F423121

General Info

Members Datasets Scaffolds Average Seq Length
363 201 726 349

Family's Representative Sequence

Representative Sequence 3300049589|Ga0501073_0000116|Ga0501073_0000116_43719_44762
Length 347
Sequence MKAVTSLGVVVLSLAVSGPAWAKTAVRILATGGTIAGAQGAGQTYGYKSGSFKVDDLIAAVPKIKDLADLTGEQVANIGSQDMNDAVWLKLSKRVNEVLGGRDVDSVVITHGTDTMEETAFFLDLTTKGDKPVVLVGSMRPATAISADGPANLYNAVSVAASPGARGRGVLVVLNDEVHAARNVTKTDTTSVQTFKSPNRGPVGLVHTAQIAWFEKMDRRRGSFDVTSLSALPRVDILYAHANMSPDLIQASVKAGAKGLVIAGVGDGNMTQPALDAVSAAAKAGVVVVRSTRLPEGLVLRNNEVNDDKMGFVASGEFTAPKARVLLQLALTKTNDVKAIQQMFDQY

Samples

Sample ID Description Type Environment
1 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
114 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
115 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
116 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
117 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
118 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
119 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
120 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
126 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
127 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
128 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
129 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
132 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
133 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
134 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
135 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
136 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
137 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
138 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
139 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
140 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
141 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
142 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
143 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
144 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
145 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
146 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
147 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
148 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
149 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
150 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
151 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
152 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
153 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
154 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
155 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
159 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
165 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
176 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
177 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
178 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
179 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
180 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
181 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
182 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
183 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
184 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
187 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
192 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
193 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
194 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
195 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
196 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
199 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
200 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
201 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 3.31
Rhizosphere 96.42
Stem 0
Stem Tuber 0
Unclassified 2.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501073_0000116 3300049589 Bacteria 51190
2 SwRhRL2b_contig_49305 2162886007 Bacteria 2120
3 MBSR1b_contig_2763132 2162886012 Bacteria 1970
4 Ga0065715_10133148 3300005293 Bacteria 1977
5 Ga0070676_10032384 3300005328 Bacteria 2994
6 Ga0070683_100212536 3300005329 Bacteria 1837
7 Ga0070690_100032545 3300005330 Bacteria 3258
8 Ga0070690_100050887 3300005330 Bacteria 2643
9 Ga0070690_100147896 3300005330 Bacteria 1600
10 Ga0070666_10005593 3300005335 Bacteria 7712
11 Ga0068868_100132387 3300005338 Bacteria 2041
12 Ga0070660_100148567 3300005339 Bacteria 1883
13 Ga0070689_100000065 3300005340 Bacteria 62971
14 Ga0070689_100019584 3300005340 Bacteria 5006
15 Ga0070689_100030837 3300005340 Bacteria 4071
16 Ga0070689_100105024 3300005340 Bacteria 2240
17 Ga0070689_100231639 3300005340 Bacteria 1519
18 Ga0070661_100263392 3300005344 Bacteria 1333
19 Ga0070692_10031779 3300005345 Bacteria 2649
20 Ga0070669_100028489 3300005353 Bacteria 4023
21 Ga0070669_100051779 3300005353 Bacteria 3002
22 Ga0070675_100078040 3300005354 Bacteria 2757
23 Ga0070675_100098199 3300005354 Bacteria 2463
24 Ga0070675_100139548 3300005354 Bacteria 2071
25 Ga0070671_100120018 3300005355 Bacteria 2212
26 Ga0070674_100000752 3300005356 Bacteria 16618
27 Ga0070674_100004872 3300005356 Bacteria 7692
28 Ga0070674_100136179 3300005356 Bacteria 1837
29 Ga0070673_100000707 3300005364 Bacteria 18413
30 Ga0070673_100008484 3300005364 Bacteria 6833
31 Ga0070673_100077702 3300005364 Bacteria 2683
32 Ga0070673_100096036 3300005364 Bacteria 2432
33 Ga0070673_100165861 3300005364 Bacteria 1882
34 Ga0070688_100000399 3300005365 Bacteria 22012
35 Ga0070688_100004943 3300005365 Bacteria 6973
36 Ga0070688_100030122 3300005365 Bacteria 3255
37 Ga0070667_100007223 3300005367 Bacteria 9231
38 Ga0070713_100328468 3300005436 Unclassified 1414
39 Ga0070701_10027055 3300005438 Bacteria 2805
40 Ga0070694_100029814 3300005444 Bacteria 3564
41 Ga0070694_100046298 3300005444 Bacteria 2920
42 Ga0070708_100102351 3300005445 Bacteria 2624
43 Ga0070678_100013516 3300005456 Bacteria 5122
44 Ga0070662_100030515 3300005457 Bacteria 3773
45 Ga0070662_100066448 3300005457 Bacteria 2645
46 Ga0068867_100039307 3300005459 Bacteria 3449
47 Ga0068867_100106613 3300005459 Bacteria 2147
48 Ga0068867_100145981 3300005459 Bacteria 1854
49 Ga0070698_100012055 3300005471 Bacteria 9166
50 Ga0070699_100106728 3300005518 Bacteria 2457
51 Ga0070699_100340818 3300005518 Bacteria 1349
52 Ga0070684_100070264 3300005535 Bacteria 3080
53 Ga0068853_100273071 3300005539 Bacteria 1557
54 Ga0070672_100000292 3300005543 Bacteria 28317
55 Ga0070672_100013051 3300005543 Bacteria 5854
56 Ga0070672_100136142 3300005543 Bacteria 2023
57 Ga0070672_100167592 3300005543 Bacteria 1825
58 Ga0070686_100035732 3300005544 Bacteria 3070
59 Ga0070665_100018174 3300005548 Bacteria 7052
60 Ga0070704_100005208 3300005549 Bacteria 7565
61 Ga0070704_100025007 3300005549 Bacteria 3926
62 Ga0068852_100005919 3300005616 Bacteria 8792
63 Ga0068852_100073194 3300005616 Bacteria 3014
64 Ga0068859_100004821 3300005617 Bacteria 13736
65 Ga0068859_100118676 3300005617 Bacteria 2711
66 Ga0068859_100181428 3300005617 Bacteria 2188
67 Ga0068859_100239702 3300005617 Bacteria 1902
68 Ga0068864_100082345 3300005618 Bacteria 2823
69 Ga0068864_100093586 3300005618 Bacteria 2655
70 Ga0068861_100014716 3300005719 Bacteria 5495
71 Ga0068858_100010360 3300005842 Bacteria 8830
72 Ga0068858_100046754 3300005842 Bacteria 4012
73 Ga0068860_100039295 3300005843 Bacteria 4526
74 Ga0075365_10041923 3300006038 Bacteria 2991
75 Ga0070712_100041130 3300006175 Bacteria 3172
76 Ga0097621_100009744 3300006237 Bacteria 6993
77 Ga0097621_100010806 3300006237 Bacteria 6699
78 Ga0097621_100029089 3300006237 Bacteria 4361
79 Ga0068871_100004437 3300006358 Bacteria 9764
80 Ga0068871_100041468 3300006358 Bacteria 3691
81 Ga0075428_100000459 3300006844 Bacteria 40878
82 Ga0075428_100003716 3300006844 Bacteria 16723
83 Ga0075428_100004719 3300006844 Bacteria 15084
84 Ga0075430_100033368 3300006846 Bacteria 4369
85 Ga0075431_100004145 3300006847 Bacteria 14153
86 Ga0075431_100046305 3300006847 Bacteria 4485
87 Ga0075431_100214974 3300006847 Bacteria 1963
88 Ga0075433_10037703 3300006852 Bacteria 4171
89 Ga0075433_10081485 3300006852 Bacteria 2854
90 Ga0075434_100026279 3300006871 Bacteria 5701
91 Ga0075434_100066025 3300006871 Bacteria 3604
92 Ga0075429_100004746 3300006880 Bacteria 11697
93 Ga0075429_100232859 3300006880 Bacteria 1613
94 Ga0068865_100022000 3300006881 Bacteria 4152
95 Ga0068865_100023262 3300006881 Bacteria 4056
96 Ga0068865_100098871 3300006881 Bacteria 2132
97 Ga0068865_100228835 3300006881 Bacteria 1457
98 Ga0097620_100004821 3300006931 Bacteria 13736
99 Ga0097620_100118677 3300006931 Bacteria 2711
100 Ga0097620_100181423 3300006931 Bacteria 2188
101 Ga0097620_100239700 3300006931 Bacteria 1902
102 Ga0111539_10000146 3300009094 Bacteria 81417
103 Ga0111539_10000960 3300009094 Bacteria 37825
104 Ga0111539_10013912 3300009094 Bacteria 10060
105 Ga0111539_10063711 3300009094 Bacteria 4362
106 Ga0111539_10079468 3300009094 Bacteria 3858
107 Ga0111539_10188625 3300009094 Bacteria 2406
108 Ga0111539_10198749 3300009094 Bacteria 2338
109 Ga0105245_10185481 3300009098 Bacteria 1990
110 Ga0114129_10000208 3300009147 Bacteria 65620
111 Ga0114129_10008086 3300009147 Bacteria 14985
112 Ga0114129_10136355 3300009147 Bacteria 3367
113 Ga0114129_10328567 3300009147 Bacteria 2031
114 Ga0105243_10312382 3300009148 Bacteria 1429
115 Ga0105242_10026480 3300009176 Bacteria 4597
116 Ga0105242_10170161 3300009176 Bacteria 1914
117 Ga0105248_10013496 3300009177 Bacteria 8995
118 Ga0105248_10019337 3300009177 Bacteria 7536
119 Ga0105248_10020626 3300009177 Bacteria 7304
120 Ga0105248_10073973 3300009177 Bacteria 3830
121 Ga0105248_10142856 3300009177 Bacteria 2700
122 Ga0105248_10643756 3300009177 Bacteria 1196
123 Ga0105238_10274310 3300009551 Bacteria 1667
124 Ga0105249_10150371 3300009553 Unclassified 2241
125 Ga0157370_10147281 3300013104 Bacteria 2192
126 Ga0157374_10010732 3300013296 Bacteria 7894
127 Ga0157374_10151231 3300013296 Bacteria 2257
128 Ga0157378_10000644 3300013297 Bacteria 32810
129 Ga0157378_10002170 3300013297 Bacteria 17422
130 Ga0157378_10009766 3300013297 Bacteria 8365
131 Ga0157378_10261102 3300013297 Unclassified 1662
132 Ga0163162_10182408 3300013306 Bacteria 2225
133 Ga0163162_10388447 3300013306 Bacteria 1529
134 Ga0163162_10438648 3300013306 Bacteria 1438
135 Ga0157372_10164193 3300013307 Bacteria 2568
136 Ga0157375_10000235 3300013308 Bacteria 51203
137 Ga0157375_10013530 3300013308 Bacteria 7264
138 Ga0157375_10022004 3300013308 Bacteria 5862
139 Ga0157375_10183793 3300013308 Bacteria 2243
140 Ga0163163_10009282 3300014325 Bacteria 8773
141 Ga0163163_10269330 3300014325 Bacteria 1754
142 Ga0157380_10000669 3300014326 Bacteria 21228
143 Ga0157377_10057141 3300014745 Bacteria 2218
144 Ga0157379_10012615 3300014968 Bacteria 7382
145 Ga0157376_10005180 3300014969 Bacteria 9093
146 Ga0163161_10188339 3300017792 Bacteria 1585
147 Ga0207697_10054943 3300025315 Bacteria 1650
148 Ga0207680_10002491 3300025903 Bacteria 8595
149 Ga0207680_10030768 3300025903 Bacteria 3033
150 Ga0207685_10099500 3300025905 Bacteria 1240
151 Ga0207645_10001685 3300025907 Bacteria 17959
152 Ga0207645_10023116 3300025907 Unclassified 4041
153 Ga0207657_10151688 3300025919 Bacteria 1887
154 Ga0207646_10323308 3300025922 Bacteria 1394
155 Ga0207681_10015819 3300025923 Bacteria 4709
156 Ga0207681_10024942 3300025923 Bacteria 3842
157 Ga0207650_10258916 3300025925 Bacteria 1411
158 Ga0207659_10002574 3300025926 Bacteria 10800
159 Ga0207659_10108443 3300025926 Bacteria 2106
160 Ga0207687_10030311 3300025927 Bacteria 3646
161 Ga0207644_10001401 3300025931 Bacteria 15540
162 Ga0207644_10015399 3300025931 Bacteria 5131
163 Ga0207644_10073919 3300025931 Bacteria 2500
164 Ga0207644_10082530 3300025931 Bacteria 2378
165 Ga0207690_10030871 3300025932 Bacteria 3423
166 Ga0207706_10020935 3300025933 Bacteria 5873
167 Ga0207706_10117482 3300025933 Bacteria 2339
168 Ga0207686_10169626 3300025934 Bacteria 1538
169 Ga0207670_10000012 3300025936 Bacteria 246808
170 Ga0207670_10369701 3300025936 Bacteria 1139
171 Ga0207669_10006105 3300025937 Bacteria 5472
172 Ga0207669_10008584 3300025937 Bacteria 4806
173 Ga0207669_10031293 3300025937 Bacteria 2971
174 Ga0207691_10003838 3300025940 Bacteria 14581
175 Ga0207691_10010633 3300025940 Bacteria 8831
176 Ga0207691_10146136 3300025940 Bacteria 2081
177 Ga0207711_10002723 3300025941 Bacteria 15582
178 Ga0207711_10011744 3300025941 Bacteria 7276
179 Ga0207711_10134889 3300025941 Bacteria 2216
180 Ga0207711_10299358 3300025941 Bacteria 1483
181 Ga0207689_10004491 3300025942 Bacteria 12645
182 Ga0207651_10000452 3300025960 Bacteria 17343
183 Ga0207651_10063112 3300025960 Bacteria 2585
184 Ga0207668_10044390 3300025972 Bacteria 3023
185 Ga0207658_10092246 3300025986 Bacteria 2352
186 Ga0207677_10070665 3300026023 Bacteria 2461
187 Ga0207677_10312865 3300026023 Bacteria 1302
188 Ga0207703_10012592 3300026035 Bacteria 6594
189 Ga0207703_10025145 3300026035 Bacteria 4683
190 Ga0207703_10072849 3300026035 Bacteria 2840
191 Ga0207639_10225404 3300026041 Unclassified 1621
192 Ga0207708_10269130 3300026075 Bacteria 1378
193 Ga0207641_10020107 3300026088 Bacteria 5481
194 Ga0207641_10042350 3300026088 Bacteria 3820
195 Ga0207648_10047544 3300026089 Bacteria 3760
196 Ga0207648_10137267 3300026089 Bacteria 2154
197 Ga0207648_10183380 3300026089 Bacteria 1853
198 Ga0207676_10086450 3300026095 Bacteria 2562
199 Ga0207675_100006793 3300026118 Bacteria 10829
200 Ga0207675_100075786 3300026118 Bacteria 3149
201 Ga0207675_100111127 3300026118 Bacteria 2586
202 Ga0207683_10001538 3300026121 Bacteria 20801
203 Ga0207683_10002371 3300026121 Bacteria 16461
204 Ga0207683_10084814 3300026121 Bacteria 2816
205 Ga0207683_10150700 3300026121 Unclassified 2099
206 Ga0207698_10013755 3300026142 Bacteria 5353
207 Ga0207428_10053735 3300027907 Bacteria 3211
208 Ga0207428_10066071 3300027907 Bacteria 2850
209 Ga0207428_10171438 3300027907 Bacteria 1643
210 Ga0207428_10220458 3300027907 Bacteria 1422
211 Ga0268264_10156738 3300028381 Bacteria 2047
212 Ga0307410_10001696 3300031852 Bacteria 10146
213 Ga0307409_100125497 3300031995 Bacteria 2182
214 Ga0307416_100302857 3300032002 Bacteria 1590
215 Ga0307414_10045196 3300032004 Bacteria 3014
216 Ga0307411_10024553 3300032005 Bacteria 3595
217 Ga0307411_10153988 3300032005 Bacteria 1712
218 Ga0373950_0000004 3300034818 Bacteria 527382
219 Ga0373934_0003062 3300035086 Bacteria 6107
220 Ga0373957_0028388 3300035120 Bacteria 2039
221 Ga0373943_0008975 3300035170 Bacteria 4481
222 Ga0373946_0031070 3300035171 Bacteria 2136
223 Ga0373946_0103248 3300035171 Bacteria 1281
224 Ga0373955_0107587 3300035172 Bacteria 1609
225 Ga0373933_0001000 3300035724 Bacteria 17250
226 Ga0373947_0010237 3300035725 Bacteria 5384
227 Ga0373937_0020254 3300036401 Bacteria 5962
228 Ga0373937_0080840 3300036401 Bacteria 3006
229 Ga0373937_0221676 3300036401 Bacteria 1780
230 Ga0373937_0229474 3300036401 Bacteria 1748
231 Ga0316584_0006955 3300036712 Bacteria 7695
232 Ga0373925_0000037 3300037068 Bacteria 143020
233 Ga0373925_0237442 3300037068 Bacteria 1459
234 Ga0373925_0255698 3300037068 Unclassified 1406
235 Ga0373925_0286418 3300037068 Bacteria 1328
236 Ga0395905_0000582 3300037471 Bacteria 49196
237 Ga0395905_0006643 3300037471 Bacteria 11598
238 Ga0395905_0153695 3300037471 Unclassified 2164
239 Ga0395905_0479159 3300037471 Bacteria 1144
240 Ga0450894_002283 3300042131 Bacteria 2598
241 Ga0439435_0000452 3300042436 Bacteria 6456
242 Ga0451577_0093532 3300042876 Bacteria 2685
243 Ga0451577_0107076 3300042876 Bacteria 2499
244 Ga0453683_0013301 3300044673 Bacteria 5378
245 Ga0466971_0084232 3300044719 Bacteria 1452
246 Ga0451576_0010311 3300045051 Bacteria 10727
247 Ga0451576_0035205 3300045051 Bacteria 5313
248 Ga0451576_0045336 3300045051 Bacteria 4631
249 Ga0451576_0053094 3300045051 Bacteria 4247
250 Ga0451576_0117273 3300045051 Bacteria 2771
251 Ga0451576_0264336 3300045051 Bacteria 1798
252 Ga0495592_0066081 3300046454 Bacteria 2647
253 Ga0495603_0068912 3300046455 Bacteria 2081
254 Ga0495603_0117742 3300046455 Bacteria 1549
255 Ga0495651_0123323 3300046462 Bacteria 1901
256 Ga0495639_0000054 3300046475 Bacteria 50497
257 Ga0495594_0013029 3300046499 Bacteria 4336
258 Ga0495594_0027190 3300046499 Bacteria 3082
259 Ga0495630_0007013 3300046517 Bacteria 8032
260 Ga0495630_0074267 3300046517 Bacteria 2561
261 Ga0495630_0236860 3300046517 Bacteria 1395
262 Ga0495663_0039483 3300046525 Bacteria 1430
263 Ga0495666_0000001 3300046526 Bacteria 147374
264 Ga0495640_0104935 3300046533 Bacteria 1852
265 Ga0495586_0000007 3300046535 Bacteria 153732
266 Ga0495586_0015659 3300046535 Bacteria 4035
267 Ga0495598_0073106 3300046537 Bacteria 1084
268 Ga0495621_0054274 3300046539 Bacteria 1440
269 Ga0495667_0022770 3300046559 Bacteria 4220
270 Ga0495667_0060450 3300046559 Bacteria 2485
271 Ga0495634_0004288 3300046642 Bacteria 11240
272 Ga0495657_0027340 3300046675 Bacteria 4028
273 Ga0495599_0034511 3300046678 Bacteria 3178
274 Ga0495599_0062637 3300046678 Bacteria 2324
275 Ga0495658_0004675 3300046683 Bacteria 6735
276 Ga0495658_0005504 3300046683 Bacteria 6226
277 Ga0495658_0030174 3300046683 Bacteria 2942
278 Ga0495669_0006840 3300046684 Bacteria 4772
279 Ga0495613_0181454 3300046689 Bacteria 1490
280 Ga0495636_0030499 3300047318 Bacteria 2205
281 Ga0495676_0001693 3300047321 Bacteria 19268
282 Ga0495680_0025424 3300047322 Bacteria 4900
283 Ga0495680_0221681 3300047322 Bacteria 1350
284 Ga0495677_0003699 3300047445 Bacteria 5922
285 Ga0495615_0024846 3300048090 Unclassified 1386
286 Ga0496100_0022711 3300048903 Bacteria 3800
287 Ga0496101_0011453 3300048904 Bacteria 5887
288 Ga0496106_0247411 3300048909 Unclassified 1425
289 Ga0496107_0068946 3300048910 Bacteria 2566
290 Ga0496108_0007970 3300048911 Bacteria 8592
291 Ga0496108_0014036 3300048911 Bacteria 6536
292 Ga0496110_0090538 3300048913 Bacteria 2735
293 Ga0496111_0122448 3300048914 Bacteria 1921
294 Ga0496112_0057327 3300048915 Bacteria 3835
295 Ga0496112_0151767 3300048915 Bacteria 2284
296 Ga0496114_0024235 3300048917 Bacteria 4952
297 Ga0496115_0094925 3300048918 Bacteria 2441
298 Ga0501031_0084332 3300049568 Bacteria 2071
299 Ga0501033_0012779 3300049570 Bacteria 6402
300 Ga0501036_0003473 3300049572 Bacteria 12596
301 Ga0501036_0197923 3300049572 Bacteria 1690
302 Ga0501036_0206790 3300049572 Bacteria 1650
303 Ga0501038_0002013 3300049574 Bacteria 18771
304 Ga0501039_0026867 3300049575 Bacteria 4424
305 Ga0501039_0063092 3300049575 Bacteria 2871
306 Ga0501040_0000999 3300049576 Bacteria 17899
307 Ga0501040_0014522 3300049576 Bacteria 5191
308 Ga0501040_0038713 3300049576 Bacteria 3241
309 Ga0501040_0046732 3300049576 Bacteria 2955
310 Ga0501041_0000056 3300049577 Bacteria 40879
311 Ga0501041_0065291 3300049577 Bacteria 2229
312 Ga0501042_0001793 3300049578 Bacteria 12844
313 Ga0501043_0034513 3300049579 Bacteria 3978
314 Ga0501048_0003052 3300049582 Bacteria 12759
315 Ga0501048_0136394 3300049582 Bacteria 1734
316 Ga0501067_0000047 3300049583 Bacteria 71799
317 Ga0501068_0060505 3300049584 Bacteria 2300
318 Ga0501069_0008432 3300049585 Bacteria 5418
319 Ga0501069_0180710 3300049585 Bacteria 1219
320 Ga0501070_0000004 3300049586 Bacteria 254956
321 Ga0501071_0000181 3300049587 Bacteria 27971
322 Ga0501072_0002955 3300049588 Bacteria 12802
323 Ga0501073_0007393 3300049589 Bacteria 8166
324 Ga0501073_0187361 3300049589 Bacteria 1432
325 Ga0501074_0054760 3300049590 Bacteria 2876
326 Ga0501075_0000781 3300049591 Bacteria 19885
327 Ga0501075_0006874 3300049591 Bacteria 7857
328 Ga0501075_0167498 3300049591 Bacteria 1676
329 Ga0501076_0000164 3300049592 Bacteria 38475
330 Ga0501076_0082108 3300049592 Bacteria 2587
331 Ga0501079_0002624 3300049741 Bacteria 13071
332 Ga0501079_0063262 3300049741 Bacteria 2855
333 Ga0501080_0263940 3300049742 Bacteria 1568
334 Ga0501081_0000077 3300049743 Bacteria 38611
335 Ga0501081_0072388 3300049743 Bacteria 2403
336 Ga0501083_0024489 3300049744 Bacteria 4181
337 Ga0501083_0034708 3300049744 Bacteria 3448
338 Ga0501035_0011181 3300049822 Bacteria 8312
339 Ga0501045_0001345 3300049824 Bacteria 16303
340 Ga0501045_0087957 3300049824 Bacteria 2294
341 Ga0501045_0129419 3300049824 Bacteria 1876
342 nmdc:mga05p37_5476_c1 3300050507 Bacteria 14906
343 nmdc:mga05p37_668_c1 3300050507 Bacteria 37837
344 nmdc:mga05p37_99827_c1 3300050507 Bacteria 3574
345 nmdc:mga09592_22892_c1 3300050508 Bacteria 5155
346 nmdc:mga09592_231799_c1 3300050508 Bacteria 1600
347 nmdc:mga0qj67_152315_c1 3300050509 Bacteria 1876
348 nmdc:mga06r32_48952_c1 3300050510 Bacteria 4042
349 nmdc:mga08y16_310582_c1 3300050511 Bacteria 1624
350 nmdc:mga08y16_382716_c1 3300050511 Bacteria 1442
351 nmdc:mga08y16_448_c1 3300050511 Bacteria 38218
352 nmdc:mga08y16_5568_c1 3300050511 Bacteria 13191
353 nmdc:mga08y16_69687_c1 3300050511 Bacteria 3666
354 nmdc:mga0n895_33910_c1 3300050512 Bacteria 4910
355 nmdc:mga0rr50_23410_c1 3300050513 Bacteria 4259
356 nmdc:mga0a205_31680_c1 3300050515 Bacteria 5067
357 nmdc:mga0a205_36375_c1 3300050515 Bacteria 4730
358 Ga0495619_0123472 3300053085 Bacteria 1776
359 Ga0501084_0264461 3300054114 Bacteria 1452
360 Ga0501082_0001219 3300060353 Bacteria 22593
361 Ga0501082_0002918 3300060353 Bacteria 14920
362 Ga0501082_0272342 3300060353 Bacteria 1473
363 Ga0530510_0000438 3300061734 Bacteria 26867
364 Ga0501073_0000116
365 SwRhRL2b_contig_49305
366 MBSR1b_contig_2763132
367 Ga0065715_10133148
368 Ga0070676_10032384
369 Ga0070683_100212536
370 Ga0070690_100032545
371 Ga0070690_100050887
372 Ga0070690_100147896
373 Ga0070666_10005593
374 Ga0068868_100132387
375 Ga0070660_100148567
376 Ga0070689_100000065
377 Ga0070689_100019584
378 Ga0070689_100030837
379 Ga0070689_100105024
380 Ga0070689_100231639
381 Ga0070661_100263392
382 Ga0070692_10031779
383 Ga0070669_100028489
384 Ga0070669_100051779
385 Ga0070675_100078040
386 Ga0070675_100098199
387 Ga0070675_100139548
388 Ga0070671_100120018
389 Ga0070674_100000752
390 Ga0070674_100004872
391 Ga0070674_100136179
392 Ga0070673_100000707
393 Ga0070673_100008484
394 Ga0070673_100077702
395 Ga0070673_100096036
396 Ga0070673_100165861
397 Ga0070688_100000399
398 Ga0070688_100004943
399 Ga0070688_100030122
400 Ga0070667_100007223
401 Ga0070713_100328468
402 Ga0070701_10027055
403 Ga0070694_100029814
404 Ga0070694_100046298
405 Ga0070708_100102351
406 Ga0070678_100013516
407 Ga0070662_100030515
408 Ga0070662_100066448
409 Ga0068867_100039307
410 Ga0068867_100106613
411 Ga0068867_100145981
412 Ga0070698_100012055
413 Ga0070699_100106728
414 Ga0070699_100340818
415 Ga0070684_100070264
416 Ga0068853_100273071
417 Ga0070672_100000292
418 Ga0070672_100013051
419 Ga0070672_100136142
420 Ga0070672_100167592
421 Ga0070686_100035732
422 Ga0070665_100018174
423 Ga0070704_100005208
424 Ga0070704_100025007
425 Ga0068852_100005919
426 Ga0068852_100073194
427 Ga0068859_100004821
428 Ga0068859_100118676
429 Ga0068859_100181428
430 Ga0068859_100239702
431 Ga0068864_100082345
432 Ga0068864_100093586
433 Ga0068861_100014716
434 Ga0068858_100010360
435 Ga0068858_100046754
436 Ga0068860_100039295
437 Ga0075365_10041923
438 Ga0070712_100041130
439 Ga0097621_100009744
440 Ga0097621_100010806
441 Ga0097621_100029089
442 Ga0068871_100004437
443 Ga0068871_100041468
444 Ga0075428_100000459
445 Ga0075428_100003716
446 Ga0075428_100004719
447 Ga0075430_100033368
448 Ga0075431_100004145
449 Ga0075431_100046305
450 Ga0075431_100214974
451 Ga0075433_10037703
452 Ga0075433_10081485
453 Ga0075434_100026279
454 Ga0075434_100066025
455 Ga0075429_100004746
456 Ga0075429_100232859
457 Ga0068865_100022000
458 Ga0068865_100023262
459 Ga0068865_100098871
460 Ga0068865_100228835
461 Ga0097620_100004821
462 Ga0097620_100118677
463 Ga0097620_100181423
464 Ga0097620_100239700
465 Ga0111539_10000146
466 Ga0111539_10000960
467 Ga0111539_10013912
468 Ga0111539_10063711
469 Ga0111539_10079468
470 Ga0111539_10188625
471 Ga0111539_10198749
472 Ga0105245_10185481
473 Ga0114129_10000208
474 Ga0114129_10008086
475 Ga0114129_10136355
476 Ga0114129_10328567
477 Ga0105243_10312382
478 Ga0105242_10026480
479 Ga0105242_10170161
480 Ga0105248_10013496
481 Ga0105248_10019337
482 Ga0105248_10020626
483 Ga0105248_10073973
484 Ga0105248_10142856
485 Ga0105248_10643756
486 Ga0105238_10274310
487 Ga0105249_10150371
488 Ga0157370_10147281
489 Ga0157374_10010732
490 Ga0157374_10151231
491 Ga0157378_10000644
492 Ga0157378_10002170
493 Ga0157378_10009766
494 Ga0157378_10261102
495 Ga0163162_10182408
496 Ga0163162_10388447
497 Ga0163162_10438648
498 Ga0157372_10164193
499 Ga0157375_10000235
500 Ga0157375_10013530
501 Ga0157375_10022004
502 Ga0157375_10183793
503 Ga0163163_10009282
504 Ga0163163_10269330
505 Ga0157380_10000669
506 Ga0157377_10057141
507 Ga0157379_10012615
508 Ga0157376_10005180
509 Ga0163161_10188339
510 Ga0207697_10054943
511 Ga0207680_10002491
512 Ga0207680_10030768
513 Ga0207685_10099500
514 Ga0207645_10001685
515 Ga0207645_10023116
516 Ga0207657_10151688
517 Ga0207646_10323308
518 Ga0207681_10015819
519 Ga0207681_10024942
520 Ga0207650_10258916
521 Ga0207659_10002574
522 Ga0207659_10108443
523 Ga0207687_10030311
524 Ga0207644_10001401
525 Ga0207644_10015399
526 Ga0207644_10073919
527 Ga0207644_10082530
528 Ga0207690_10030871
529 Ga0207706_10020935
530 Ga0207706_10117482
531 Ga0207686_10169626
532 Ga0207670_10000012
533 Ga0207670_10369701
534 Ga0207669_10006105
535 Ga0207669_10008584
536 Ga0207669_10031293
537 Ga0207691_10003838
538 Ga0207691_10010633
539 Ga0207691_10146136
540 Ga0207711_10002723
541 Ga0207711_10011744
542 Ga0207711_10134889
543 Ga0207711_10299358
544 Ga0207689_10004491
545 Ga0207651_10000452
546 Ga0207651_10063112
547 Ga0207668_10044390
548 Ga0207658_10092246
549 Ga0207677_10070665
550 Ga0207677_10312865
551 Ga0207703_10012592
552 Ga0207703_10025145
553 Ga0207703_10072849
554 Ga0207639_10225404
555 Ga0207708_10269130
556 Ga0207641_10020107
557 Ga0207641_10042350
558 Ga0207648_10047544
559 Ga0207648_10137267
560 Ga0207648_10183380
561 Ga0207676_10086450
562 Ga0207675_100006793
563 Ga0207675_100075786
564 Ga0207675_100111127
565 Ga0207683_10001538
566 Ga0207683_10002371
567 Ga0207683_10084814
568 Ga0207683_10150700
569 Ga0207698_10013755
570 Ga0207428_10053735
571 Ga0207428_10066071
572 Ga0207428_10171438
573 Ga0207428_10220458
574 Ga0268264_10156738
575 Ga0307410_10001696
576 Ga0307409_100125497
577 Ga0307416_100302857
578 Ga0307414_10045196
579 Ga0307411_10024553
580 Ga0307411_10153988
581 Ga0373950_0000004
582 Ga0373934_0003062
583 Ga0373957_0028388
584 Ga0373943_0008975
585 Ga0373946_0031070
586 Ga0373946_0103248
587 Ga0373955_0107587
588 Ga0373933_0001000
589 Ga0373947_0010237
590 Ga0373937_0020254
591 Ga0373937_0080840
592 Ga0373937_0221676
593 Ga0373937_0229474
594 Ga0316584_0006955
595 Ga0373925_0000037
596 Ga0373925_0237442
597 Ga0373925_0255698
598 Ga0373925_0286418
599 Ga0395905_0000582
600 Ga0395905_0006643
601 Ga0395905_0153695
602 Ga0395905_0479159
603 Ga0450894_002283
604 Ga0439435_0000452
605 Ga0451577_0093532
606 Ga0451577_0107076
607 Ga0453683_0013301
608 Ga0466971_0084232
609 Ga0451576_0010311
610 Ga0451576_0035205
611 Ga0451576_0045336
612 Ga0451576_0053094
613 Ga0451576_0117273
614 Ga0451576_0264336
615 Ga0495592_0066081
616 Ga0495603_0068912
617 Ga0495603_0117742
618 Ga0495651_0123323
619 Ga0495639_0000054
620 Ga0495594_0013029
621 Ga0495594_0027190
622 Ga0495630_0007013
623 Ga0495630_0074267
624 Ga0495630_0236860
625 Ga0495663_0039483
626 Ga0495666_0000001
627 Ga0495640_0104935
628 Ga0495586_0000007
629 Ga0495586_0015659
630 Ga0495598_0073106
631 Ga0495621_0054274
632 Ga0495667_0022770
633 Ga0495667_0060450
634 Ga0495634_0004288
635 Ga0495657_0027340
636 Ga0495599_0034511
637 Ga0495599_0062637
638 Ga0495658_0004675
639 Ga0495658_0005504
640 Ga0495658_0030174
641 Ga0495669_0006840
642 Ga0495613_0181454
643 Ga0495636_0030499
644 Ga0495676_0001693
645 Ga0495680_0025424
646 Ga0495680_0221681
647 Ga0495677_0003699
648 Ga0495615_0024846
649 Ga0496100_0022711
650 Ga0496101_0011453
651 Ga0496106_0247411
652 Ga0496107_0068946
653 Ga0496108_0007970
654 Ga0496108_0014036
655 Ga0496110_0090538
656 Ga0496111_0122448
657 Ga0496112_0057327
658 Ga0496112_0151767
659 Ga0496114_0024235
660 Ga0496115_0094925
661 Ga0501031_0084332
662 Ga0501033_0012779
663 Ga0501036_0003473
664 Ga0501036_0197923
665 Ga0501036_0206790
666 Ga0501038_0002013
667 Ga0501039_0026867
668 Ga0501039_0063092
669 Ga0501040_0000999
670 Ga0501040_0014522
671 Ga0501040_0038713
672 Ga0501040_0046732
673 Ga0501041_0000056
674 Ga0501041_0065291
675 Ga0501042_0001793
676 Ga0501043_0034513
677 Ga0501048_0003052
678 Ga0501048_0136394
679 Ga0501067_0000047
680 Ga0501068_0060505
681 Ga0501069_0008432
682 Ga0501069_0180710
683 Ga0501070_0000004
684 Ga0501071_0000181
685 Ga0501072_0002955
686 Ga0501073_0007393
687 Ga0501073_0187361
688 Ga0501074_0054760
689 Ga0501075_0000781
690 Ga0501075_0006874
691 Ga0501075_0167498
692 Ga0501076_0000164
693 Ga0501076_0082108
694 Ga0501079_0002624
695 Ga0501079_0063262
696 Ga0501080_0263940
697 Ga0501081_0000077
698 Ga0501081_0072388
699 Ga0501083_0024489
700 Ga0501083_0034708
701 Ga0501035_0011181
702 Ga0501045_0001345
703 Ga0501045_0087957
704 Ga0501045_0129419
705 nmdc:mga05p37_5476_c1
706 nmdc:mga05p37_668_c1
707 nmdc:mga05p37_99827_c1
708 nmdc:mga09592_22892_c1
709 nmdc:mga09592_231799_c1
710 nmdc:mga0qj67_152315_c1
711 nmdc:mga06r32_48952_c1
712 nmdc:mga08y16_310582_c1
713 nmdc:mga08y16_382716_c1
714 nmdc:mga08y16_448_c1
715 nmdc:mga08y16_5568_c1
716 nmdc:mga08y16_69687_c1
717 nmdc:mga0n895_33910_c1
718 nmdc:mga0rr50_23410_c1
719 nmdc:mga0a205_31680_c1
720 nmdc:mga0a205_36375_c1
721 Ga0495619_0123472
722 Ga0501084_0264461
723 Ga0501082_0001219
724 Ga0501082_0002918
725 Ga0501082_0272342
726 Ga0530510_0000438

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17763

Asparaginase_C

Glutaminase/Asparaginase C-terminal domain

234

344

0.99

PF00710

Asparaginase

Asparaginase, N-terminal

25

219

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rue-assembly1.cif.gz_B wolinella succinogenes l-asparaginase mutant v23q,k24t with l-asp 0.97 29 356
6v29-assembly1.cif.gz_B-2 complex of double mutant (t89v,k162t) of e. coli l-asparaginase ii with l-asp 0.9686 29 356
6rue-assembly1.cif.gz_C wolinella succinogenes l-asparaginase mutant v23q,k24t with l-asp 0.9675 29 356
8ece-assembly1.cif.gz_C e. coli l-asparaginase ii mutant (v27t) in complex with l-glu 0.9672 31 356
6eok-assembly1.cif.gz_C crystal structure of e. coli l-asparaginase ii 0.9672 30 356
ID Description Score Start End Superfamily
2wt4A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9833 243 355 3.40.50.40
3ecaB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9785 243 356 3.40.50.40
2wt4A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9747 243 355 3.40.50.40
1djoB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9737 243 355 3.40.50.40
3ecaB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9701 243 356 3.40.50.40
ID Description Score Start End GO Terms
AF-A0A661RFN5-F1-model_v4 L-asparaginase 2 (EC 3.5.1.1) 0.9901 231 356 GO:0004067
AF-J0K2D7-F1-model_v4 L-asparaginase (EC 3.5.1.1) 0.9876 241 356 GO:0004067
AF-A0A2V9VB70-F1-model_v4 L-asparaginase 2 (EC 3.5.1.1) 0.9866 203 356 GO:0004067
AF-E8KJ48-F1-model_v4 Asparaginase/glutaminase C-terminal domain-containing protein 0.9864 251 356 GO:0004067
AF-A0A376VCG1-F1-model_v4 L-asparaginase 2 (EC 3.5.1.1) 0.9851 231 356 GO:0004067

Map