F423128

General Info

Members Datasets Scaffolds Average Seq Length
363 216 353 231

Family's Representative Sequence

Representative Sequence 3300050508|nmdc:mga09592_390836_c1|nmdc:mga09592_390836_c1_325_1026
Length 226
Sequence MKIKTKSKKVNKAWLHDHLTDPYVKLAQKEGYRARAAYKLKEIDEELKLLKPGQLVVDLGATPGAWSQYVRRKFAPRDAGAGLNGTIIALDLLEFEPIEGVTFIQGDFRDEAVLRKLEEAVAGRPVDVVVSDMAPNLSGIESSDSARIAHLVELAVEFASHHLVPGGALVCKVFHGSGYSQLVKLFKERFRAVKALKPKASRDKSAETFLIGIGLKAPKAPADTLS

Samples

Sample ID Description Type Environment
1 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
2 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
3 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
4 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
5 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
6 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
7 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
8 2831864461 Roseateles noduli HZ7 Isolate Nodule
9 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
10 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
72 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
73 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
76 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
113 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
119 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
120 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
121 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
122 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
123 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
124 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
125 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
128 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
129 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
137 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
143 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
144 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
145 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
146 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
147 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
148 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
149 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
150 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
151 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
152 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
153 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
154 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
155 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
156 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
157 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
158 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
159 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
160 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
164 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
165 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
166 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
167 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
168 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
169 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
170 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
171 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
172 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
173 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
174 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
175 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
181 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
182 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
183 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
184 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
189 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
190 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
191 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
192 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
193 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
194 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
195 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
196 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
197 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
198 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
199 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
200 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
201 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
202 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
203 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
204 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
205 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
206 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
207 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
208 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
209 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
210 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
211 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
212 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
213 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
214 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
215 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
216 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.52
Metatranscriptomes 0
Isolates 2.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 31.13
Nodule 0.83
Rhizoplane 1.38
Rhizosphere 53.17
Stem 0
Stem Tuber 0
Unclassified 13.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000879 3300002773 Bacteria 14787
2 JGI25153J46596_10007460 3300003215 Bacteria 5374
3 JGI25153J46596_10025081 3300003215 Bacteria 2137
4 rootH1_10035191 3300003316 Bacteria 3297
5 rootL2_10000586 3300003322 Bacteria 75859
6 rootL2_10038809 3300003322 Bacteria 2253
7 Ga0055526_1000295 3300003771 Bacteria 41778
8 Ga0055526_1002679 3300003771 Bacteria 11890
9 Ga0055524_1001033 3300003775 Bacteria 17200
10 Ga0055524_1007921 3300003775 Bacteria 4464
11 Ga0055531_10002715 3300003794 Bacteria 11655
12 Ga0055531_10010048 3300003794 Bacteria 4756
13 Ga0065165_1000024 3300005262 Bacteria 247672
14 Ga0065165_1001470 3300005262 Bacteria 25178
15 Ga0065715_10125640 3300005293 Bacteria 2126
16 Ga0070658_10389002 3300005327 Bacteria 1197
17 Ga0070676_10007760 3300005328 Bacteria 5762
18 Ga0070676_10199544 3300005328 Bacteria 1311
19 Ga0070670_100007532 3300005331 Bacteria 9240
20 Ga0070677_10019828 3300005333 Bacteria 2441
21 Ga0068869_100532482 3300005334 Bacteria 985
22 Ga0068869_100741023 3300005334 Bacteria 841
23 Ga0070660_100449270 3300005339 Bacteria 1069
24 Ga0070661_100118496 3300005344 Bacteria 1981
25 Ga0070668_100258353 3300005347 Bacteria 1448
26 Ga0070669_100121828 3300005353 Bacteria 1991
27 Ga0070675_100017023 3300005354 Bacteria 5777
28 Ga0070675_100031534 3300005354 Bacteria 4285
29 Ga0070671_100032136 3300005355 Bacteria 4340
30 Ga0070671_100307742 3300005355 Bacteria 1349
31 Ga0070674_100006941 3300005356 Bacteria 6640
32 Ga0070674_100108710 3300005356 Bacteria 2032
33 Ga0070673_100011778 3300005364 Bacteria 5982
34 Ga0070667_100003516 3300005367 Bacteria 13347
35 Ga0070667_100033268 3300005367 Bacteria 4307
36 Ga0070667_100193973 3300005367 Bacteria 1800
37 Ga0070667_100622122 3300005367 Bacteria 996
38 Ga0070663_100000599 3300005455 Bacteria 19216
39 Ga0070678_100618642 3300005456 Bacteria 968
40 Ga0070662_100036213 3300005457 Bacteria 3489
41 Ga0068867_100010817 3300005459 Bacteria 6435
42 Ga0068867_100045621 3300005459 Bacteria 3215
43 Ga0068867_100058585 3300005459 Bacteria 2854
44 Ga0068867_100091865 3300005459 Bacteria 2305
45 Ga0070707_100201378 3300005468 Bacteria 1941
46 Ga0070672_100007204 3300005543 Bacteria 7532
47 Ga0070672_100143019 3300005543 Bacteria 1975
48 Ga0070665_100023604 3300005548 Bacteria 6193
49 Ga0070665_100348723 3300005548 Bacteria 1485
50 Ga0068855_100072342 3300005563 Bacteria 4008
51 Ga0070664_100211330 3300005564 Bacteria 1734
52 Ga0068857_100037345 3300005577 Bacteria 4302
53 Ga0068857_100625613 3300005577 Bacteria 1019
54 Ga0068852_100081760 3300005616 Bacteria 2868
55 Ga0068852_100232859 3300005616 Bacteria 1757
56 Ga0068859_100301027 3300005617 Bacteria 1697
57 Ga0068864_100123457 3300005618 Bacteria 2318
58 Ga0068866_10113929 3300005718 Bacteria 1513
59 Ga0068866_10324182 3300005718 Bacteria 970
60 Ga0068851_10038265 3300005834 Bacteria 2406
61 Ga0075368_10006300 3300006042 Bacteria 4139
62 Ga0075368_10007041 3300006042 Bacteria 3958
63 Ga0075363_100056836 3300006048 Bacteria 2098
64 Ga0075364_10022263 3300006051 Bacteria 4000
65 Ga0075364_10023406 3300006051 Bacteria 3911
66 Ga0075362_10006261 3300006177 Bacteria 4423
67 Ga0075362_10022042 3300006177 Bacteria 2679
68 Ga0075362_10032304 3300006177 Bacteria 2270
69 Ga0075367_10041429 3300006178 Bacteria 2692
70 Ga0075367_10056544 3300006178 Bacteria 2331
71 Ga0075367_10133121 3300006178 Bacteria 1538
72 Ga0075369_10002961 3300006186 Bacteria 6134
73 Ga0075369_10015809 3300006186 Bacteria 3035
74 Ga0075369_10033099 3300006186 Bacteria 2190
75 Ga0075366_10001045 3300006195 Bacteria 13589
76 Ga0075366_10004509 3300006195 Bacteria 7475
77 Ga0075366_10027029 3300006195 Bacteria 3365
78 Ga0075366_10061136 3300006195 Bacteria 2238
79 Ga0075366_10136852 3300006195 Bacteria 1479
80 Ga0075366_10164400 3300006195 Bacteria 1345
81 Ga0075370_10001744 3300006353 Bacteria 9686
82 Ga0075370_10008657 3300006353 Bacteria 5245
83 Ga0075370_10010395 3300006353 Bacteria 4866
84 Ga0075370_10011034 3300006353 Bacteria 4738
85 Ga0075370_10050812 3300006353 Bacteria 2352
86 Ga0075370_10055337 3300006353 Bacteria 2254
87 Ga0075370_10089280 3300006353 Bacteria 1777
88 Ga0075428_100306261 3300006844 Bacteria 1708
89 Ga0075429_100501468 3300006880 Bacteria 1064
90 Ga0097620_100301036 3300006931 Bacteria 1697
91 Ga0099823_1003560 3300006944 Bacteria 14814
92 Ga0105245_10363868 3300009098 Bacteria 1436
93 Ga0105243_10003227 3300009148 Bacteria 13321
94 Ga0105243_10570397 3300009148 Bacteria 1085
95 Ga0105237_10036431 3300009545 Bacteria 4978
96 Ga0157319_1000011 3300012497 Bacteria 180060
97 Ga0157374_10426133 3300013296 Bacteria 1326
98 Ga0157378_10057342 3300013297 Bacteria 3471
99 Ga0157378_10788894 3300013297 Bacteria 975
100 Ga0163162_10107751 3300013306 Bacteria 2882
101 Ga0157380_10244845 3300014326 Bacteria 1619
102 Ga0157377_10000056 3300014745 Bacteria 87608
103 Ga0157379_10105797 3300014968 Bacteria 2525
104 Ga0163161_10190221 3300017792 Bacteria 1577
105 Ga0207425_1000609 3300025245 Bacteria 20697
106 Ga0209129_1000025 3300025258 Bacteria 413639
107 Ga0209673_1003089 3300025273 Bacteria 10214
108 Ga0209673_1029494 3300025273 Bacteria 1746
109 Ga0209673_1036543 3300025273 Bacteria 1456
110 Ga0209564_1000005 3300025295 Bacteria 1147192
111 Ga0209564_1000039 3300025295 Bacteria 413604
112 Ga0209758_1000196 3300025297 Bacteria 133816
113 Ga0209758_1000311 3300025297 Bacteria 94121
114 Ga0209050_1000230 3300025298 Bacteria 122752
115 Ga0209050_1003538 3300025298 Bacteria 11398
116 Ga0209256_1000609 3300025299 Bacteria 49593
117 Ga0209256_1003701 3300025299 Bacteria 10385
118 Ga0209256_1011993 3300025299 Bacteria 3388
119 Ga0209051_1000703 3300025303 Bacteria 36654
120 Ga0209051_1009033 3300025303 Bacteria 5190
121 Ga0209257_1000844 3300025304 Bacteria 43964
122 Ga0209257_1002848 3300025304 Bacteria 16192
123 Ga0207656_10155558 3300025321 Bacteria 1085
124 Ga0207682_10011330 3300025893 Bacteria 3483
125 Ga0207645_10019270 3300025907 Bacteria 4475
126 Ga0207645_10021676 3300025907 Bacteria 4187
127 Ga0207645_10050876 3300025907 Bacteria 2646
128 Ga0207684_10023487 3300025910 Bacteria 5265
129 Ga0207671_10038273 3300025914 Bacteria 3555
130 Ga0207657_10351070 3300025919 Bacteria 1163
131 Ga0207649_10100408 3300025920 Bacteria 1914
132 Ga0207646_10223151 3300025922 Bacteria 1702
133 Ga0207650_10004101 3300025925 Bacteria 9949
134 Ga0207659_10019770 3300025926 Bacteria 4439
135 Ga0207659_10118568 3300025926 Bacteria 2024
136 Ga0207644_10022614 3300025931 Bacteria 4297
137 Ga0207644_10022967 3300025931 Bacteria 4266
138 Ga0207706_10003392 3300025933 Bacteria 15229
139 Ga0207706_10059523 3300025933 Bacteria 3363
140 Ga0207706_10599389 3300025933 Bacteria 946
141 Ga0207709_10002076 3300025935 Bacteria 12914
142 Ga0207709_10085274 3300025935 Bacteria 2047
143 Ga0207669_10010540 3300025937 Bacteria 4453
144 Ga0207704_10156115 3300025938 Bacteria 1618
145 Ga0207691_10006073 3300025940 Bacteria 11670
146 Ga0207691_10114456 3300025940 Bacteria 2396
147 Ga0207689_10027593 3300025942 Bacteria 4751
148 Ga0207679_10482532 3300025945 Bacteria 1104
149 Ga0207667_10059314 3300025949 Bacteria 4008
150 Ga0207667_10610042 3300025949 Bacteria 1100
151 Ga0207651_10012789 3300025960 Bacteria 4768
152 Ga0207651_10324779 3300025960 Bacteria 1287
153 Ga0207668_10239948 3300025972 Bacteria 1466
154 Ga0207640_10143684 3300025981 Bacteria 1743
155 Ga0207640_10322935 3300025981 Bacteria 1230
156 Ga0207658_10027543 3300025986 Bacteria 3993
157 Ga0207658_10304543 3300025986 Bacteria 1374
158 Ga0207677_10443699 3300026023 Bacteria 1110
159 Ga0207639_10127043 3300026041 Bacteria 2105
160 Ga0207678_10000706 3300026067 Bacteria 30472
161 Ga0207678_10062019 3300026067 Bacteria 3215
162 Ga0207678_10529488 3300026067 Bacteria 1029
163 Ga0207641_10364299 3300026088 Bacteria 1381
164 Ga0207648_10000828 3300026089 Bacteria 34818
165 Ga0207648_10024936 3300026089 Bacteria 5330
166 Ga0207648_10025396 3300026089 Bacteria 5278
167 Ga0207648_10094731 3300026089 Bacteria 2611
168 Ga0207648_10133401 3300026089 Bacteria 2186
169 Ga0207676_10094312 3300026095 Bacteria 2466
170 Ga0207674_10253171 3300026116 Bacteria 1708
171 Ga0207683_10035868 3300026121 Bacteria 4314
172 Ga0207698_10176525 3300026142 Bacteria 1887
173 Ga0209389_1034387 3300027296 Bacteria 4147
174 Ga0209371_1026769 3300027312 Bacteria 1306
175 Ga0209974_10109381 3300027876 Bacteria 971
176 Ga0268266_10718882 3300028379 Bacteria 963
177 Ga0268265_10308872 3300028380 Bacteria 1427
178 Ga0268264_10194369 3300028381 Bacteria 1852
179 Ga0307517_10010892 3300028786 Bacteria 12670
180 Ga0307517_10114740 3300028786 Bacteria 2025
181 Ga0307517_10312184 3300028786 Bacteria 875
182 Ga0307515_10013139 3300028794 Bacteria 15496
183 Ga0307515_10039752 3300028794 Bacteria 7466
184 Ga0307515_10098087 3300028794 Bacteria 3572
185 Ga0307515_10172887 3300028794 Bacteria 2144
186 Ga0307515_10290220 3300028794 Bacteria 1332
187 Ga0268256_1032022 3300030500 Bacteria 1257
188 Ga0307512_10004318 3300030522 Bacteria 15676
189 Ga0307512_10083827 3300030522 Bacteria 2270
190 Ga0265328_10016960 3300031239 Bacteria 2827
191 Ga0265327_10000423 3300031251 Bacteria 77351
192 Ga0307513_10123799 3300031456 Bacteria 2546
193 Ga0307509_10000180 3300031507 Bacteria 98647
194 Ga0307509_10012920 3300031507 Bacteria 9924
195 Ga0307509_10023342 3300031507 Bacteria 6951
196 Ga0307509_10029935 3300031507 Bacteria 6030
197 Ga0307509_10203394 3300031507 Bacteria 1814
198 Ga0307509_10236058 3300031507 Bacteria 1626
199 Ga0307408_100236389 3300031548 Bacteria 1499
200 Ga0307408_100347619 3300031548 Bacteria 1257
201 Ga0307408_100349701 3300031548 Bacteria 1254
202 Ga0307508_10000017 3300031616 Bacteria 203567
203 Ga0307508_10000078 3300031616 Bacteria 113416
204 Ga0307508_10000379 3300031616 Bacteria 53710
205 Ga0307508_10342209 3300031616 Bacteria 1087
206 Ga0307514_10059260 3300031649 Bacteria 2926
207 Ga0307514_10075159 3300031649 Bacteria 2521
208 Ga0307514_10117350 3300031649 Bacteria 1867
209 Ga0307514_10189848 3300031649 Bacteria 1310
210 Ga0307516_10011354 3300031730 Bacteria 9689
211 Ga0307516_10033799 3300031730 Bacteria 5144
212 Ga0307516_10199802 3300031730 Bacteria 1719
213 Ga0307516_10281059 3300031730 Bacteria 1346
214 Ga0307413_10082086 3300031824 Bacteria 2069
215 Ga0307410_10029100 3300031852 Bacteria 3513
216 Ga0307406_10149291 3300031901 Bacteria 1665
217 Ga0307406_10241242 3300031901 Bacteria 1356
218 Ga0307412_10012044 3300031911 Bacteria 5027
219 Ga0307412_10067655 3300031911 Bacteria 2426
220 Ga0307412_10112912 3300031911 Bacteria 1943
221 Ga0307416_100166669 3300032002 Bacteria 2044
222 Ga0307411_10022185 3300032005 Bacteria 3733
223 Ga0307411_10140039 3300032005 Bacteria 1782
224 Ga0307507_10101702 3300033179 Bacteria 2402
225 Ga0307507_10239672 3300033179 Bacteria 1189
226 Ga0307510_10005180 3300033180 Bacteria 15492
227 Ga0307510_10013336 3300033180 Bacteria 9747
228 Ga0307510_10015988 3300033180 Bacteria 8865
229 Ga0307510_10237944 3300033180 Bacteria 1317
230 Ga0373925_0125259 3300037068 Bacteria 1998
231 Ga0395900_0761498 3300037418 Bacteria 898
232 Ga0395898_0657863 3300037466 Bacteria 990
233 Ga0395905_0001798 3300037471 Bacteria 24860
234 Ga0395905_0002121 3300037471 Bacteria 22513
235 Ga0395905_0010243 3300037471 Bacteria 9135
236 Ga0395905_0014879 3300037471 Bacteria 7422
237 Ga0395905_0024789 3300037471 Bacteria 5660
238 Ga0395905_0108465 3300037471 Bacteria 2606
239 Ga0395905_0314082 3300037471 Bacteria 1456
240 Ga0451800_0706003 3300041459 Bacteria 3511
241 Ga0451841_0027513 3300041498 Bacteria 971
242 Ga0451845_0104827 3300041501 Bacteria 1473
243 Ga0451849_0653306 3300041505 Bacteria 1457
244 Ga0451851_0907529 3300041507 Bacteria 1790
245 Ga0451851_1085812 3300041507 Bacteria 1212
246 Ga0451853_2325347 3300041512 Bacteria 1963
247 Ga0450890_002519 3300042127 Bacteria 2507
248 Ga0439458_0042209 3300042157 Bacteria 1110
249 Ga0439459_0000679 3300042438 Bacteria 4646
250 Ga0451577_0052933 3300042876 Bacteria 3625
251 Ga0466969_0000027 3300044656 Bacteria 94811
252 Ga0466969_0018965 3300044656 Bacteria 3580
253 Ga0466972_0009665 3300044658 Bacteria 4839
254 Ga0466972_0038485 3300044658 Bacteria 2336
255 Ga0466965_0069350 3300044683 Bacteria 1771
256 Ga0466961_0333688 3300044693 Bacteria 924
257 Ga0466963_0164062 3300044694 Bacteria 1547
258 Ga0453684_0065501 3300044712 Bacteria 4633
259 Ga0453684_0147600 3300044712 Bacteria 2799
260 Ga0466971_0034062 3300044719 Bacteria 2282
261 Ga0466968_0026369 3300044735 Bacteria 2384
262 Ga0466957_0155285 3300044842 Bacteria 1483
263 Ga0466959_0001897 3300045049 Bacteria 13162
264 Ga0466959_0024607 3300045049 Bacteria 4461
265 Ga0451576_0004239 3300045051 Bacteria 18825
266 Ga0495592_0001123 3300046454 Bacteria 18605
267 Ga0495590_0019239 3300046457 Bacteria 2435
268 Ga0495638_0359085 3300046460 Bacteria 767
269 Ga0495583_0094455 3300046506 Bacteria 1284
270 Ga0495610_0012331 3300046512 Bacteria 5154
271 Ga0495632_0003879 3300046519 Bacteria 10390
272 Ga0495625_0002294 3300046660 Bacteria 20943
273 Ga0495625_0045735 3300046660 Bacteria 3162
274 Ga0495625_0165129 3300046660 Bacteria 1481
275 Ga0495670_0160154 3300046691 Bacteria 1182
276 Ga0495660_0127094 3300046810 Bacteria 1283
277 Ga0495676_0205527 3300047321 Bacteria 1366
278 Ga0495687_000604 3300047443 Bacteria 41982
279 Ga0495687_017584 3300047443 Bacteria 3560
280 Ga0495686_0008403 3300047472 Bacteria 7574
281 Ga0495626_0061636 3300048091 Bacteria 1705
282 Ga0496102_0048257 3300048905 Bacteria 3871
283 Ga0496106_0029387 3300048909 Bacteria 4096
284 Ga0496110_0496523 3300048913 Bacteria 1111
285 Ga0496112_0741776 3300048915 Bacteria 909
286 Ga0496124_0273583 3300048927 Bacteria 1235
287 Ga0501298_006287 3300049521 Bacteria 1939
288 Ga0501301_001654 3300049524 Bacteria 1427
289 Ga0501303_002180 3300049526 Bacteria 1497
290 Ga0501043_0000010 3300049579 Bacteria 206374
291 Ga0501046_0000132 3300049580 Bacteria 79506
292 Ga0501047_0000026 3300049581 Bacteria 225296
293 Ga0501048_0014686 3300049582 Bacteria 5794
294 Ga0501262_003579 3300049759 Bacteria 1785
295 Ga0501045_0002989 3300049824 Bacteria 11566
296 nmdc:mga03683_26424_c1 3300050489 Bacteria 2290
297 nmdc:mga03683_49741_c1 3300050489 Bacteria 1746
298 nmdc:mga03683_54529_c1 3300050489 Bacteria 1677
299 nmdc:mga03n38_113307_c1 3300050490 Bacteria 1324
300 nmdc:mga03n38_44205_c1 3300050490 Bacteria 1955
301 nmdc:mga03n38_68909_c1 3300050490 Bacteria 1632
302 nmdc:mga00v17_21065_c1 3300050491 Bacteria 3744
303 nmdc:mga0k408_1160_c1 3300050493 Bacteria 14410
304 nmdc:mga0k408_163_c1 3300050493 Bacteria 34737
305 nmdc:mga0k408_1741_c1 3300050493 Bacteria 11671
306 nmdc:mga0k408_179611_c1 3300050493 Bacteria 1262
307 nmdc:mga0k408_256641_c1 3300050493 Bacteria 1044
308 nmdc:mga0k408_29125_c1 3300050493 Bacteria 3142
309 nmdc:mga0k408_55851_c1 3300050493 Bacteria 2290
310 nmdc:mga0k408_677_c1 3300050493 Bacteria 18692
311 nmdc:mga06z11_108830_c1 3300050494 Bacteria 1532
312 nmdc:mga06z11_298366_c1 3300050494 Bacteria 958
313 nmdc:mga06z11_80207_c1 3300050494 Bacteria 1749
314 nmdc:mga06z11_91082_c1 3300050494 Bacteria 1655
315 nmdc:mga07m45_115861_c1 3300050496 Bacteria 1545
316 nmdc:mga07m45_121190_c1 3300050496 Bacteria 1511
317 nmdc:mga07m45_1475_c1 3300050496 Bacteria 10810
318 nmdc:mga07m45_181553_c1 3300050496 Bacteria 1224
319 nmdc:mga07m45_290_c1 3300050496 Bacteria 20350
320 nmdc:mga07m45_31983_c1 3300050496 Bacteria 2917
321 nmdc:mga07m45_40227_c1 3300050496 Bacteria 2616
322 nmdc:mga07m45_43373_c1 3300050496 Bacteria 2522
323 nmdc:mga07m45_43917_c1 3300050496 Bacteria 2507
324 nmdc:mga07m45_60995_c2 3300050496 Bacteria 1807
325 nmdc:mga07m45_65647_c1 3300050496 Bacteria 2061
326 nmdc:mga07m45_82547_c1 3300050496 Bacteria 1835
327 nmdc:mga09592_390836_c1 3300050508 Bacteria 1202
328 nmdc:mga0sz30_100429_c1 3300050516 Bacteria 1264
329 nmdc:mga0sz30_15643_c1 3300050516 Bacteria 3001
330 nmdc:mga0sz30_37468_c1 3300050516 Bacteria 2030
331 Ga0500578_0000090 3300053086 Bacteria 102606
332 Ga0500578_0452585 3300053086 Bacteria 730
333 Ga0500583_0007810 3300053092 Bacteria 3793
334 Ga0500651_0116195 3300053093 Bacteria 1628
335 Ga0500650_0120879 3300053098 Bacteria 1221
336 Ga0500594_0002776 3300053118 Bacteria 3812
337 Ga0500614_009900 3300053123 Bacteria 2038
338 Ga0500621_027274 3300053126 Bacteria 2246
339 Ga0500652_151788 3300053131 Bacteria 961
340 Ga0500655_015146 3300053133 Bacteria 1413
341 Ga0500658_0005217 3300053134 Bacteria 4834
342 Ga0500559_0000059 3300053136 Bacteria 87846
343 Ga0500568_0020858 3300053139 Bacteria 2828
344 Ga0500568_0078968 3300053139 Bacteria 1251
345 Ga0500604_0013866 3300053151 Bacteria 2188
346 Ga0500619_000204 3300053154 Bacteria 13661
347 Ga0500622_0001118 3300053156 Bacteria 22384
348 Ga0500622_0001396 3300053156 Bacteria 19455
349 Ga0500570_039806 3300053724 Bacteria 2469
350 Ga0500645_001833 3300053730 Bacteria 10183
351 Ga0500587_003323 3300053739 Bacteria 2256
352 Ga0500587_006942 3300053739 Bacteria 1486
353 Ga0590075_033155 3300059424 Bacteria 1311

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_0001798 Ga0395905_0001798_9530_10192 220
2 iso_pu_bacteria 2886848708 2886849255 220
3 3300003322 rootL2_10000586 rootL2_100005862 224
4 3300003771 Ga0055526_1002679 Ga0055526_10026796 224
5 3300003775 Ga0055524_1001033 Ga0055524_100103314 224
6 3300003775 Ga0055524_1007921 Ga0055524_10079214 224
7 3300003794 Ga0055531_10002715 Ga0055531_100027155 224
8 3300003794 Ga0055531_10010048 Ga0055531_100100482 224
9 3300005262 Ga0065165_1000024 Ga0065165_1000024143 224
10 3300005339 Ga0070660_100449270 Ga0070660_1004492701 224
11 3300005344 Ga0070661_100118496 Ga0070661_1001184961 224
12 3300005457 Ga0070662_100036213 Ga0070662_1000362132 224
13 3300005616 Ga0068852_100081760 Ga0068852_1000817602 224
14 3300006353 Ga0075370_10008657 Ga0075370_100086573 224
15 3300006844 Ga0075428_100306261 Ga0075428_1003062612 224
16 3300006944 Ga0099823_1003560 Ga0099823_10035605 224
17 3300012497 Ga0157319_1000011 Ga0157319_100001169 224
18 3300025273 Ga0209673_1003089 Ga0209673_10030898 224
19 3300025273 Ga0209673_1029494 Ga0209673_10294942 224
20 3300025295 Ga0209564_1000005 Ga0209564_1000005518 224
21 3300025298 Ga0209050_1003538 Ga0209050_10035382 224
22 3300025299 Ga0209256_1000609 Ga0209256_100060936 224
23 3300025299 Ga0209256_1003701 Ga0209256_10037017 224
24 3300025303 Ga0209051_1000703 Ga0209051_10007035 224
25 3300025304 Ga0209257_1000844 Ga0209257_100084431 224
26 3300025304 Ga0209257_1002848 Ga0209257_10028486 224
27 3300025920 Ga0207649_10100408 Ga0207649_101004081 224
28 3300025933 Ga0207706_10003392 Ga0207706_1000339213 224
29 3300027296 Ga0209389_1034387 Ga0209389_10343873 224
30 3300027312 Ga0209371_1026769 Ga0209371_10267692 224
31 3300027876 Ga0209974_10109381 Ga0209974_101093811 224
32 3300028381 Ga0268264_10194369 Ga0268264_101943693 224
33 3300030500 Ga0268256_1032022 Ga0268256_10320222 224
34 3300031239 Ga0265328_10016960 Ga0265328_100169602 224
35 3300031251 Ga0265327_10000423 Ga0265327_1000042359 224
36 3300031548 Ga0307408_100347619 Ga0307408_1003476192 224
37 3300037418 Ga0395900_0761498 Ga0395900_0761498_113_787 224
38 3300037466 Ga0395898_0657863 Ga0395898_0657863_111_785 224
39 3300037471 Ga0395905_0002121 Ga0395905_0002121_17638_18312 224
40 3300037471 Ga0395905_0014879 Ga0395905_0014879_6630_7304 224
41 3300037471 Ga0395905_0108465 Ga0395905_0108465_1799_2473 224
42 3300042127 Ga0450890_002519 Ga0450890_002519_1191_1865 224
43 3300042438 Ga0439459_0000679 Ga0439459_0000679_3395_4069 224
44 3300044656 Ga0466969_0000027 Ga0466969_0000027_90157_90831 224
45 3300044656 Ga0466969_0018965 Ga0466969_0018965_1899_2573 224
46 3300044658 Ga0466972_0009665 Ga0466972_0009665_2434_3108 224
47 3300044658 Ga0466972_0038485 Ga0466972_0038485_1139_1813 224
48 3300044683 Ga0466965_0069350 Ga0466965_0069350_446_1120 224
49 3300044693 Ga0466961_0333688 Ga0466961_0333688_231_905 224
50 3300044694 Ga0466963_0164062 Ga0466963_0164062_238_912 224
51 3300044712 Ga0453684_0147600 Ga0453684_0147600_1814_2488 224
52 3300044719 Ga0466971_0034062 Ga0466971_0034062_666_1340 224
53 3300044842 Ga0466957_0155285 Ga0466957_0155285_491_1165 224
54 3300045049 Ga0466959_0001897 Ga0466959_0001897_1905_2579 224
55 3300045049 Ga0466959_0024607 Ga0466959_0024607_941_1615 224
56 3300045051 Ga0451576_0004239 Ga0451576_0004239_2000_2674 224
57 3300046691 Ga0495670_0160154 Ga0495670_0160154_421_1095 224
58 3300048913 Ga0496110_0496523 Ga0496110_0496523_342_1016 224
59 3300048927 Ga0496124_0273583 Ga0496124_0273583_63_737 224
60 3300050493 nmdc:mga0k408_55851_c1 nmdc:mga0k408_55851_c1_744_1418 224
61 3300053156 Ga0500622_0001118 Ga0500622_0001118_3937_4611 224
62 3300059424 Ga0590075_033155 Ga0590075_033155_547_1221 224
63 iso_pu_bacteria 2831864461 2831869560 224
64 3300005334 Ga0068869_100741023 Ga0068869_1007410231 225
65 3300005577 Ga0068857_100625613 Ga0068857_1006256131 225
66 3300006051 Ga0075364_10022263 Ga0075364_100222635 225
67 3300006177 Ga0075362_10022042 Ga0075362_100220425 225
68 3300006353 Ga0075370_10010395 Ga0075370_100103951 225
69 3300009545 Ga0105237_10036431 Ga0105237_100364315 225
70 3300025298 Ga0209050_1000230 Ga0209050_100023013 225
71 3300025303 Ga0209051_1009033 Ga0209051_10090335 225
72 3300025914 Ga0207671_10038273 Ga0207671_100382735 225
73 3300025933 Ga0207706_10059523 Ga0207706_100595232 225
74 3300025949 Ga0207667_10610042 Ga0207667_106100421 225
75 3300026041 Ga0207639_10127043 Ga0207639_101270432 225
76 3300026067 Ga0207678_10062019 Ga0207678_100620192 225
77 3300026089 Ga0207648_10133401 Ga0207648_101334013 225
78 3300028380 Ga0268265_10308872 Ga0268265_103088723 225
79 3300028794 Ga0307515_10172887 Ga0307515_101728872 225
80 3300031548 Ga0307408_100349701 Ga0307408_1003497012 225
81 3300032005 Ga0307411_10022185 Ga0307411_100221855 225
82 3300046810 Ga0495660_0127094 Ga0495660_0127094_156_833 225
83 3300047443 Ga0495687_000604 Ga0495687_000604_192_869 225
84 3300050489 nmdc:mga03683_54529_c1 nmdc:mga03683_54529_c1_817_1494 225
85 3300050490 nmdc:mga03n38_44205_c1 nmdc:mga03n38_44205_c1_619_1296 225
86 3300050491 nmdc:mga00v17_21065_c1 nmdc:mga00v17_21065_c1_110_787 225
87 3300050496 nmdc:mga07m45_1475_c1 nmdc:mga07m45_1475_c1_8094_8771 225
88 3300050496 nmdc:mga07m45_60995_c2 nmdc:mga07m45_60995_c2_364_1086 225
89 3300050516 nmdc:mga0sz30_100429_c1 nmdc:mga0sz30_100429_c1_21_776 225
90 3300005563 Ga0068855_100072342 Ga0068855_1000723423 226
91 3300006880 Ga0075429_100501468 Ga0075429_1005014682 226
92 3300025949 Ga0207667_10059314 Ga0207667_100593143 226
93 3300037471 Ga0395905_0024789 Ga0395905_0024789_210_890 226
94 3300050508 nmdc:mga09592_390836_c1 nmdc:mga09592_390836_c1_325_1026 226
95 3300005617 Ga0068859_100301027 Ga0068859_1003010273 227
96 3300006042 Ga0075368_10006300 Ga0075368_100063002 227
97 3300006051 Ga0075364_10023406 Ga0075364_100234065 227
98 3300006178 Ga0075367_10133121 Ga0075367_101331213 227
99 3300006186 Ga0075369_10002961 Ga0075369_100029612 227
100 3300006195 Ga0075366_10061136 Ga0075366_100611363 227
101 3300006195 Ga0075366_10164400 Ga0075366_101644002 227
102 3300006353 Ga0075370_10011034 Ga0075370_100110342 227
103 3300006353 Ga0075370_10055337 Ga0075370_100553372 227
104 3300006931 Ga0097620_100301036 Ga0097620_1003010363 227
105 3300028786 Ga0307517_10114740 Ga0307517_101147402 227
106 3300028786 Ga0307517_10312184 Ga0307517_103121841 227
107 3300031616 Ga0307508_10342209 Ga0307508_103422092 227
108 3300046457 Ga0495590_0019239 Ga0495590_0019239_886_1569 227
109 3300046506 Ga0495583_0094455 Ga0495583_0094455_46_729 227
110 3300046519 Ga0495632_0003879 Ga0495632_0003879_7145_7828 227
111 3300046660 Ga0495625_0045735 Ga0495625_0045735_710_1393 227
112 3300047443 Ga0495687_017584 Ga0495687_017584_519_1202 227
113 3300048091 Ga0495626_0061636 Ga0495626_0061636_990_1673 227
114 3300050490 nmdc:mga03n38_113307_c1 nmdc:mga03n38_113307_c1_352_1035 227
115 3300050493 nmdc:mga0k408_1160_c1 nmdc:mga0k408_1160_c1_673_1356 227
116 3300050493 nmdc:mga0k408_1741_c1 nmdc:mga0k408_1741_c1_8057_8740 227
117 3300050494 nmdc:mga06z11_91082_c1 nmdc:mga06z11_91082_c1_656_1339 227
118 3300050496 nmdc:mga07m45_121190_c1 nmdc:mga07m45_121190_c1_213_896 227
119 3300050496 nmdc:mga07m45_290_c1 nmdc:mga07m45_290_c1_16305_16988 227
120 3300050496 nmdc:mga07m45_43917_c1 nmdc:mga07m45_43917_c1_1384_2067 227
121 3300050516 nmdc:mga0sz30_15643_c1 nmdc:mga0sz30_15643_c1_704_1387 227
122 3300053086 Ga0500578_0452585 Ga0500578_0452585_29_712 227
123 3300053098 Ga0500650_0120879 Ga0500650_0120879_27_710 227
124 3300053134 Ga0500658_0005217 Ga0500658_0005217_3479_4162 227
125 3300053139 Ga0500568_0020858 Ga0500568_0020858_760_1443 227
126 3300005293 Ga0065715_10125640 Ga0065715_101256402 228
127 3300005327 Ga0070658_10389002 Ga0070658_103890022 228
128 3300005328 Ga0070676_10199544 Ga0070676_101995442 228
129 3300005331 Ga0070670_100007532 Ga0070670_1000075325 228
130 3300005333 Ga0070677_10019828 Ga0070677_100198283 228
131 3300005347 Ga0070668_100258353 Ga0070668_1002583533 228
132 3300005354 Ga0070675_100017023 Ga0070675_1000170234 228
133 3300005355 Ga0070671_100307742 Ga0070671_1003077422 228
134 3300005356 Ga0070674_100006941 Ga0070674_1000069415 228
135 3300005356 Ga0070674_100108710 Ga0070674_1001087102 228
136 3300005364 Ga0070673_100011778 Ga0070673_1000117782 228
137 3300005367 Ga0070667_100193973 Ga0070667_1001939732 228
138 3300005456 Ga0070678_100618642 Ga0070678_1006186421 228
139 3300005459 Ga0068867_100058585 Ga0068867_1000585852 228
140 3300005459 Ga0068867_100091865 Ga0068867_1000918652 228
141 3300005543 Ga0070672_100007204 Ga0070672_1000072042 228
142 3300005548 Ga0070665_100348723 Ga0070665_1003487231 228
143 3300005564 Ga0070664_100211330 Ga0070664_1002113302 228
144 3300005618 Ga0068864_100123457 Ga0068864_1001234572 228
145 3300005718 Ga0068866_10324182 Ga0068866_103241822 228
146 3300005834 Ga0068851_10038265 Ga0068851_100382653 228
147 3300006177 Ga0075362_10032304 Ga0075362_100323044 228
148 3300006195 Ga0075366_10001045 Ga0075366_100010455 228
149 3300009098 Ga0105245_10363868 Ga0105245_103638681 228
150 3300013306 Ga0163162_10107751 Ga0163162_101077512 228
151 3300014326 Ga0157380_10244845 Ga0157380_102448452 228
152 3300017792 Ga0163161_10190221 Ga0163161_101902212 228
153 3300025321 Ga0207656_10155558 Ga0207656_101555582 228
154 3300025893 Ga0207682_10011330 Ga0207682_100113302 228
155 3300025907 Ga0207645_10019270 Ga0207645_100192705 228
156 3300025907 Ga0207645_10050876 Ga0207645_100508762 228
157 3300025919 Ga0207657_10351070 Ga0207657_103510702 228
158 3300025925 Ga0207650_10004101 Ga0207650_100041015 228
159 3300025926 Ga0207659_10019770 Ga0207659_100197704 228
160 3300025931 Ga0207644_10022614 Ga0207644_100226144 228
161 3300025937 Ga0207669_10010540 Ga0207669_100105404 228
162 3300025938 Ga0207704_10156115 Ga0207704_101561153 228
163 3300025940 Ga0207691_10006073 Ga0207691_100060732 228
164 3300025945 Ga0207679_10482532 Ga0207679_104825322 228
165 3300025960 Ga0207651_10012789 Ga0207651_100127895 228
166 3300025972 Ga0207668_10239948 Ga0207668_102399481 228
167 3300025981 Ga0207640_10322935 Ga0207640_103229352 228
168 3300025986 Ga0207658_10304543 Ga0207658_103045432 228
169 3300026067 Ga0207678_10529488 Ga0207678_105294882 228
170 3300026088 Ga0207641_10364299 Ga0207641_103642992 228
171 3300026089 Ga0207648_10024936 Ga0207648_100249362 228
172 3300026089 Ga0207648_10094731 Ga0207648_100947314 228
173 3300026095 Ga0207676_10094312 Ga0207676_100943123 228
174 3300026121 Ga0207683_10035868 Ga0207683_100358682 228
175 3300028379 Ga0268266_10718882 Ga0268266_107188821 228
176 3300031548 Ga0307408_100236389 Ga0307408_1002363892 228
177 3300031649 Ga0307514_10189848 Ga0307514_101898482 228
178 3300031824 Ga0307413_10082086 Ga0307413_100820863 228
179 3300031852 Ga0307410_10029100 Ga0307410_100291003 228
180 3300031901 Ga0307406_10149291 Ga0307406_101492911 228
181 3300031911 Ga0307412_10012044 Ga0307412_100120445 228
182 3300031911 Ga0307412_10067655 Ga0307412_100676552 228
183 3300032002 Ga0307416_100166669 Ga0307416_1001666691 228
184 3300032005 Ga0307411_10140039 Ga0307411_101400392 228
185 3300041507 Ga0451851_1085812 Ga0451851_1085812_180_878 228
186 3300042157 Ga0439458_0042209 Ga0439458_0042209_262_963 228
187 3300044712 Ga0453684_0065501 Ga0453684_0065501_986_1681 228
188 3300050489 nmdc:mga03683_26424_c1 nmdc:mga03683_26424_c1_1276_1974 228
189 3300050493 nmdc:mga0k408_163_c1 nmdc:mga0k408_163_c1_18543_19241 228
190 3300050493 nmdc:mga0k408_179611_c1 nmdc:mga0k408_179611_c1_352_1044 228
191 3300050493 nmdc:mga0k408_256641_c1 nmdc:mga0k408_256641_c1_249_944 228
192 iso_pu_bacteria 2585428058 2587731941 228
193 iso_pu_bacteria 2585428062 2587757429 228
194 iso_pu_bacteria 2588253510 2588292129 228
195 iso_pu_bacteria 2643221592 2643971760 228
196 iso_pu_bacteria 2643221625 2644139250 228
197 iso_pu_bacteria 2643221648 2644274860 228
198 iso_pu_bacteria 2643221654 2644304396 228
199 3300005718 Ga0068866_10113929 Ga0068866_101139292 229
200 3300025933 Ga0207706_10599389 Ga0207706_105993892 229
201 3300025935 Ga0207709_10085274 Ga0207709_100852744 229
202 3300025981 Ga0207640_10143684 Ga0207640_101436843 229
203 3300031911 Ga0307412_10112912 Ga0307412_101129122 229
204 3300050493 nmdc:mga0k408_29125_c1 nmdc:mga0k408_29125_c1_1797_2507 229
205 3300050493 nmdc:mga0k408_29125_c1 nmdc:mga0k408_29125_c1_636_1346 229
206 3300050494 nmdc:mga06z11_80207_c1 nmdc:mga06z11_80207_c1_694_1404 229
207 3300050496 nmdc:mga07m45_43373_c1 nmdc:mga07m45_43373_c1_837_1547 229
208 3300005455 Ga0070663_100000599 Ga0070663_1000005996 230
209 3300005459 Ga0068867_100010817 Ga0068867_1000108176 230
210 3300005616 Ga0068852_100232859 Ga0068852_1002328592 230
211 3300006195 Ga0075366_10004509 Ga0075366_100045095 230
212 3300006353 Ga0075370_10050812 Ga0075370_100508121 230
213 3300009148 Ga0105243_10003227 Ga0105243_100032276 230
214 3300013297 Ga0157378_10057342 Ga0157378_100573425 230
215 3300014745 Ga0157377_10000056 Ga0157377_100000568 230
216 3300025935 Ga0207709_10002076 Ga0207709_100020765 230
217 3300026023 Ga0207677_10443699 Ga0207677_104436992 230
218 3300026067 Ga0207678_10000706 Ga0207678_1000070611 230
219 3300026089 Ga0207648_10000828 Ga0207648_100008286 230
220 3300026142 Ga0207698_10176525 Ga0207698_101765251 230
221 3300037471 Ga0395905_0010243 Ga0395905_0010243_6595_7287 230
222 3300050496 nmdc:mga07m45_82547_c1 nmdc:mga07m45_82547_c1_798_1502 230
223 3300048909 Ga0496106_0029387 Ga0496106_0029387_414_1121 231
224 3300002773 JGI25152J39213_1000879 JGI25152J39213_10008796 232
225 3300003215 JGI25153J46596_10007460 JGI25153J46596_100074602 232
226 3300003215 JGI25153J46596_10025081 JGI25153J46596_100250812 232
227 3300003316 rootH1_10035191 rootH1_100351916 232
228 3300003322 rootL2_10038809 rootL2_100388092 232
229 3300003771 Ga0055526_1000295 Ga0055526_100029513 232
230 3300005262 Ga0065165_1001470 Ga0065165_10014705 232
231 3300005328 Ga0070676_10007760 Ga0070676_100077605 232
232 3300005334 Ga0068869_100532482 Ga0068869_1005324822 232
233 3300005353 Ga0070669_100121828 Ga0070669_1001218282 232
234 3300005354 Ga0070675_100031534 Ga0070675_1000315342 232
235 3300005355 Ga0070671_100032136 Ga0070671_1000321362 232
236 3300005367 Ga0070667_100003516 Ga0070667_10000351611 232
237 3300005367 Ga0070667_100033268 Ga0070667_1000332682 232
238 3300005367 Ga0070667_100622122 Ga0070667_1006221222 232
239 3300005459 Ga0068867_100045621 Ga0068867_1000456215 232
240 3300005468 Ga0070707_100201378 Ga0070707_1002013782 232
241 3300005543 Ga0070672_100143019 Ga0070672_1001430192 232
242 3300005548 Ga0070665_100023604 Ga0070665_1000236046 232
243 3300005577 Ga0068857_100037345 Ga0068857_1000373451 232
244 3300006042 Ga0075368_10007041 Ga0075368_100070415 232
245 3300006048 Ga0075363_100056836 Ga0075363_1000568362 232
246 3300006177 Ga0075362_10006261 Ga0075362_100062612 232
247 3300006178 Ga0075367_10041429 Ga0075367_100414293 232
248 3300006178 Ga0075367_10056544 Ga0075367_100565443 232
249 3300006186 Ga0075369_10015809 Ga0075369_100158094 232
250 3300006186 Ga0075369_10033099 Ga0075369_100330991 232
251 3300006195 Ga0075366_10027029 Ga0075366_100270291 232
252 3300006195 Ga0075366_10136852 Ga0075366_101368522 232
253 3300006353 Ga0075370_10001744 Ga0075370_100017446 232
254 3300006353 Ga0075370_10089280 Ga0075370_100892802 232
255 3300009148 Ga0105243_10570397 Ga0105243_105703971 232
256 3300013296 Ga0157374_10426133 Ga0157374_104261331 232
257 3300013297 Ga0157378_10788894 Ga0157378_107888942 232
258 3300014968 Ga0157379_10105797 Ga0157379_101057971 232
259 3300025245 Ga0207425_1000609 Ga0207425_100060919 232
260 3300025258 Ga0209129_1000025 Ga0209129_1000025155 232
261 3300025273 Ga0209673_1036543 Ga0209673_10365432 232
262 3300025295 Ga0209564_1000039 Ga0209564_1000039155 232
263 3300025297 Ga0209758_1000196 Ga0209758_100019636 232
264 3300025297 Ga0209758_1000311 Ga0209758_10003112 232
265 3300025299 Ga0209256_1011993 Ga0209256_10119935 232
266 3300025907 Ga0207645_10021676 Ga0207645_100216765 232
267 3300025910 Ga0207684_10023487 Ga0207684_100234872 232
268 3300025922 Ga0207646_10223151 Ga0207646_102231513 232
269 3300025926 Ga0207659_10118568 Ga0207659_101185682 232
270 3300025931 Ga0207644_10022967 Ga0207644_100229672 232
271 3300025940 Ga0207691_10114456 Ga0207691_101144562 232
272 3300025942 Ga0207689_10027593 Ga0207689_100275932 232
273 3300025960 Ga0207651_10324779 Ga0207651_103247792 232
274 3300025986 Ga0207658_10027543 Ga0207658_100275435 232
275 3300026089 Ga0207648_10025396 Ga0207648_100253962 232
276 3300026116 Ga0207674_10253171 Ga0207674_102531712 232
277 3300028786 Ga0307517_10010892 Ga0307517_100108922 232
278 3300028794 Ga0307515_10013139 Ga0307515_100131396 232
279 3300028794 Ga0307515_10039752 Ga0307515_100397524 232
280 3300028794 Ga0307515_10098087 Ga0307515_100980873 232
281 3300028794 Ga0307515_10290220 Ga0307515_102902201 232
282 3300030522 Ga0307512_10004318 Ga0307512_100043184 232
283 3300030522 Ga0307512_10083827 Ga0307512_100838272 232
284 3300031456 Ga0307513_10123799 Ga0307513_101237993 232
285 3300031507 Ga0307509_10000180 Ga0307509_1000018062 232
286 3300031507 Ga0307509_10012920 Ga0307509_100129202 232
287 3300031507 Ga0307509_10023342 Ga0307509_100233423 232
288 3300031507 Ga0307509_10029935 Ga0307509_100299352 232
289 3300031507 Ga0307509_10203394 Ga0307509_102033943 232
290 3300031507 Ga0307509_10236058 Ga0307509_102360582 232
291 3300031616 Ga0307508_10000017 Ga0307508_1000001753 232
292 3300031616 Ga0307508_10000078 Ga0307508_10000078104 232
293 3300031616 Ga0307508_10000379 Ga0307508_1000037926 232
294 3300031649 Ga0307514_10059260 Ga0307514_100592602 232
295 3300031649 Ga0307514_10075159 Ga0307514_100751592 232
296 3300031649 Ga0307514_10117350 Ga0307514_101173501 232
297 3300031730 Ga0307516_10011354 Ga0307516_100113546 232
298 3300031730 Ga0307516_10033799 Ga0307516_100337994 232
299 3300031730 Ga0307516_10199802 Ga0307516_101998021 232
300 3300031730 Ga0307516_10281059 Ga0307516_102810592 232
301 3300031901 Ga0307406_10241242 Ga0307406_102412423 232
302 3300033179 Ga0307507_10101702 Ga0307507_101017022 232
303 3300033179 Ga0307507_10239672 Ga0307507_102396721 232
304 3300033180 Ga0307510_10005180 Ga0307510_1000518011 232
305 3300033180 Ga0307510_10013336 Ga0307510_100133365 232
306 3300033180 Ga0307510_10015988 Ga0307510_100159887 232
307 3300033180 Ga0307510_10237944 Ga0307510_102379441 232
308 3300037068 Ga0373925_0125259 Ga0373925_0125259_1177_1887 232
309 3300037471 Ga0395905_0314082 Ga0395905_0314082_339_1040 232
310 3300041459 Ga0451800_0706003 Ga0451800_0706003_601_1299 232
311 3300041498 Ga0451841_0027513 Ga0451841_0027513_179_877 232
312 3300041501 Ga0451845_0104827 Ga0451845_0104827_359_1057 232
313 3300041505 Ga0451849_0653306 Ga0451849_0653306_422_1120 232
314 3300041507 Ga0451851_0907529 Ga0451851_0907529_292_990 232
315 3300041512 Ga0451853_2325347 Ga0451853_2325347_1145_1843 232
316 3300042876 Ga0451577_0052933 Ga0451577_0052933_2343_3095 232
317 3300044735 Ga0466968_0026369 Ga0466968_0026369_1033_1740 232
318 3300046454 Ga0495592_0001123 Ga0495592_0001123_3925_4635 232
319 3300046460 Ga0495638_0359085 Ga0495638_0359085_24_734 232
320 3300046512 Ga0495610_0012331 Ga0495610_0012331_1226_1924 232
321 3300046660 Ga0495625_0002294 Ga0495625_0002294_6986_7684 232
322 3300046660 Ga0495625_0165129 Ga0495625_0165129_467_1177 232
323 3300047321 Ga0495676_0205527 Ga0495676_0205527_441_1151 232
324 3300047472 Ga0495686_0008403 Ga0495686_0008403_3543_4241 232
325 3300048905 Ga0496102_0048257 Ga0496102_0048257_228_926 232
326 3300048915 Ga0496112_0741776 Ga0496112_0741776_14_808 232
327 3300049521 Ga0501298_006287 Ga0501298_006287_627_1325 232
328 3300049524 Ga0501301_001654 Ga0501301_001654_474_1172 232
329 3300049526 Ga0501303_002180 Ga0501303_002180_684_1382 232
330 3300049579 Ga0501043_0000010 Ga0501043_0000010_188954_189691 232
331 3300049580 Ga0501046_0000132 Ga0501046_0000132_43097_43834 232
332 3300049581 Ga0501047_0000026 Ga0501047_0000026_35665_36402 232
333 3300049582 Ga0501048_0014686 Ga0501048_0014686_1407_2144 232
334 3300049759 Ga0501262_003579 Ga0501262_003579_709_1407 232
335 3300049824 Ga0501045_0002989 Ga0501045_0002989_6868_7605 232
336 3300050489 nmdc:mga03683_49741_c1 nmdc:mga03683_49741_c1_494_1195 232
337 3300050490 nmdc:mga03n38_68909_c1 nmdc:mga03n38_68909_c1_623_1324 232
338 3300050493 nmdc:mga0k408_677_c1 nmdc:mga0k408_677_c1_3688_4386 232
339 3300050494 nmdc:mga06z11_108830_c1 nmdc:mga06z11_108830_c1_267_965 232
340 3300050494 nmdc:mga06z11_298366_c1 nmdc:mga06z11_298366_c1_67_801 232
341 3300050496 nmdc:mga07m45_115861_c1 nmdc:mga07m45_115861_c1_243_953 232
342 3300050496 nmdc:mga07m45_181553_c1 nmdc:mga07m45_181553_c1_119_853 232
343 3300050496 nmdc:mga07m45_31983_c1 nmdc:mga07m45_31983_c1_1500_2231 232
344 3300050496 nmdc:mga07m45_40227_c1 nmdc:mga07m45_40227_c1_1339_2037 232
345 3300050496 nmdc:mga07m45_65647_c1 nmdc:mga07m45_65647_c1_908_1609 232
346 3300050516 nmdc:mga0sz30_37468_c1 nmdc:mga0sz30_37468_c1_399_1100 232
347 3300053086 Ga0500578_0000090 Ga0500578_0000090_56826_57524 232
348 3300053092 Ga0500583_0007810 Ga0500583_0007810_2499_3209 232
349 3300053093 Ga0500651_0116195 Ga0500651_0116195_701_1411 232
350 3300053118 Ga0500594_0002776 Ga0500594_0002776_2173_2883 232
351 3300053123 Ga0500614_009900 Ga0500614_009900_350_1060 232
352 3300053126 Ga0500621_027274 Ga0500621_027274_1104_1814 232
353 3300053131 Ga0500652_151788 Ga0500652_151788_165_875 232
354 3300053133 Ga0500655_015146 Ga0500655_015146_175_885 232
355 3300053136 Ga0500559_0000059 Ga0500559_0000059_67418_68128 232
356 3300053139 Ga0500568_0078968 Ga0500568_0078968_529_1239 232
357 3300053151 Ga0500604_0013866 Ga0500604_0013866_941_1651 232
358 3300053154 Ga0500619_000204 Ga0500619_000204_11260_11958 232
359 3300053156 Ga0500622_0001396 Ga0500622_0001396_2968_3678 232
360 3300053724 Ga0500570_039806 Ga0500570_039806_1713_2411 232
361 3300053730 Ga0500645_001833 Ga0500645_001833_6187_6897 232
362 3300053739 Ga0500587_003323 Ga0500587_003323_593_1291 232
363 3300053739 Ga0500587_006942 Ga0500587_006942_573_1283 232

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01728

FtsJ

FtsJ-like methyltransferase

32

215

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ej0-assembly1.cif.gz_A ftsj rna methyltransferase complexed with s-adenosylmethionine, mercury derivative 0.9155 31 223
1ej0-assembly1.cif.gz_A ftsj rna methyltransferase complexed with s-adenosylmethionine, mercury derivative 0.9106 31 223
3dou-assembly1.cif.gz_A crystal structure of methyltransferase involved in cell division from thermoplasma volcanicum gss1 0.88 35 222
8fkw-assembly1.cif.gz_SJ human nucleolar pre-60s ribosomal subunit (state d2) 0.8788 21 222
7o9k-assembly1.cif.gz_n human mitochondrial ribosome large subunit assembly intermediate with mterf4-nsun4, mrm2, mtg1, the malsu module, gtpbp5 and mtef-tu 0.8744 31 223
ID Description Score Start End Superfamily
1ej0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9155 31 223 3.40.50.150
af_Q5RJT2_23_207_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9123 31 221 3.40.50.150
1ej0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9106 31 223 3.40.50.150
af_A0A0R0GT40_1_145_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8946 93 226 3.40.50.150
af_Q9VDT6_58_249_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8782 31 222 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2M8VC08-F1-model_v4 deleted 0.9366 43 222
AF-A0A2M8VC08-F1-model_v4 deleted 0.926 43 222
AF-A0A382BP09-F1-model_v4 Ribosomal RNA methyltransferase FtsJ domain-containing protein 0.9256 31 222 GO:0008650
AF-A0A382BP09-F1-model_v4 Ribosomal RNA methyltransferase FtsJ domain-containing protein 0.9206 31 222 GO:0008650
AF-G7G3S3-F1-model_v4 deleted 0.92 54 223

Feature Viewer

pLDDT pTM Quality
79.47 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map