F423167

General Info

Members Datasets Scaffolds Average Seq Length
363 234 726 219

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8056579771|8056584259
Length 224
Sequence TMPTGARGTTPLSTAQMAARVAADIRPGSYVNLGIGLPTLVADHLPAGSGITLHTENGLLGMGPSPGADLVDPELINAGKVPVTELAGASYFHQADSFAMMRGGHIDVCVLGAFQVSTSGDLANWSTGRPGAVPAVGGAMDLAVGAKRSVVMMRLLTKDGRPKLLRECTLPLTGVGCVSRIYSDVAVIDVGPASDGEAVLVESYGVAHRELEEMLGLSLASVSV

Samples

Sample ID Description Type Environment
1 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
158 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
159 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
160 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
161 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
162 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
163 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
164 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
165 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
166 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
167 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
168 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
169 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
170 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
171 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
174 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
188 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
189 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
202 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
203 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
204 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
205 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
206 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
207 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
212 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
213 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
214 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
215 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
216 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
217 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
218 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
219 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
220 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
221 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
222 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
223 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
224 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere
225 2643221641 Nocardioides sp. Root122 Isolate Unclassified
226 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
227 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
228 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
229 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
230 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
231 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
232 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
233 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
234 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.97
Metatranscriptomes 0
Isolates 3.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.03
Nodule 0.28
Rhizoplane 4.68
Rhizosphere 88.71
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1014404 3300001976 Bacteria 1031
2 JGI24751J29686_10000216 3300002459 Bacteria 24503
3 Ga0065707_10084570 3300005295 Bacteria 7048
4 Ga0070676_10006246 3300005328 Bacteria 6363
5 Ga0070683_100127715 3300005329 Bacteria 2404
6 Ga0070690_100006535 3300005330 Bacteria 6617
7 Ga0070670_100000003 3300005331 Bacteria 529510
8 Ga0070677_10120529 3300005333 Bacteria 1184
9 Ga0068869_100678104 3300005334 Bacteria 877
10 Ga0070666_10019555 3300005335 Bacteria 4373
11 Ga0070666_10026845 3300005335 Bacteria 3766
12 Ga0070666_10065416 3300005335 Bacteria 2467
13 Ga0070666_10200706 3300005335 Bacteria 1403
14 Ga0070682_100001519 3300005337 Bacteria 12993
15 Ga0068868_100000011 3300005338 Bacteria 117273
16 Ga0068868_100000203 3300005338 Bacteria 40057
17 Ga0068868_100244518 3300005338 Bacteria 1508
18 Ga0070660_100000648 3300005339 Bacteria 23026
19 Ga0070660_100003716 3300005339 Bacteria 10542
20 Ga0070660_100043919 3300005339 Bacteria 3416
21 Ga0070660_100698436 3300005339 Bacteria 850
22 Ga0070691_10007079 3300005341 Bacteria 5142
23 Ga0070687_100015117 3300005343 Bacteria 3481
24 Ga0070692_10016475 3300005345 Bacteria 3515
25 Ga0070668_100021204 3300005347 Bacteria 4911
26 Ga0070668_100036308 3300005347 Bacteria 3760
27 Ga0070668_100394016 3300005347 Bacteria 1181
28 Ga0070669_100000020 3300005353 Bacteria 181297
29 Ga0070669_100264073 3300005353 Bacteria 1374
30 Ga0070675_100086708 3300005354 Bacteria 2617
31 Ga0070674_100000244 3300005356 Bacteria 26961
32 Ga0070674_100199655 3300005356 Bacteria 1544
33 Ga0070673_100054249 3300005364 Bacteria 3152
34 Ga0070673_100554311 3300005364 Bacteria 1044
35 Ga0070688_100003038 3300005365 Bacteria 8564
36 Ga0070659_100000004 3300005366 Bacteria 267958
37 Ga0070659_100016980 3300005366 Bacteria 5471
38 Ga0070667_100000581 3300005367 Bacteria 36106
39 Ga0070667_100008301 3300005367 Bacteria 8609
40 Ga0070709_10003216 3300005434 Bacteria 8774
41 Ga0070714_100145392 3300005435 Bacteria 2132
42 Ga0070710_10000808 3300005437 Bacteria 15022
43 Ga0070701_10000310 3300005438 Bacteria 15901
44 Ga0070711_100002396 3300005439 Bacteria 10681
45 Ga0070705_100025252 3300005440 Bacteria 3219
46 Ga0070700_100023840 3300005441 Bacteria 3584
47 Ga0070694_100038583 3300005444 Bacteria 3175
48 Ga0070694_100186417 3300005444 Bacteria 1538
49 Ga0070678_100000855 3300005456 Bacteria 15524
50 Ga0070662_100000713 3300005457 Bacteria 20417
51 Ga0070662_100068043 3300005457 Bacteria 2617
52 Ga0070662_100179114 3300005457 Bacteria 1670
53 Ga0070681_10559452 3300005458 Bacteria 1057
54 Ga0068867_100001211 3300005459 Bacteria 17725
55 Ga0070706_100255854 3300005467 Bacteria 1635
56 Ga0070672_100221751 3300005543 Bacteria 1586
57 Ga0070695_100033480 3300005545 Bacteria 3215
58 Ga0070696_100008077 3300005546 Bacteria 7035
59 Ga0070696_100019562 3300005546 Bacteria 4586
60 Ga0070693_100009763 3300005547 Bacteria 4783
61 Ga0070665_100015960 3300005548 Bacteria 7539
62 Ga0070665_100117268 3300005548 Bacteria 2665
63 Ga0070665_100741206 3300005548 Bacteria 995
64 Ga0070704_100000392 3300005549 Bacteria 20077
65 Ga0068855_100628465 3300005563 Bacteria 1155
66 Ga0068854_100000262 3300005578 Bacteria 35841
67 Ga0068859_100002266 3300005617 Bacteria 19509
68 Ga0068859_100003505 3300005617 Bacteria 15985
69 Ga0068859_100039215 3300005617 Bacteria 4751
70 Ga0068864_100000005 3300005618 Bacteria 400840
71 Ga0068866_10000490 3300005718 Bacteria 18191
72 Ga0068861_100011691 3300005719 Bacteria 6107
73 Ga0068861_100014274 3300005719 Bacteria 5574
74 Ga0068858_100001689 3300005842 Bacteria 22563
75 Ga0068858_100546692 3300005842 Bacteria 1121
76 Ga0068858_100888803 3300005842 Bacteria 871
77 Ga0068860_100001255 3300005843 Bacteria 27661
78 Ga0068860_100092169 3300005843 Bacteria 2887
79 Ga0068862_100000001 3300005844 Bacteria 523031
80 Ga0068862_100001317 3300005844 Bacteria 23074
81 Ga0068862_100593495 3300005844 Bacteria 1062
82 Ga0081455_10011091 3300005937 Bacteria 9073
83 Ga0081455_10288364 3300005937 Bacteria 1183
84 Ga0081539_10006226 3300005985 Bacteria 11566
85 Ga0081539_10030297 3300005985 Bacteria 3361
86 Ga0070717_10443724 3300006028 Bacteria 1169
87 Ga0070715_10001049 3300006163 Bacteria 7805
88 Ga0070716_100001640 3300006173 Bacteria 10102
89 Ga0070712_100001225 3300006175 Bacteria 15514
90 Ga0075369_10000628 3300006186 Bacteria 11200
91 Ga0097621_100466205 3300006237 Bacteria 1140
92 Ga0068865_100000770 3300006881 Bacteria 17965
93 Ga0097620_100002267 3300006931 Bacteria 19509
94 Ga0097620_100003505 3300006931 Bacteria 15985
95 Ga0097620_100039216 3300006931 Bacteria 4751
96 Ga0111539_10057439 3300009094 Bacteria 4621
97 Ga0105245_10001005 3300009098 Bacteria 25622
98 Ga0105243_10000676 3300009148 Bacteria 33249
99 Ga0105241_10129405 3300009174 Bacteria 2042
100 Ga0105242_10000197 3300009176 Bacteria 46948
101 Ga0105248_10001558 3300009177 Bacteria 25511
102 Ga0105248_10003464 3300009177 Bacteria 17524
103 Ga0105248_10021552 3300009177 Bacteria 7138
104 Ga0105248_10045098 3300009177 Bacteria 4944
105 Ga0105237_10123464 3300009545 Bacteria 2584
106 Ga0105238_10090407 3300009551 Bacteria 3049
107 Ga0099796_10063933 3300010159 Bacteria 1312
108 Ga0105239_10004408 3300010375 Bacteria 16853
109 Ga0105246_10737835 3300011119 Bacteria 867
110 Ga0157371_10077135 3300013102 Bacteria 2360
111 Ga0157374_10079931 3300013296 Bacteria 3099
112 Ga0157378_10097095 3300013297 Bacteria 2685
113 Ga0157378_10158437 3300013297 Bacteria 2115
114 Ga0163162_10002808 3300013306 Bacteria 16565
115 Ga0163162_10708019 3300013306 Bacteria 1128
116 Ga0157372_10005085 3300013307 Bacteria 13986
117 Ga0157375_10001551 3300013308 Bacteria 19772
118 Ga0163163_10125024 3300014325 Bacteria 2609
119 Ga0157380_10000029 3300014326 Bacteria 98248
120 Ga0157380_10000136 3300014326 Bacteria 41118
121 Ga0157377_10321976 3300014745 Bacteria 1028
122 Ga0157379_10002115 3300014968 Bacteria 16461
123 Ga0157379_10139880 3300014968 Bacteria 2182
124 Ga0163161_10005634 3300017792 Bacteria 8685
125 Ga0207692_10005487 3300025898 Bacteria 5084
126 Ga0207642_10000178 3300025899 Bacteria 18339
127 Ga0207688_10009202 3300025901 Bacteria 5381
128 Ga0207680_10012186 3300025903 Bacteria 4373
129 Ga0207680_10036193 3300025903 Bacteria 2841
130 Ga0207680_10045031 3300025903 Bacteria 2599
131 Ga0207680_10183305 3300025903 Bacteria 1417
132 Ga0207647_10034358 3300025904 Bacteria 3238
133 Ga0207685_10003329 3300025905 Bacteria 3892
134 Ga0207699_10011117 3300025906 Bacteria 4536
135 Ga0207645_10205691 3300025907 Bacteria 1296
136 Ga0207684_10423287 3300025910 Bacteria 1144
137 Ga0207654_10149187 3300025911 Bacteria 1499
138 Ga0207707_10093847 3300025912 Bacteria 2622
139 Ga0207693_10000507 3300025915 Bacteria 35136
140 Ga0207693_10157427 3300025915 Bacteria 1787
141 Ga0207663_10004149 3300025916 Bacteria 7173
142 Ga0207660_10402645 3300025917 Bacteria 1102
143 Ga0207662_10028201 3300025918 Bacteria 3244
144 Ga0207657_10268210 3300025919 Bacteria 1357
145 Ga0207681_10000005 3300025923 Bacteria 555724
146 Ga0207681_10046212 3300025923 Bacteria 2928
147 Ga0207694_10256293 3300025924 Bacteria 1432
148 Ga0207650_10000004 3300025925 Bacteria 743372
149 Ga0207659_10220039 3300025926 Bacteria 1526
150 Ga0207687_10003137 3300025927 Bacteria 11208
151 Ga0207700_10029913 3300025928 Bacteria 3850
152 Ga0207700_10048903 3300025928 Bacteria 3143
153 Ga0207664_10005692 3300025929 Bacteria 8517
154 Ga0207664_10412166 3300025929 Bacteria 1203
155 Ga0207690_10023529 3300025932 Bacteria 3845
156 Ga0207706_10001533 3300025933 Bacteria 22933
157 Ga0207706_10002707 3300025933 Bacteria 17263
158 Ga0207706_10097215 3300025933 Bacteria 2589
159 Ga0207686_10031433 3300025934 Bacteria 3152
160 Ga0207669_10111394 3300025937 Bacteria 1835
161 Ga0207665_10001870 3300025939 Bacteria 14190
162 Ga0207691_10002422 3300025940 Bacteria 18263
163 Ga0207691_10230121 3300025940 Bacteria 1605
164 Ga0207711_10000075 3300025941 Bacteria 106870
165 Ga0207711_10054076 3300025941 Bacteria 3444
166 Ga0207711_10061867 3300025941 Bacteria 3228
167 Ga0207689_10542147 3300025942 Bacteria 977
168 Ga0207679_10497510 3300025945 Bacteria 1087
169 Ga0207667_10075468 3300025949 Bacteria 3501
170 Ga0207712_10003191 3300025961 Bacteria 10430
171 Ga0207668_10001538 3300025972 Bacteria 13494
172 Ga0207640_10000827 3300025981 Bacteria 17626
173 Ga0207640_10328656 3300025981 Bacteria 1220
174 Ga0207658_10008136 3300025986 Bacteria 7143
175 Ga0207658_10012613 3300025986 Bacteria 5771
176 Ga0207658_10145634 3300025986 Bacteria 1923
177 Ga0207677_10022443 3300026023 Bacteria 3879
178 Ga0207703_10000920 3300026035 Bacteria 28669
179 Ga0207703_10204842 3300026035 Bacteria 1755
180 Ga0207639_10032434 3300026041 Bacteria 3845
181 Ga0207678_10011888 3300026067 Bacteria 7644
182 Ga0207708_10010331 3300026075 Bacteria 6931
183 Ga0207641_10071296 3300026088 Bacteria 2988
184 Ga0207648_10000929 3300026089 Bacteria 33018
185 Ga0207676_10000006 3300026095 Bacteria 681936
186 Ga0207676_10056656 3300026095 Bacteria 3082
187 Ga0207675_100000544 3300026118 Bacteria 36830
188 Ga0207675_100001138 3300026118 Bacteria 26336
189 Ga0207683_10000335 3300026121 Bacteria 42789
190 Ga0209974_10004613 3300027876 Bacteria 4903
191 Ga0268266_10028987 3300028379 Bacteria 4704
192 Ga0268266_10135955 3300028379 Bacteria 2202
193 Ga0268265_10000001 3300028380 Bacteria 1230727
194 Ga0268265_10000980 3300028380 Bacteria 26001
195 Ga0268265_10009821 3300028380 Bacteria 6459
196 Ga0268264_10001041 3300028381 Bacteria 27858
197 Ga0268264_10142125 3300028381 Bacteria 2141
198 Ga0316176_1218616 3300030732 Bacteria 1285
199 Ga0307408_100050536 3300031548 Bacteria 2991
200 Ga0307408_100077533 3300031548 Bacteria 2474
201 Ga0307408_100274584 3300031548 Bacteria 1401
202 Ga0307405_10023684 3300031731 Bacteria 3493
203 Ga0307413_10004503 3300031824 Bacteria 6073
204 Ga0307413_10056730 3300031824 Bacteria 2391
205 Ga0307413_10079828 3300031824 Bacteria 2093
206 Ga0307413_10098175 3300031824 Bacteria 1927
207 Ga0307410_10029714 3300031852 Bacteria 3483
208 Ga0307410_10208641 3300031852 Bacteria 1495
209 Ga0307406_10482291 3300031901 Bacteria 1001
210 Ga0307407_10039094 3300031903 Bacteria 2635
211 Ga0307407_10179998 3300031903 Bacteria 1400
212 Ga0307407_10567574 3300031903 Bacteria 841
213 Ga0307412_10020453 3300031911 Bacteria 4028
214 Ga0307412_10069670 3300031911 Bacteria 2394
215 Ga0307412_10223717 3300031911 Bacteria 1444
216 Ga0307409_100014351 3300031995 Bacteria 5149
217 Ga0307409_100050904 3300031995 Bacteria 3166
218 Ga0307409_100236069 3300031995 Bacteria 1661
219 Ga0307409_100481662 3300031995 Bacteria 1204
220 Ga0307416_100268328 3300032002 Bacteria 1673
221 Ga0307416_100778257 3300032002 Bacteria 1051
222 Ga0307414_10073066 3300032004 Bacteria 2480
223 Ga0307414_10222016 3300032004 Bacteria 1552
224 Ga0307411_10022740 3300032005 Bacteria 3698
225 Ga0307411_10034851 3300032005 Bacteria 3136
226 Ga0307411_10189469 3300032005 Bacteria 1569
227 Ga0307411_10217601 3300032005 Bacteria 1479
228 Ga0307411_10812059 3300032005 Bacteria 824
229 Ga0307415_100002727 3300032126 Bacteria 8823
230 Ga0307415_100039593 3300032126 Bacteria 3116
231 Ga0307415_100075526 3300032126 Bacteria 2385
232 Ga0373960_0064161 3300035121 Bacteria 1121
233 Ga0373931_0044251 3300035691 Bacteria 2347
234 Ga0395899_0052923 3300037312 Bacteria 3007
235 Ga0395899_0095846 3300037312 Bacteria 2146
236 Ga0395899_0327577 3300037312 Bacteria 1030
237 Ga0395900_0004164 3300037418 Bacteria 15391
238 Ga0395900_0009006 3300037418 Bacteria 10235
239 Ga0395900_0018553 3300037418 Bacteria 7094
240 Ga0395900_0036983 3300037418 Bacteria 5033
241 Ga0395900_0053360 3300037418 Bacteria 4161
242 Ga0395900_0069613 3300037418 Bacteria 3616
243 Ga0395900_0177300 3300037418 Bacteria 2167
244 Ga0395900_0410735 3300037418 Bacteria 1316
245 Ga0395900_0514927 3300037418 Bacteria 1145
246 Ga0395898_0067325 3300037466 Bacteria 3467
247 Ga0395898_0366442 3300037466 Bacteria 1374
248 Ga0395898_0557485 3300037466 Bacteria 1088
249 Ga0395905_0010668 3300037471 Bacteria 8912
250 Ga0395905_0015629 3300037471 Bacteria 7212
251 Ga0395905_0016805 3300037471 Bacteria 6951
252 Ga0395905_0017444 3300037471 Bacteria 6815
253 Ga0395905_0026507 3300037471 Bacteria 5464
254 Ga0395905_0035971 3300037471 Bacteria 4650
255 Ga0395905_0049853 3300037471 Bacteria 3924
256 Ga0395905_0063167 3300037471 Bacteria 3464
257 Ga0395905_0098806 3300037471 Bacteria 2741
258 Ga0395905_0104786 3300037471 Bacteria 2655
259 Ga0395905_0209717 3300037471 Bacteria 1825
260 Ga0436364_0295768 3300037853 Bacteria 1232
261 Ga0395901_0002772 3300038443 Bacteria 17659
262 Ga0395901_0005608 3300038443 Bacteria 12703
263 Ga0395901_0011522 3300038443 Bacteria 8960
264 Ga0395901_0164154 3300038443 Bacteria 2332
265 Ga0395901_0954351 3300038443 Bacteria 836
266 Ga0237819_00448 3300038705 Bacteria 14028
267 Ga0237819_00646 3300038705 Bacteria 11334
268 Ga0436360_0016165 3300039438 Bacteria 759
269 Ga0439461_0011498 3300041410 Bacteria 1644
270 Ga0439466_0009408 3300041411 Bacteria 3649
271 Ga0439465_0000256 3300041413 Bacteria 14670
272 Ga0439445_0016968 3300042004 Bacteria 1796
273 Ga0439448_0000796 3300042005 Bacteria 7662
274 Ga0439455_0000177 3300042012 Bacteria 7346
275 Ga0439458_0000114 3300042157 Bacteria 16227
276 Ga0450893_0031638 3300042532 Bacteria 945
277 Ga0466972_0030664 3300044658 Bacteria 2647
278 Ga0466972_0043561 3300044658 Bacteria 2179
279 Ga0466972_0092440 3300044658 Bacteria 1434
280 Ga0466965_0069419 3300044683 Bacteria 1771
281 Ga0466965_0259357 3300044683 Bacteria 934
282 Ga0466961_0073984 3300044693 Bacteria 2160
283 Ga0466968_0116747 3300044735 Bacteria 1204
284 Ga0466970_0055641 3300044765 Bacteria 2113
285 Ga0466959_0009560 3300045049 Bacteria 6898
286 Ga0466959_0198926 3300045049 Bacteria 1396
287 Ga0495583_0181188 3300046506 Bacteria 862
288 Ga0495625_0189169 3300046660 Bacteria 1365
289 Ga0496100_0000383 3300048903 Bacteria 21527
290 Ga0496100_0092929 3300048903 Bacteria 2063
291 Ga0496101_0015817 3300048904 Bacteria 5091
292 Ga0496102_0003043 3300048905 Bacteria 14207
293 Ga0496102_0075254 3300048905 Bacteria 3104
294 Ga0496103_0001173 3300048906 Bacteria 18017
295 Ga0496106_0000615 3300048909 Bacteria 25459
296 Ga0496106_0014446 3300048909 Bacteria 5835
297 Ga0496107_0001171 3300048910 Bacteria 15903
298 Ga0496107_0155997 3300048910 Bacteria 1690
299 Ga0496107_0301232 3300048910 Bacteria 1193
300 Ga0496108_0090085 3300048911 Bacteria 2607
301 Ga0496109_0509344 3300048912 Bacteria 1136
302 Ga0496110_0124200 3300048913 Bacteria 2328
303 Ga0496113_0134829 3300048916 Bacteria 1939
304 Ga0496114_0000517 3300048917 Bacteria 28403
305 Ga0496115_0020373 3300048918 Bacteria 5116
306 Ga0496121_0018158 3300048924 Bacteria 7112
307 Ga0496125_0018413 3300048928 Bacteria 6634
308 Ga0501031_0060143 3300049568 Bacteria 2476
309 Ga0501032_0004506 3300049569 Bacteria 10485
310 Ga0501032_0111254 3300049569 Bacteria 1812
311 Ga0501034_0006009 3300049571 Bacteria 13129
312 Ga0501034_0344846 3300049571 Bacteria 1419
313 Ga0501036_0043907 3300049572 Bacteria 3785
314 Ga0501037_0003884 3300049573 Bacteria 10841
315 Ga0501037_0319383 3300049573 Bacteria 1075
316 Ga0501038_0011365 3300049574 Bacteria 8125
317 Ga0501038_0055801 3300049574 Bacteria 3393
318 Ga0501039_0002788 3300049575 Bacteria 13051
319 Ga0501039_0060559 3300049575 Bacteria 2932
320 Ga0501040_0093749 3300049576 Bacteria 2088
321 Ga0501042_0063373 3300049578 Bacteria 2642
322 Ga0501043_0001202 3300049579 Bacteria 22791
323 Ga0501043_0141245 3300049579 Bacteria 1886
324 Ga0501046_0026584 3300049580 Bacteria 4727
325 Ga0501047_0175416 3300049581 Bacteria 2011
326 Ga0501068_0016165 3300049584 Bacteria 4299
327 Ga0501068_0085408 3300049584 Bacteria 1942
328 Ga0501070_0000400 3300049586 Bacteria 39598
329 Ga0501071_0090850 3300049587 Bacteria 2243
330 Ga0501072_0039279 3300049588 Bacteria 3716
331 Ga0501073_0015976 3300049589 Bacteria 5441
332 Ga0501077_0313841 3300049593 Bacteria 999
333 Ga0501079_0043753 3300049741 Bacteria 3457
334 Ga0501080_0098475 3300049742 Bacteria 2714
335 Ga0501081_0099697 3300049743 Bacteria 2052
336 Ga0501044_0010845 3300049823 Bacteria 9887
337 Ga0501044_0082333 3300049823 Bacteria 3257
338 Ga0501044_0814025 3300049823 Bacteria 813
339 nmdc:mga09592_470091_c1 3300050508 Bacteria 1084
340 nmdc:mga0rr50_693502_c1 3300050513 Bacteria 869
341 nmdc:mga0sz30_1090_c1 3300050516 Bacteria 9763
342 Ga0500643_013614 3300053087 Bacteria 2865
343 Ga0500641_0000297 3300053096 Bacteria 18568
344 Ga0500556_0001266 3300053104 Bacteria 11551
345 Ga0500652_042675 3300053131 Bacteria 1831
346 Ga0500616_0004336 3300053153 Bacteria 10156
347 Ga0500622_0010318 3300053156 Bacteria 5132
348 Ga0500622_0011212 3300053156 Bacteria 4891
349 Ga0500645_000791 3300053730 Bacteria 18988
350 Ga0500587_002151 3300053739 Bacteria 2811
351 Ga0501084_0062090 3300054114 Bacteria 3128
352 Ga0501082_0001447 3300060353 Bacteria 20842
353 8056584259 8056579771 Bacteria 5840325
354 2644229961 2643221641 Bacteria 4490190
355 2760307630 2758568522 Bacteria 5953541
356 2774394723 2773857762 Bacteria 5971770
357 2778126555 2775507255 Bacteria 3945731
358 2809194433 2808606439 Bacteria 5952208
359 2812349182 2811994878 Bacteria 5992952
360 2842137127 2842134933 Bacteria 5847019
361 2891973107 2891968417 Bacteria 5821697
362 2902803642 2902799365 Bacteria 5419524
363 2939586890 2939582691 Bacteria 7088898
364 JGI24752J21851_1014404
365 JGI24751J29686_10000216
366 Ga0065707_10084570
367 Ga0070676_10006246
368 Ga0070683_100127715
369 Ga0070690_100006535
370 Ga0070670_100000003
371 Ga0070677_10120529
372 Ga0068869_100678104
373 Ga0070666_10019555
374 Ga0070666_10026845
375 Ga0070666_10065416
376 Ga0070666_10200706
377 Ga0070682_100001519
378 Ga0068868_100000011
379 Ga0068868_100000203
380 Ga0068868_100244518
381 Ga0070660_100000648
382 Ga0070660_100003716
383 Ga0070660_100043919
384 Ga0070660_100698436
385 Ga0070691_10007079
386 Ga0070687_100015117
387 Ga0070692_10016475
388 Ga0070668_100021204
389 Ga0070668_100036308
390 Ga0070668_100394016
391 Ga0070669_100000020
392 Ga0070669_100264073
393 Ga0070675_100086708
394 Ga0070674_100000244
395 Ga0070674_100199655
396 Ga0070673_100054249
397 Ga0070673_100554311
398 Ga0070688_100003038
399 Ga0070659_100000004
400 Ga0070659_100016980
401 Ga0070667_100000581
402 Ga0070667_100008301
403 Ga0070709_10003216
404 Ga0070714_100145392
405 Ga0070710_10000808
406 Ga0070701_10000310
407 Ga0070711_100002396
408 Ga0070705_100025252
409 Ga0070700_100023840
410 Ga0070694_100038583
411 Ga0070694_100186417
412 Ga0070678_100000855
413 Ga0070662_100000713
414 Ga0070662_100068043
415 Ga0070662_100179114
416 Ga0070681_10559452
417 Ga0068867_100001211
418 Ga0070706_100255854
419 Ga0070672_100221751
420 Ga0070695_100033480
421 Ga0070696_100008077
422 Ga0070696_100019562
423 Ga0070693_100009763
424 Ga0070665_100015960
425 Ga0070665_100117268
426 Ga0070665_100741206
427 Ga0070704_100000392
428 Ga0068855_100628465
429 Ga0068854_100000262
430 Ga0068859_100002266
431 Ga0068859_100003505
432 Ga0068859_100039215
433 Ga0068864_100000005
434 Ga0068866_10000490
435 Ga0068861_100011691
436 Ga0068861_100014274
437 Ga0068858_100001689
438 Ga0068858_100546692
439 Ga0068858_100888803
440 Ga0068860_100001255
441 Ga0068860_100092169
442 Ga0068862_100000001
443 Ga0068862_100001317
444 Ga0068862_100593495
445 Ga0081455_10011091
446 Ga0081455_10288364
447 Ga0081539_10006226
448 Ga0081539_10030297
449 Ga0070717_10443724
450 Ga0070715_10001049
451 Ga0070716_100001640
452 Ga0070712_100001225
453 Ga0075369_10000628
454 Ga0097621_100466205
455 Ga0068865_100000770
456 Ga0097620_100002267
457 Ga0097620_100003505
458 Ga0097620_100039216
459 Ga0111539_10057439
460 Ga0105245_10001005
461 Ga0105243_10000676
462 Ga0105241_10129405
463 Ga0105242_10000197
464 Ga0105248_10001558
465 Ga0105248_10003464
466 Ga0105248_10021552
467 Ga0105248_10045098
468 Ga0105237_10123464
469 Ga0105238_10090407
470 Ga0099796_10063933
471 Ga0105239_10004408
472 Ga0105246_10737835
473 Ga0157371_10077135
474 Ga0157374_10079931
475 Ga0157378_10097095
476 Ga0157378_10158437
477 Ga0163162_10002808
478 Ga0163162_10708019
479 Ga0157372_10005085
480 Ga0157375_10001551
481 Ga0163163_10125024
482 Ga0157380_10000029
483 Ga0157380_10000136
484 Ga0157377_10321976
485 Ga0157379_10002115
486 Ga0157379_10139880
487 Ga0163161_10005634
488 Ga0207692_10005487
489 Ga0207642_10000178
490 Ga0207688_10009202
491 Ga0207680_10012186
492 Ga0207680_10036193
493 Ga0207680_10045031
494 Ga0207680_10183305
495 Ga0207647_10034358
496 Ga0207685_10003329
497 Ga0207699_10011117
498 Ga0207645_10205691
499 Ga0207684_10423287
500 Ga0207654_10149187
501 Ga0207707_10093847
502 Ga0207693_10000507
503 Ga0207693_10157427
504 Ga0207663_10004149
505 Ga0207660_10402645
506 Ga0207662_10028201
507 Ga0207657_10268210
508 Ga0207681_10000005
509 Ga0207681_10046212
510 Ga0207694_10256293
511 Ga0207650_10000004
512 Ga0207659_10220039
513 Ga0207687_10003137
514 Ga0207700_10029913
515 Ga0207700_10048903
516 Ga0207664_10005692
517 Ga0207664_10412166
518 Ga0207690_10023529
519 Ga0207706_10001533
520 Ga0207706_10002707
521 Ga0207706_10097215
522 Ga0207686_10031433
523 Ga0207669_10111394
524 Ga0207665_10001870
525 Ga0207691_10002422
526 Ga0207691_10230121
527 Ga0207711_10000075
528 Ga0207711_10054076
529 Ga0207711_10061867
530 Ga0207689_10542147
531 Ga0207679_10497510
532 Ga0207667_10075468
533 Ga0207712_10003191
534 Ga0207668_10001538
535 Ga0207640_10000827
536 Ga0207640_10328656
537 Ga0207658_10008136
538 Ga0207658_10012613
539 Ga0207658_10145634
540 Ga0207677_10022443
541 Ga0207703_10000920
542 Ga0207703_10204842
543 Ga0207639_10032434
544 Ga0207678_10011888
545 Ga0207708_10010331
546 Ga0207641_10071296
547 Ga0207648_10000929
548 Ga0207676_10000006
549 Ga0207676_10056656
550 Ga0207675_100000544
551 Ga0207675_100001138
552 Ga0207683_10000335
553 Ga0209974_10004613
554 Ga0268266_10028987
555 Ga0268266_10135955
556 Ga0268265_10000001
557 Ga0268265_10000980
558 Ga0268265_10009821
559 Ga0268264_10001041
560 Ga0268264_10142125
561 Ga0316176_1218616
562 Ga0307408_100050536
563 Ga0307408_100077533
564 Ga0307408_100274584
565 Ga0307405_10023684
566 Ga0307413_10004503
567 Ga0307413_10056730
568 Ga0307413_10079828
569 Ga0307413_10098175
570 Ga0307410_10029714
571 Ga0307410_10208641
572 Ga0307406_10482291
573 Ga0307407_10039094
574 Ga0307407_10179998
575 Ga0307407_10567574
576 Ga0307412_10020453
577 Ga0307412_10069670
578 Ga0307412_10223717
579 Ga0307409_100014351
580 Ga0307409_100050904
581 Ga0307409_100236069
582 Ga0307409_100481662
583 Ga0307416_100268328
584 Ga0307416_100778257
585 Ga0307414_10073066
586 Ga0307414_10222016
587 Ga0307411_10022740
588 Ga0307411_10034851
589 Ga0307411_10189469
590 Ga0307411_10217601
591 Ga0307411_10812059
592 Ga0307415_100002727
593 Ga0307415_100039593
594 Ga0307415_100075526
595 Ga0373960_0064161
596 Ga0373931_0044251
597 Ga0395899_0052923
598 Ga0395899_0095846
599 Ga0395899_0327577
600 Ga0395900_0004164
601 Ga0395900_0009006
602 Ga0395900_0018553
603 Ga0395900_0036983
604 Ga0395900_0053360
605 Ga0395900_0069613
606 Ga0395900_0177300
607 Ga0395900_0410735
608 Ga0395900_0514927
609 Ga0395898_0067325
610 Ga0395898_0366442
611 Ga0395898_0557485
612 Ga0395905_0010668
613 Ga0395905_0015629
614 Ga0395905_0016805
615 Ga0395905_0017444
616 Ga0395905_0026507
617 Ga0395905_0035971
618 Ga0395905_0049853
619 Ga0395905_0063167
620 Ga0395905_0098806
621 Ga0395905_0104786
622 Ga0395905_0209717
623 Ga0436364_0295768
624 Ga0395901_0002772
625 Ga0395901_0005608
626 Ga0395901_0011522
627 Ga0395901_0164154
628 Ga0395901_0954351
629 Ga0237819_00448
630 Ga0237819_00646
631 Ga0436360_0016165
632 Ga0439461_0011498
633 Ga0439466_0009408
634 Ga0439465_0000256
635 Ga0439445_0016968
636 Ga0439448_0000796
637 Ga0439455_0000177
638 Ga0439458_0000114
639 Ga0450893_0031638
640 Ga0466972_0030664
641 Ga0466972_0043561
642 Ga0466972_0092440
643 Ga0466965_0069419
644 Ga0466965_0259357
645 Ga0466961_0073984
646 Ga0466968_0116747
647 Ga0466970_0055641
648 Ga0466959_0009560
649 Ga0466959_0198926
650 Ga0495583_0181188
651 Ga0495625_0189169
652 Ga0496100_0000383
653 Ga0496100_0092929
654 Ga0496101_0015817
655 Ga0496102_0003043
656 Ga0496102_0075254
657 Ga0496103_0001173
658 Ga0496106_0000615
659 Ga0496106_0014446
660 Ga0496107_0001171
661 Ga0496107_0155997
662 Ga0496107_0301232
663 Ga0496108_0090085
664 Ga0496109_0509344
665 Ga0496110_0124200
666 Ga0496113_0134829
667 Ga0496114_0000517
668 Ga0496115_0020373
669 Ga0496121_0018158
670 Ga0496125_0018413
671 Ga0501031_0060143
672 Ga0501032_0004506
673 Ga0501032_0111254
674 Ga0501034_0006009
675 Ga0501034_0344846
676 Ga0501036_0043907
677 Ga0501037_0003884
678 Ga0501037_0319383
679 Ga0501038_0011365
680 Ga0501038_0055801
681 Ga0501039_0002788
682 Ga0501039_0060559
683 Ga0501040_0093749
684 Ga0501042_0063373
685 Ga0501043_0001202
686 Ga0501043_0141245
687 Ga0501046_0026584
688 Ga0501047_0175416
689 Ga0501068_0016165
690 Ga0501068_0085408
691 Ga0501070_0000400
692 Ga0501071_0090850
693 Ga0501072_0039279
694 Ga0501073_0015976
695 Ga0501077_0313841
696 Ga0501079_0043753
697 Ga0501080_0098475
698 Ga0501081_0099697
699 Ga0501044_0010845
700 Ga0501044_0082333
701 Ga0501044_0814025
702 nmdc:mga09592_470091_c1
703 nmdc:mga0rr50_693502_c1
704 nmdc:mga0sz30_1090_c1
705 Ga0500643_013614
706 Ga0500641_0000297
707 Ga0500556_0001266
708 Ga0500652_042675
709 Ga0500616_0004336
710 Ga0500622_0010318
711 Ga0500622_0011212
712 Ga0500645_000791
713 Ga0500587_002151
714 Ga0501084_0062090
715 Ga0501082_0001447
716 8056584259
717 2644229961
718 2760307630
719 2774394723
720 2778126555
721 2809194433
722 2812349182
723 2842137127
724 2891973107
725 2902803642
726 2939586890

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01144

CoA_trans

Coenzyme A transferase

14

207

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3k6m-assembly2.cif.gz_C dynamic domains of succinyl-coa:3-ketoacid-coenzyme a transferase from pig heart. 0.8456 12 217
3oxo-assembly3.cif.gz_E succinyl-coa:3-ketoacid coa transferase from pig heart covalently bound to coa 0.843 15 217
3oxo-assembly3.cif.gz_F succinyl-coa:3-ketoacid coa transferase from pig heart covalently bound to coa 0.8425 15 217
5dbn-assembly1.cif.gz_D crystal structure of atoda complex 0.8408 10 217
3oxo-assembly4.cif.gz_H succinyl-coa:3-ketoacid coa transferase from pig heart covalently bound to coa 0.8402 18 217
ID Description Score Start End Superfamily
5dbnD00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8408 10 217 3.40.1080.10
2nrcB02 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8172 12 217 3.40.1080.10
5dbnD00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8039 10 217 3.40.1080.10
2nrcB02 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.7788 12 217 3.40.1080.10
1o9lB02 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.7648 10 217 3.40.1080.10
ID Description Score Start End GO Terms
AF-A0A2N3DP54-F1-model_v4 Succinyl-CoA--3-ketoacid-CoA transferase 0.9966 138 218 GO:0008410
AF-A0A2N3DP54-F1-model_v4 Succinyl-CoA--3-ketoacid-CoA transferase 0.9727 138 218 GO:0008410
AF-A0A352H4X5-F1-model_v4 deleted 0.9458 98 217
AF-A0A832BV08-F1-model_v4 deleted 0.9202 100 218
AF-A0A3M1GDL0-F1-model_v4 Succinyl-CoA--3-ketoacid-CoA transferase 0.9174 98 215 GO:0008410

Map