F423203

General Info

Members Datasets Scaffolds Average Seq Length
364 242 330 372

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_10000790|Ga0070666_1000079018
Length 428
Sequence MSTRGAAAHAWIRYLTHLYTSVSVARLMNRSSRIRSSSPRAMNVVGLMSGTSADGIDAALVRIAGDGDAVTAKPLAFYVWPYPRGLQQRVLSAAAHGSVADICHLNAVLGECFGHAALAVIARAGLSPAQVHLIGSHGQTVHHLPVPIQEHGVGRIRSTLQIAEPSVIAERTGITTVANFRQRDMAAGGEGAPLAPFAHHRLLRDRHRSRLIVNLGGIGNVTYLPAGKRLKSVTAFDTGPANIVLDGLIHRLSKGRLSMDRNGRLASKGTVDLTLLNLMLAHPFLKKRPPKSTGREEFGDRFITRIMAAAPAKHKSEDLLATASLFTAITVGLSRQWLAGPIDEVIVGGGGALNRSVMGDLAAVFEPTPVKRFEDVGWESKSFEAIAFALLAYHTIKGECTNVPSVTGASHPVVQGQIVPGRWTWKQS

Samples

Sample ID Description Type Environment
1 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
2 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
3 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
4 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
5 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
6 2643221729 Bacillus sp. Root11 Isolate Unclassified
7 2643221730 Bacillus sp. Root131 Isolate Unclassified
8 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
9 2684622632 Bacillus cereus 905 Isolate Unclassified
10 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
11 2738543013 Variovorax sp. BT01 Isolate Unclassified
12 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
13 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
14 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
15 2842682962 Bacillus sp. R-72492 Isolate Unclassified
16 2849139964 Bacillus sp. R-71875 Isolate Unclassified
17 2857581216 Bacillus sp. R-71922 Isolate Unclassified
18 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
19 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
20 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
21 2938917290 Bacillus sp. CR71 Isolate Unclassified
22 2965761152 Bacillus sp. COPE52 Isolate Unclassified
23 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
24 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
25 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
26 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
27 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
28 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
29 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
30 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
31 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
32 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
33 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
34 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
39 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
40 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
41 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
42 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
48 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
51 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
90 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
91 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
113 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
114 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
152 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
153 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
154 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
157 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
158 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
163 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
172 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
173 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
174 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
175 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
176 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
177 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
180 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
181 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
182 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
183 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
184 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
185 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
186 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
187 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
188 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
189 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
190 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
191 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
192 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
193 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
194 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
195 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
196 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
197 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
198 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
199 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
200 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
201 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
202 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
211 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
212 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
213 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
214 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
216 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
217 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
218 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
219 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
220 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
221 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
222 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
223 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
224 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
225 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
226 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
227 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
228 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
229 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
233 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
234 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
235 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
236 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
237 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
238 8007371054 Clostridium sp. YIM B02515 Isolate Unclassified
239 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
240 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
241 8023438354 Bacillus sp. BH2 Isolate Unclassified
242 8023444577 Bacillus sp. BH32 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.38
Metatranscriptomes 0.27
Isolates 9.34

Biome Distribution

Category Percentage (%)
Aerial Root 0.55
Bulb 0
Endosphere 5.49
Nodule 0
Rhizoplane 2.47
Rhizosphere 78.85
Stem 0
Stem Tuber 0
Unclassified 12.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10004597 3300003187 Bacteria 7272
2 JGI25151J46595_10008006 3300003187 Bacteria 5123
3 JGI25151J46595_10014458 3300003187 Bacteria 3514
4 rootL2_10083384 3300003322 Bacteria 1992
5 Ga0055534_1002527 3300003784 Bacteria 6276
6 Ga0065712_10091110 3300005290 Bacteria 2390
7 Ga0065715_10094698 3300005293 Bacteria 4258
8 Ga0070658_10015968 3300005327 Bacteria 6006
9 Ga0070690_100022436 3300005330 Bacteria 3862
10 Ga0070690_100078977 3300005330 Bacteria 2151
11 Ga0070670_100014763 3300005331 Bacteria 6704
12 Ga0070666_10000790 3300005335 Bacteria 19210
13 Ga0070666_10257005 3300005335 Bacteria 1238
14 Ga0070680_100021576 3300005336 Bacteria 5121
15 Ga0070680_100026257 3300005336 Bacteria 4657
16 Ga0068868_100066217 3300005338 Bacteria 2872
17 Ga0070689_100001525 3300005340 Bacteria 14757
18 Ga0070689_100028247 3300005340 Bacteria 4238
19 Ga0070692_10019928 3300005345 Bacteria 3244
20 Ga0070668_100019258 3300005347 Bacteria 5137
21 Ga0070669_100068916 3300005353 Bacteria 2612
22 Ga0070675_100005529 3300005354 Bacteria 9671
23 Ga0070671_100061745 3300005355 Bacteria 3121
24 Ga0070671_100126877 3300005355 Unclassified 2148
25 Ga0070673_100001088 3300005364 Bacteria 15549
26 Ga0070688_100003233 3300005365 Bacteria 8353
27 Ga0070667_100045476 3300005367 Bacteria 3691
28 Ga0070667_100221397 3300005367 Bacteria 1685
29 Ga0070703_10023444 3300005406 Unclassified 1818
30 Ga0070708_100015530 3300005445 Bacteria 6292
31 Ga0070708_100482929 3300005445 Unclassified 1169
32 Ga0070678_100001083 3300005456 Bacteria 14258
33 Ga0070678_100052676 3300005456 Bacteria 2956
34 Ga0070662_100016808 3300005457 Bacteria 4918
35 Ga0070662_100141129 3300005457 Bacteria 1867
36 Ga0068867_100042332 3300005459 Bacteria 3331
37 Ga0070706_100000795 3300005467 Bacteria 35237
38 Ga0070706_100024321 3300005467 Bacteria 5575
39 Ga0070706_100058151 3300005467 Bacteria 3568
40 Ga0070706_100063813 3300005467 Bacteria 3404
41 Ga0070707_100039824 3300005468 Bacteria 4493
42 Ga0070707_100291612 3300005468 Bacteria 1585
43 Ga0070698_100054815 3300005471 Bacteria 4046
44 Ga0070698_100131982 3300005471 Bacteria 2453
45 Ga0070698_100275657 3300005471 Bacteria 1613
46 Ga0070699_100127150 3300005518 Bacteria 2245
47 Ga0070697_100042552 3300005536 Bacteria 3676
48 Ga0070697_100082727 3300005536 Bacteria 2647
49 Ga0070697_100163492 3300005536 Bacteria 1881
50 Ga0068853_100081730 3300005539 Bacteria 2829
51 Ga0070672_100000205 3300005543 Bacteria 32823
52 Ga0070695_100015124 3300005545 Bacteria 4657
53 Ga0070695_100067206 3300005545 Bacteria 2338
54 Ga0070696_100031078 3300005546 Bacteria 3658
55 Ga0070693_100003350 3300005547 Bacteria 7450
56 Ga0070665_100044921 3300005548 Bacteria 4435
57 Ga0070704_100009045 3300005549 Bacteria 6006
58 Ga0068855_100002024 3300005563 Bacteria 25144
59 Ga0070664_100025077 3300005564 Bacteria 4940
60 Ga0068857_100133382 3300005577 Bacteria 2241
61 Ga0068856_100020231 3300005614 Bacteria 6463
62 Ga0068852_100012465 3300005616 Bacteria 6457
63 Ga0068852_100114143 3300005616 Bacteria 2461
64 Ga0068859_100096529 3300005617 Bacteria 3008
65 Ga0068861_100191231 3300005719 Bacteria 1711
66 Ga0068851_10005345 3300005834 Bacteria 5829
67 Ga0068863_100211490 3300005841 Bacteria 1868
68 Ga0068858_100051162 3300005842 Bacteria 3822
69 Ga0068860_100078659 3300005843 Bacteria 3136
70 Ga0075364_10020526 3300006051 Bacteria 4155
71 Ga0075366_10002670 3300006195 Bacteria 9196
72 Ga0075366_10018663 3300006195 Bacteria 4006
73 Ga0097621_100007186 3300006237 Bacteria 7943
74 Ga0097621_100325372 3300006237 Bacteria 1362
75 Ga0097621_100350083 3300006237 Bacteria 1313
76 Ga0068871_100008632 3300006358 Bacteria 7329
77 Ga0068871_100040152 3300006358 Bacteria 3747
78 Ga0075428_100046589 3300006844 Bacteria 4761
79 Ga0075431_100005746 3300006847 Bacteria 12261
80 Ga0075431_100158486 3300006847 Bacteria 2328
81 Ga0075431_100315584 3300006847 Unclassified 1577
82 Ga0075433_10141460 3300006852 Bacteria 2138
83 Ga0075433_10212642 3300006852 Bacteria 1718
84 Ga0075434_100199615 3300006871 Bacteria 2020
85 Ga0075429_100003185 3300006880 Bacteria 13949
86 Ga0075429_100026826 3300006880 Bacteria 5002
87 Ga0075429_100039249 3300006880 Bacteria 4121
88 Ga0075436_100042147 3300006914 Bacteria 3148
89 Ga0097620_100096527 3300006931 Bacteria 3008
90 Ga0105251_10007498 3300009011 Bacteria 6709
91 Ga0105251_10037307 3300009011 Bacteria 2386
92 Ga0105244_10005007 3300009036 Bacteria 8929
93 Ga0105244_10022854 3300009036 Bacteria 3438
94 Ga0105250_10001847 3300009092 Bacteria 11044
95 Ga0105250_10005344 3300009092 Bacteria 5769
96 Ga0105240_10001120 3300009093 Bacteria 47119
97 Ga0111539_10000089 3300009094 Bacteria 94977
98 Ga0111539_10023835 3300009094 Bacteria 7520
99 Ga0111539_10056001 3300009094 Bacteria 4688
100 Ga0105245_10060481 3300009098 Bacteria 3411
101 Ga0105245_10089978 3300009098 Bacteria 2822
102 Ga0114129_10001966 3300009147 Bacteria 28118
103 Ga0114129_10005965 3300009147 Bacteria 17248
104 Ga0114129_10021387 3300009147 Bacteria 9183
105 Ga0114129_10029077 3300009147 Bacteria 7828
106 Ga0114129_10124306 3300009147 Bacteria 3548
107 Ga0105243_10378998 3300009148 Bacteria 1308
108 Ga0105242_10024855 3300009176 Bacteria 4734
109 Ga0105248_10022126 3300009177 Bacteria 7046
110 Ga0105248_10049736 3300009177 Bacteria 4701
111 Ga0105249_10005673 3300009553 Bacteria 10798
112 Ga0105239_10015729 3300010375 Bacteria 8374
113 Ga0157371_10020525 3300013102 Bacteria 4861
114 Ga0157371_10193717 3300013102 Bacteria 1456
115 Ga0157370_10116494 3300013104 Bacteria 2496
116 Ga0157370_10389649 3300013104 Unclassified 1283
117 Ga0157374_10065992 3300013296 Bacteria 3400
118 Ga0157374_10077598 3300013296 Bacteria 3144
119 Ga0157374_10136715 3300013296 Bacteria 2376
120 Ga0157378_10002957 3300013297 Bacteria 15109
121 Ga0163162_10030796 3300013306 Bacteria 5317
122 Ga0163162_10061055 3300013306 Bacteria 3807
123 Ga0163162_10102173 3300013306 Bacteria 2960
124 Ga0157372_10076640 3300013307 Bacteria 3776
125 Ga0157375_10001956 3300013308 Bacteria 17757
126 Ga0157375_10080908 3300013308 Bacteria 3287
127 Ga0163163_10086244 3300014325 Bacteria 3148
128 Ga0157379_10275196 3300014968 Bacteria 1531
129 Ga0157376_10001173 3300014969 Bacteria 17237
130 Ga0157376_10016037 3300014969 Bacteria 5676
131 Ga0157376_10217449 3300014969 Bacteria 1768
132 Ga0157376_10307060 3300014969 Bacteria 1504
133 Ga0157376_10334908 3300014969 Bacteria 1443
134 Ga0163161_10052253 3300017792 Bacteria 2962
135 Ga0213876_10052457 3300021384 Bacteria 2156
136 Ga0213876_10073306 3300021384 Bacteria 1808
137 Ga0209130_1002445 3300025284 Bacteria 9300
138 Ga0209130_1012715 3300025284 Bacteria 2186
139 Ga0209025_1000448 3300025294 Bacteria 80629
140 Ga0209025_1003490 3300025294 Bacteria 14823
141 Ga0209025_1003962 3300025294 Bacteria 13293
142 Ga0209025_1004269 3300025294 Bacteria 12565
143 Ga0209025_1004897 3300025294 Bacteria 11275
144 Ga0209025_1008393 3300025294 Bacteria 7445
145 Ga0207656_10008351 3300025321 Bacteria 3808
146 Ga0207696_1001137 3300025711 Bacteria 15389
147 Ga0207696_1013183 3300025711 Bacteria 2893
148 Ga0207655_1002430 3300025728 Bacteria 15145
149 Ga0207713_1038441 3300025735 Bacteria 2030
150 Ga0207653_10000409 3300025885 Bacteria 18625
151 Ga0207688_10126070 3300025901 Unclassified 1497
152 Ga0207645_10018813 3300025907 Bacteria 4537
153 Ga0207645_10160964 3300025907 Bacteria 1468
154 Ga0207684_10000152 3300025910 Bacteria 121082
155 Ga0207684_10002471 3300025910 Bacteria 18618
156 Ga0207684_10205707 3300025910 Bacteria 1698
157 Ga0207695_10010748 3300025913 Bacteria 11166
158 Ga0207660_10035784 3300025917 Bacteria 3449
159 Ga0207660_10060002 3300025917 Bacteria 2732
160 Ga0207652_10062991 3300025921 Bacteria 3206
161 Ga0207646_10000004 3300025922 Bacteria 529176
162 Ga0207646_10001691 3300025922 Bacteria 26814
163 Ga0207650_10051553 3300025925 Bacteria 3046
164 Ga0207650_10173932 3300025925 Bacteria 1713
165 Ga0207659_10072902 3300025926 Unclassified 2512
166 Ga0207644_10083223 3300025931 Bacteria 2369
167 Ga0207706_10052677 3300025933 Bacteria 3593
168 Ga0207706_10147403 3300025933 Bacteria 2070
169 Ga0207670_10001029 3300025936 Bacteria 14740
170 Ga0207691_10000046 3300025940 Bacteria 99655
171 Ga0207691_10019263 3300025940 Bacteria 6460
172 Ga0207711_10046305 3300025941 Bacteria 3716
173 Ga0207711_10230151 3300025941 Bacteria 1697
174 Ga0207689_10026566 3300025942 Bacteria 4850
175 Ga0207689_10155675 3300025942 Bacteria 1884
176 Ga0207679_10016050 3300025945 Bacteria 4965
177 Ga0207667_10003227 3300025949 Bacteria 20144
178 Ga0207651_10000286 3300025960 Bacteria 21703
179 Ga0207668_10036267 3300025972 Bacteria 3290
180 Ga0207658_10034003 3300025986 Bacteria 3640
181 Ga0207658_10148422 3300025986 Bacteria 1907
182 Ga0207677_10109232 3300026023 Bacteria 2056
183 Ga0207677_10122209 3300026023 Bacteria 1961
184 Ga0207639_10447896 3300026041 Bacteria 1172
185 Ga0207641_10299847 3300026088 Bacteria 1518
186 Ga0207648_10013361 3300026089 Bacteria 7642
187 Ga0207648_10027596 3300026089 Bacteria 5040
188 Ga0207674_10010817 3300026116 Bacteria 10287
189 Ga0207674_10129079 3300026116 Bacteria 2492
190 Ga0207675_100058624 3300026118 Bacteria 3593
191 Ga0207683_10002161 3300026121 Bacteria 17273
192 Ga0207683_10025252 3300026121 Bacteria 5124
193 Ga0207698_10004810 3300026142 Bacteria 8271
194 Ga0207698_10085895 3300026142 Bacteria 2557
195 Ga0207698_10225290 3300026142 Unclassified 1698
196 Ga0207428_10002500 3300027907 Bacteria 18359
197 Ga0207428_10013204 3300027907 Bacteria 7229
198 Ga0268266_10045090 3300028379 Unclassified 3771
199 Ga0268266_10075104 3300028379 Bacteria 2936
200 Ga0268264_10128899 3300028381 Bacteria 2240
201 Ga0268264_10135507 3300028381 Bacteria 2189
202 Ga0265338_10040136 3300028800 Bacteria 4401
203 Ga0265327_10000014 3300031251 Bacteria 506288
204 Ga0265327_10028589 3300031251 Bacteria 3185
205 Ga0265316_10001727 3300031344 Bacteria 23179
206 Ga0307513_10188460 3300031456 Bacteria 1917
207 Ga0307408_100068883 3300031548 Bacteria 2607
208 Ga0307408_100341400 3300031548 Unclassified 1268
209 Ga0265314_10001851 3300031711 Bacteria 22676
210 Ga0307516_10107135 3300031730 Bacteria 2604
211 Ga0316577_10020972 3300031733 Bacteria 3622
212 Ga0307410_10009818 3300031852 Bacteria 5391
213 Ga0307409_100004889 3300031995 Bacteria 7622
214 Ga0316593_10005796 3300032168 Bacteria 3291
215 Ga0373951_0007904 3300035091 Bacteria 2412
216 Ga0373956_0082232 3300035119 Bacteria 1479
217 Ga0373955_0083411 3300035172 Bacteria 1810
218 Ga0316574_0087273 3300035398 Bacteria 1986
219 Ga0373937_0067411 3300036401 Bacteria 3297
220 Ga0373937_0082771 3300036401 Bacteria 2969
221 Ga0373937_0255872 3300036401 Bacteria 1651
222 Ga0373925_0072375 3300037068 Bacteria 2608
223 Ga0395900_0055122 3300037418 Bacteria 4093
224 Ga0395898_0049570 3300037466 Bacteria 4114
225 Ga0395905_0011476 3300037471 Bacteria 8562
226 Ga0237819_00171 3300038705 Bacteria 24039
227 Ga0237819_01401 3300038705 Bacteria 6298
228 Ga0400484_32449 3300038725 Bacteria 21223
229 Ga0400484_36111 3300038725 Bacteria 5153
230 Ga0400490_43393 3300038726 Bacteria 4956
231 Ga0400488_47243 3300038741 Bacteria 3731
232 Ga0400488_58381 3300038741 Bacteria 19254
233 Ga0400486_16509 3300038742 Bacteria 3705
234 Ga0400483_018010 3300039062 Bacteria 5036
235 Ga0400483_082310 3300039062 Bacteria 2675
236 Ga0400483_091849 3300039062 Bacteria 5841
237 Ga0400483_213870 3300039062 Bacteria 3611
238 Ga0400487_42042 3300039110 Bacteria 5611
239 Ga0400487_46358 3300039110 Bacteria 5495
240 Ga0436365_0261033 3300039437 Bacteria 3237
241 Ga0436365_0306201 3300039437 Bacteria 2715
242 Ga0436365_0833014 3300039437 Bacteria 1915
243 Ga0439431_0005644 3300041997 Bacteria 2761
244 Ga0451577_0014500 3300042876 Bacteria 7347
245 Ga0453684_0004740 3300044712 Bacteria 28100
246 Ga0453684_0007626 3300044712 Bacteria 19821
247 Ga0453684_0010790 3300044712 Bacteria 15491
248 Ga0453684_0028283 3300044712 Bacteria 8007
249 Ga0453684_0317720 3300044712 Bacteria 1765
250 Ga0451576_0008706 3300045051 Bacteria 11876
251 Ga0451576_0106555 3300045051 Unclassified 2916
252 Ga0451576_0301101 3300045051 Bacteria 1677
253 Ga0495582_0009943 3300046473 Bacteria 5236
254 Ga0495608_0015168 3300046511 Bacteria 5346
255 Ga0495618_0011493 3300046514 Bacteria 5370
256 Ga0495628_0039927 3300046516 Bacteria 3752
257 Ga0495628_0233290 3300046516 Bacteria 1379
258 Ga0495630_0000192 3300046517 Bacteria 47913
259 Ga0495666_0004303 3300046526 Bacteria 7187
260 Ga0495640_0230741 3300046533 Bacteria 1164
261 Ga0495586_0000115 3300046535 Bacteria 47977
262 Ga0495645_0015929 3300046543 Bacteria 5357
263 Ga0495667_0015665 3300046559 Bacteria 5125
264 Ga0495657_0104864 3300046675 Bacteria 1797
265 Ga0495599_0062109 3300046678 Bacteria 2334
266 Ga0495647_0018928 3300046681 Bacteria 2458
267 Ga0495658_0051247 3300046683 Bacteria 2338
268 Ga0495658_0213722 3300046683 Bacteria 1206
269 Ga0495613_0094767 3300046689 Bacteria 2160
270 Ga0495600_0114644 3300046809 Bacteria 1755
271 Ga0495636_0071658 3300047318 Bacteria 1480
272 Ga0495674_0007208 3300047319 Bacteria 10634
273 Ga0495676_0008402 3300047321 Bacteria 9464
274 Ga0495675_0106211 3300047444 Unclassified 1755
275 Ga0496102_0241869 3300048905 Bacteria 1702
276 Ga0496104_0038277 3300048907 Bacteria 4488
277 Ga0496108_0226110 3300048911 Unclassified 1626
278 Ga0496109_0027115 3300048912 Bacteria 5113
279 Ga0496111_0006436 3300048914 Bacteria 7625
280 Ga0496111_0160664 3300048914 Bacteria 1668
281 Ga0496114_0006790 3300048917 Bacteria 9010
282 Ga0496114_0173450 3300048917 Bacteria 1880
283 Ga0496115_0000185 3300048918 Bacteria 57916
284 Ga0496118_0007673 3300048921 Bacteria 11348
285 Ga0496122_0032607 3300048925 Bacteria 4304
286 Ga0496126_0002463 3300048929 Bacteria 24945
287 Ga0501299_010328 3300049522 Unclassified 1558
288 Ga0501034_0014283 3300049571 Bacteria 8184
289 Ga0501034_0196627 3300049571 Bacteria 1976
290 Ga0501034_0276999 3300049571 Bacteria 1617
291 Ga0501067_0102102 3300049583 Bacteria 1593
292 Ga0501068_0000074 3300049584 Bacteria 39863
293 Ga0501068_0058644 3300049584 Bacteria 2336
294 Ga0501068_0060419 3300049584 Bacteria 2301
295 Ga0501069_0000205 3300049585 Bacteria 26190
296 Ga0501069_0000365 3300049585 Bacteria 20384
297 Ga0501070_0011118 3300049586 Bacteria 7597
298 Ga0501071_0001852 3300049587 Bacteria 12534
299 Ga0501071_0130920 3300049587 Bacteria 1863
300 Ga0501072_0001945 3300049588 Bacteria 15397
301 Ga0501073_0006175 3300049589 Bacteria 8943
302 Ga0501073_0008505 3300049589 Bacteria 7611
303 Ga0501074_0000195 3300049590 Bacteria 32910
304 Ga0501074_0004227 3300049590 Bacteria 10256
305 Ga0501079_0022335 3300049741 Bacteria 4851
306 Ga0501083_0000741 3300049744 Bacteria 21319
307 Ga0501044_0059368 3300049823 Bacteria 3919
308 nmdc:mga00v17_30208_c1 3300050491 Bacteria 3187
309 nmdc:mga0k408_7424_c1 3300050493 Bacteria 5853
310 nmdc:mga0k408_85502_c1 3300050493 Bacteria 1851
311 nmdc:mga05p37_111920_c1 3300050507 Bacteria 3357
312 nmdc:mga05p37_22845_c1 3300050507 Bacteria 7585
313 nmdc:mga09592_1182_c1 3300050508 Bacteria 20835
314 nmdc:mga09592_90970_c1 3300050508 Bacteria 2607
315 nmdc:mga06r32_122487_c1 3300050510 Bacteria 2566
316 nmdc:mga06r32_143196_c1 3300050510 Bacteria 2367
317 nmdc:mga06r32_45100_c1 3300050510 Bacteria 4201
318 nmdc:mga06r32_75460_c1 3300050510 Unclassified 3271
319 nmdc:mga08y16_16116_c1 3300050511 Bacteria 7860
320 nmdc:mga08y16_16593_c2 3300050511 Bacteria 5548
321 nmdc:mga08y16_4242_c1 3300050511 Bacteria 14959
322 nmdc:mga0a205_331161_c1 3300050515 Bacteria 1392
323 nmdc:mga0a205_5136_c1 3300050515 Bacteria 11774
324 nmdc:mga0a205_93811_c1 3300050515 Bacteria 2900
325 nmdc:mga0sz30_31710_c1 3300050516 Bacteria 2188
326 Ga0495601_0089160 3300053077 Bacteria 1983
327 Ga0500641_0046443 3300053096 Bacteria 1772
328 Ga0501084_0000574 3300054114 Bacteria 28080
329 Ga0501084_0027005 3300054114 Bacteria 4796
330 Ga0501082_0058766 3300060353 Bacteria 3313

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035119 Ga0373956_0082232 Ga0373956_0082232_81_1028 313
2 3300025901 Ga0207688_10126070 Ga0207688_101260702 326
3 3300006914 Ga0075436_100042147 Ga0075436_1000421472 337
4 3300047318 Ga0495636_0071658 Ga0495636_0071658_291_1337 339
5 3300050511 nmdc:mga08y16_16593_c2 nmdc:mga08y16_16593_c2_1481_2509 339
6 3300048925 Ga0496122_0032607 Ga0496122_0032607_1690_2856 341
7 3300049823 Ga0501044_0059368 Ga0501044_0059368_440_1525 341
8 3300013306 Ga0163162_10030796 Ga0163162_100307963 342
9 3300014969 Ga0157376_10334908 Ga0157376_103349082 342
10 3300005330 Ga0070690_100022436 Ga0070690_1000224363 343
11 3300006237 Ga0097621_100325372 Ga0097621_1003253721 343
12 3300006358 Ga0068871_100040152 Ga0068871_1000401522 343
13 3300025940 Ga0207691_10019263 Ga0207691_100192632 343
14 3300026023 Ga0207677_10109232 Ga0207677_101092322 343
15 3300026041 Ga0207639_10447896 Ga0207639_104478961 343
16 3300046675 Ga0495657_0104864 Ga0495657_0104864_466_1587 343
17 3300005335 Ga0070666_10257005 Ga0070666_102570051 344
18 3300005355 Ga0070671_100061745 Ga0070671_1000617453 344
19 3300009177 Ga0105248_10049736 Ga0105248_100497363 344
20 3300013306 Ga0163162_10061055 Ga0163162_100610552 344
21 3300013308 Ga0157375_10080908 Ga0157375_100809083 344
22 3300014325 Ga0163163_10086244 Ga0163163_100862442 344
23 3300014968 Ga0157379_10275196 Ga0157379_102751961 344
24 3300025931 Ga0207644_10083223 Ga0207644_100832233 344
25 3300025941 Ga0207711_10230151 Ga0207711_102301511 344
26 3300005471 Ga0070698_100054815 Ga0070698_1000548154 345
27 3300009094 Ga0111539_10056001 Ga0111539_100560013 345
28 3300021384 Ga0213876_10052457 Ga0213876_100524571 345
29 3300035172 Ga0373955_0083411 Ga0373955_0083411_341_1387 345
30 3300036401 Ga0373937_0082771 Ga0373937_0082771_505_1551 345
31 3300039437 Ga0436365_0306201 Ga0436365_0306201_62_1108 345
32 3300046514 Ga0495618_0011493 Ga0495618_0011493_1007_2053 345
33 3300046516 Ga0495628_0039927 Ga0495628_0039927_460_1506 345
34 3300046533 Ga0495640_0230741 Ga0495640_0230741_76_1122 345
35 3300046683 Ga0495658_0213722 Ga0495658_0213722_106_1152 345
36 3300009147 Ga0114129_10021387 Ga0114129_100213872 346
37 3300050510 nmdc:mga06r32_122487_c1 nmdc:mga06r32_122487_c1_1179_2315 346
38 3300005719 Ga0068861_100191231 Ga0068861_1001912312 347
39 3300006880 Ga0075429_100039249 Ga0075429_1000392492 347
40 3300026118 Ga0207675_100058624 Ga0207675_1000586243 347
41 3300005367 Ga0070667_100221397 Ga0070667_1002213971 348
42 3300014969 Ga0157376_10307060 Ga0157376_103070602 348
43 3300025986 Ga0207658_10148422 Ga0207658_101484222 348
44 3300028381 Ga0268264_10135507 Ga0268264_101355073 348
45 3300028800 Ga0265338_10040136 Ga0265338_100401362 348
46 3300046516 Ga0495628_0233290 Ga0495628_0233290_35_1240 349
47 3300050493 nmdc:mga0k408_85502_c1 nmdc:mga0k408_85502_c1_206_1306 349
48 3300005459 Ga0068867_100042332 Ga0068867_1000423323 350
49 3300013306 Ga0163162_10102173 Ga0163162_101021732 350
50 3300025972 Ga0207668_10036267 Ga0207668_100362672 350
51 3300026089 Ga0207648_10013361 Ga0207648_100133616 350
52 3300045051 Ga0451576_0008706 Ga0451576_0008706_2449_3528 351
53 3300005290 Ga0065712_10091110 Ga0065712_100911103 352
54 3300005340 Ga0070689_100028247 Ga0070689_1000282472 352
55 3300009098 Ga0105245_10060481 Ga0105245_100604812 352
56 3300009176 Ga0105242_10024855 Ga0105242_100248554 352
57 3300009177 Ga0105248_10022126 Ga0105248_100221267 352
58 3300013296 Ga0157374_10136715 Ga0157374_101367152 352
59 3300025942 Ga0207689_10026566 Ga0207689_100265663 352
60 3300036401 Ga0373937_0067411 Ga0373937_0067411_2050_3114 352
61 3300046543 Ga0495645_0015929 Ga0495645_0015929_2701_3765 352
62 3300046678 Ga0495599_0062109 Ga0495599_0062109_232_1296 352
63 3300046809 Ga0495600_0114644 Ga0495600_0114644_190_1254 352
64 3300053077 Ga0495601_0089160 Ga0495601_0089160_98_1162 352
65 3300005338 Ga0068868_100066217 Ga0068868_1000662174 353
66 3300005616 Ga0068852_100012465 Ga0068852_1000124655 353
67 3300005834 Ga0068851_10005345 Ga0068851_100053455 353
68 3300006051 Ga0075364_10020526 Ga0075364_100205263 353
69 3300006195 Ga0075366_10018663 Ga0075366_100186632 353
70 3300006871 Ga0075434_100199615 Ga0075434_1001996152 353
71 3300021384 Ga0213876_10073306 Ga0213876_100733062 353
72 3300025321 Ga0207656_10008351 Ga0207656_100083513 353
73 3300026023 Ga0207677_10122209 Ga0207677_101222092 353
74 3300026142 Ga0207698_10004810 Ga0207698_100048108 353
75 3300048914 Ga0496111_0160664 Ga0496111_0160664_234_1301 353
76 3300003187 JGI25151J46595_10008006 JGI25151J46595_100080062 354
77 3300025284 Ga0209130_1002445 Ga0209130_10024458 354
78 3300025294 Ga0209025_1003490 Ga0209025_10034906 354
79 3300006847 Ga0075431_100158486 Ga0075431_1001584863 355
80 3300006852 Ga0075433_10212642 Ga0075433_102126422 355
81 3300005293 Ga0065715_10094698 Ga0065715_100946983 357
82 3300005445 Ga0070708_100482929 Ga0070708_1004829291 357
83 3300005467 Ga0070706_100024321 Ga0070706_1000243214 357
84 3300005467 Ga0070706_100063813 Ga0070706_1000638134 357
85 3300005468 Ga0070707_100039824 Ga0070707_1000398242 357
86 3300005518 Ga0070699_100127150 Ga0070699_1001271502 357
87 3300005536 Ga0070697_100042552 Ga0070697_1000425523 357
88 3300005545 Ga0070695_100015124 Ga0070695_1000151244 357
89 3300005549 Ga0070704_100009045 Ga0070704_1000090455 357
90 3300013104 Ga0157370_10389649 Ga0157370_103896492 357
91 3300025910 Ga0207684_10205707 Ga0207684_102057071 357
92 3300031251 Ga0265327_10000014 Ga0265327_10000014464 357
93 iso_pu_bacteria 2510065053 2510285449 357
94 iso_pu_bacteria 2510065055 2510295908 357
95 iso_pu_bacteria 2510065058 2510313537 357
96 iso_pu_bacteria 2773857672 2774132465 357
97 iso_pu_bacteria 2917832318 2917833932 357
98 iso_pu_bacteria 2919125081 2919129947 357
99 iso_pu_bacteria 2974298342 2974302880 357
100 iso_pu_bacteria 2984499530 2984499536 357
101 iso_pu_bacteria 2984504281 2984505980 357
102 iso_pu_bacteria 8016728285 8016732054 357
103 3300005336 Ga0070680_100021576 Ga0070680_1000215763 358
104 3300005336 Ga0070680_100026257 Ga0070680_1000262573 358
105 3300005345 Ga0070692_10019928 Ga0070692_100199282 358
106 3300005406 Ga0070703_10023444 Ga0070703_100234442 358
107 3300005467 Ga0070706_100000795 Ga0070706_10000079533 358
108 3300005468 Ga0070707_100291612 Ga0070707_1002916122 358
109 3300005471 Ga0070698_100131982 Ga0070698_1001319822 358
110 3300005471 Ga0070698_100275657 Ga0070698_1002756572 358
111 3300005536 Ga0070697_100082727 Ga0070697_1000827272 358
112 3300005536 Ga0070697_100163492 Ga0070697_1001634922 358
113 3300005545 Ga0070695_100067206 Ga0070695_1000672062 358
114 3300005546 Ga0070696_100031078 Ga0070696_1000310783 358
115 3300005547 Ga0070693_100003350 Ga0070693_1000033504 358
116 3300005564 Ga0070664_100025077 Ga0070664_1000250774 358
117 3300005617 Ga0068859_100096529 Ga0068859_1000965292 358
118 3300005842 Ga0068858_100051162 Ga0068858_1000511622 358
119 3300005843 Ga0068860_100078659 Ga0068860_1000786593 358
120 3300006237 Ga0097621_100350083 Ga0097621_1003500832 358
121 3300006844 Ga0075428_100046589 Ga0075428_1000465892 358
122 3300006847 Ga0075431_100005746 Ga0075431_1000057468 358
123 3300006852 Ga0075433_10141460 Ga0075433_101414602 358
124 3300006880 Ga0075429_100003185 Ga0075429_1000031858 358
125 3300006931 Ga0097620_100096527 Ga0097620_1000965273 358
126 3300009148 Ga0105243_10378998 Ga0105243_103789981 358
127 3300014969 Ga0157376_10016037 Ga0157376_100160377 358
128 3300025910 Ga0207684_10000152 Ga0207684_10000152114 358
129 3300025917 Ga0207660_10035784 Ga0207660_100357842 358
130 3300025917 Ga0207660_10060002 Ga0207660_100600022 358
131 3300025921 Ga0207652_10062991 Ga0207652_100629914 358
132 3300025922 Ga0207646_10000004 Ga0207646_1000000433 358
133 3300025941 Ga0207711_10046305 Ga0207711_100463052 358
134 3300025942 Ga0207689_10155675 Ga0207689_101556752 358
135 3300025945 Ga0207679_10016050 Ga0207679_100160505 358
136 3300026116 Ga0207674_10010817 Ga0207674_100108174 358
137 3300028381 Ga0268264_10128899 Ga0268264_101288993 358
138 3300038726 Ga0400490_43393 Ga0400490_43393_526_1605 358
139 3300038741 Ga0400488_47243 Ga0400488_47243_2099_3178 358
140 3300038742 Ga0400486_16509 Ga0400486_16509_73_1152 358
141 3300039062 Ga0400483_018010 Ga0400483_018010_2542_3621 358
142 3300050507 nmdc:mga05p37_111920_c1 nmdc:mga05p37_111920_c1_179_1270 358
143 3300050515 nmdc:mga0a205_5136_c1 nmdc:mga0a205_5136_c1_3203_4294 358
144 3300005327 Ga0070658_10015968 Ga0070658_100159687 359
145 3300031548 Ga0307408_100068883 Ga0307408_1000688834 359
146 3300039437 Ga0436365_0833014 Ga0436365_0833014_592_1683 359
147 3300050491 nmdc:mga00v17_30208_c1 nmdc:mga00v17_30208_c1_866_1957 359
148 3300050516 nmdc:mga0sz30_31710_c1 nmdc:mga0sz30_31710_c1_47_1138 359
149 3300053096 Ga0500641_0046443 Ga0500641_0046443_175_1266 359
150 3300009011 Ga0105251_10007498 Ga0105251_100074987 360
151 3300009036 Ga0105244_10022854 Ga0105244_100228542 360
152 3300009093 Ga0105240_10001120 Ga0105240_1000112014 360
153 3300013102 Ga0157371_10020525 Ga0157371_100205253 360
154 3300013102 Ga0157371_10193717 Ga0157371_101937171 360
155 3300025735 Ga0207713_1038441 Ga0207713_10384412 360
156 3300025913 Ga0207695_10010748 Ga0207695_1001074812 360
157 3300031251 Ga0265327_10028589 Ga0265327_100285893 360
158 3300006847 Ga0075431_100315584 Ga0075431_1003155841 361
159 3300037471 Ga0395905_0011476 Ga0395905_0011476_854_2002 361
160 3300049571 Ga0501034_0014283 Ga0501034_0014283_6819_7931 361
161 3300049571 Ga0501034_0276999 Ga0501034_0276999_225_1322 361
162 3300049583 Ga0501067_0102102 Ga0501067_0102102_363_1460 361
163 3300049584 Ga0501068_0000074 Ga0501068_0000074_5007_6119 361
164 3300049584 Ga0501068_0058644 Ga0501068_0058644_362_1501 361
165 3300049584 Ga0501068_0060419 Ga0501068_0060419_708_1805 361
166 3300049585 Ga0501069_0000205 Ga0501069_0000205_14440_15552 361
167 3300049585 Ga0501069_0000365 Ga0501069_0000365_13700_14797 361
168 3300049586 Ga0501070_0011118 Ga0501070_0011118_5792_6889 361
169 3300049587 Ga0501071_0001852 Ga0501071_0001852_5836_6933 361
170 3300049587 Ga0501071_0130920 Ga0501071_0130920_616_1728 361
171 3300049588 Ga0501072_0001945 Ga0501072_0001945_14009_15106 361
172 3300049589 Ga0501073_0006175 Ga0501073_0006175_1315_2427 361
173 3300049589 Ga0501073_0008505 Ga0501073_0008505_3687_4784 361
174 3300049590 Ga0501074_0000195 Ga0501074_0000195_17721_18833 361
175 3300049590 Ga0501074_0004227 Ga0501074_0004227_1652_2749 361
176 3300049741 Ga0501079_0022335 Ga0501079_0022335_3129_4226 361
177 3300049744 Ga0501083_0000741 Ga0501083_0000741_6773_7885 361
178 3300050510 nmdc:mga06r32_75460_c1 nmdc:mga06r32_75460_c1_921_2051 361
179 3300054114 Ga0501084_0000574 Ga0501084_0000574_12603_13715 361
180 3300054114 Ga0501084_0027005 Ga0501084_0027005_3629_4726 361
181 3300060353 Ga0501082_0058766 Ga0501082_0058766_1924_3021 361
182 3300005445 Ga0070708_100015530 Ga0070708_1000155306 363
183 3300009147 Ga0114129_10001966 Ga0114129_1000196621 363
184 3300009147 Ga0114129_10005965 Ga0114129_1000596511 363
185 3300009147 Ga0114129_10029077 Ga0114129_100290775 363
186 3300009147 Ga0114129_10124306 Ga0114129_101243063 363
187 3300025885 Ga0207653_10000409 Ga0207653_1000040914 363
188 3300031733 Ga0316577_10020972 Ga0316577_100209723 363
189 3300032168 Ga0316593_10005796 Ga0316593_100057962 363
190 3300039110 Ga0400487_46358 Ga0400487_46358_160_1260 363
191 3300050507 nmdc:mga05p37_22845_c1 nmdc:mga05p37_22845_c1_4997_6103 363
192 3300050508 nmdc:mga09592_1182_c1 nmdc:mga09592_1182_c1_2356_3462 363
193 3300050510 nmdc:mga06r32_45100_c1 nmdc:mga06r32_45100_c1_1565_2671 363
194 3300050515 nmdc:mga0a205_93811_c1 nmdc:mga0a205_93811_c1_1755_2861 363
195 3300009553 Ga0105249_10005673 Ga0105249_100056732 364
196 3300005340 Ga0070689_100001525 Ga0070689_1000015257 365
197 3300005365 Ga0070688_100003233 Ga0070688_1000032335 365
198 3300005456 Ga0070678_100052676 Ga0070678_1000526762 365
199 3300005457 Ga0070662_100141129 Ga0070662_1001411292 365
200 3300005539 Ga0068853_100081730 Ga0068853_1000817303 365
201 3300005614 Ga0068856_100020231 Ga0068856_1000202313 365
202 3300005616 Ga0068852_100114143 Ga0068852_1001141432 365
203 3300005841 Ga0068863_100211490 Ga0068863_1002114903 365
204 3300006195 Ga0075366_10002670 Ga0075366_100026706 365
205 3300010375 Ga0105239_10015729 Ga0105239_100157297 365
206 3300013104 Ga0157370_10116494 Ga0157370_101164942 365
207 3300013296 Ga0157374_10065992 Ga0157374_100659922 365
208 3300013307 Ga0157372_10076640 Ga0157372_100766402 365
209 3300014969 Ga0157376_10217449 Ga0157376_102174492 365
210 3300025907 Ga0207645_10160964 Ga0207645_101609642 365
211 3300025925 Ga0207650_10173932 Ga0207650_101739323 365
212 3300025933 Ga0207706_10147403 Ga0207706_101474032 365
213 3300025936 Ga0207670_10001029 Ga0207670_100010295 365
214 3300026089 Ga0207648_10027596 Ga0207648_100275964 365
215 3300026121 Ga0207683_10025252 Ga0207683_100252522 365
216 3300026142 Ga0207698_10085895 Ga0207698_100858952 365
217 3300028379 Ga0268266_10075104 Ga0268266_100751043 365
218 3300031730 Ga0307516_10107135 Ga0307516_101071353 365
219 3300036401 Ga0373937_0255872 Ga0373937_0255872_200_1318 365
220 3300039437 Ga0436365_0261033 Ga0436365_0261033_2034_3146 365
221 3300044712 Ga0453684_0007626 Ga0453684_0007626_3582_4691 365
222 3300048905 Ga0496102_0241869 Ga0496102_0241869_296_1408 365
223 3300048917 Ga0496114_0173450 Ga0496114_0173450_725_1837 365
224 3300048918 Ga0496115_0000185 Ga0496115_0000185_53793_54905 365
225 3300048921 Ga0496118_0007673 Ga0496118_0007673_8761_9873 365
226 3300048929 Ga0496126_0002463 Ga0496126_0002463_20822_21934 365
227 3300050493 nmdc:mga0k408_7424_c1 nmdc:mga0k408_7424_c1_2484_3602 365
228 3300031852 Ga0307410_10009818 Ga0307410_100098182 366
229 3300031995 Ga0307409_100004889 Ga0307409_1000048894 366
230 3300038725 Ga0400484_32449 Ga0400484_32449_3371_4489 366
231 3300038741 Ga0400488_58381 Ga0400488_58381_14914_16029 366
232 3300039062 Ga0400483_082310 Ga0400483_082310_746_1858 366
233 3300039062 Ga0400483_091849 Ga0400483_091849_1602_2732 366
234 3300039062 Ga0400483_213870 Ga0400483_213870_2226_3338 366
235 3300039110 Ga0400487_42042 Ga0400487_42042_1076_2191 366
236 iso_pu_bacteria 2738543013 2739249704 366
237 3300035091 Ga0373951_0007904 Ga0373951_0007904_131_1261 367
238 3300038725 Ga0400484_36111 Ga0400484_36111_2621_3742 367
239 3300003322 rootL2_10083384 rootL2_100833842 368
240 3300003784 Ga0055534_1002527 Ga0055534_10025271 368
241 3300017792 Ga0163161_10052253 Ga0163161_100522532 368
242 3300025284 Ga0209130_1012715 Ga0209130_10127152 368
243 3300031456 Ga0307513_10188460 Ga0307513_101884601 368
244 3300035398 Ga0316574_0087273 Ga0316574_0087273_34_1191 368
245 3300041997 Ga0439431_0005644 Ga0439431_0005644_365_1486 368
246 3300044712 Ga0453684_0010790 Ga0453684_0010790_12320_13480 368
247 3300045051 Ga0451576_0301101 Ga0451576_0301101_485_1618 368
248 3300046511 Ga0495608_0015168 Ga0495608_0015168_2013_3218 368
249 3300046559 Ga0495667_0015665 Ga0495667_0015665_1491_2696 368
250 3300006880 Ga0075429_100026826 Ga0075429_1000268266 369
251 3300050508 nmdc:mga09592_90970_c1 nmdc:mga09592_90970_c1_733_1935 369
252 3300050510 nmdc:mga06r32_143196_c1 nmdc:mga06r32_143196_c1_219_1421 369
253 3300050515 nmdc:mga0a205_331161_c1 nmdc:mga0a205_331161_c1_164_1366 369
254 3300042876 Ga0451577_0014500 Ga0451577_0014500_1497_2624 370
255 3300044712 Ga0453684_0317720 Ga0453684_0317720_106_1233 370
256 3300031344 Ga0265316_10001727 Ga0265316_100017277 371
257 3300049571 Ga0501034_0196627 Ga0501034_0196627_169_1341 371
258 3300026088 Ga0207641_10299847 Ga0207641_102998472 372
259 3300037418 Ga0395900_0055122 Ga0395900_0055122_466_1590 372
260 3300037466 Ga0395898_0049570 Ga0395898_0049570_131_1255 372
261 3300005467 Ga0070706_100058151 Ga0070706_1000581513 373
262 3300005577 Ga0068857_100133382 Ga0068857_1001333822 373
263 3300025910 Ga0207684_10002471 Ga0207684_1000247113 373
264 3300025922 Ga0207646_10001691 Ga0207646_1000169126 373
265 3300026116 Ga0207674_10129079 Ga0207674_101290792 373
266 3300005330 Ga0070690_100078977 Ga0070690_1000789772 374
267 3300005331 Ga0070670_100014763 Ga0070670_1000147634 374
268 3300005335 Ga0070666_10000790 Ga0070666_1000079018 374
269 3300005347 Ga0070668_100019258 Ga0070668_1000192583 374
270 3300005353 Ga0070669_100068916 Ga0070669_1000689162 374
271 3300005354 Ga0070675_100005529 Ga0070675_1000055296 374
272 3300005355 Ga0070671_100126877 Ga0070671_1001268772 374
273 3300005364 Ga0070673_100001088 Ga0070673_1000010886 374
274 3300005367 Ga0070667_100045476 Ga0070667_1000454764 374
275 3300005456 Ga0070678_100001083 Ga0070678_1000010834 374
276 3300005457 Ga0070662_100016808 Ga0070662_1000168082 374
277 3300005543 Ga0070672_100000205 Ga0070672_10000020525 374
278 3300005548 Ga0070665_100044921 Ga0070665_1000449214 374
279 3300006237 Ga0097621_100007186 Ga0097621_1000071862 374
280 3300006358 Ga0068871_100008632 Ga0068871_1000086326 374
281 3300009094 Ga0111539_10000089 Ga0111539_1000008989 374
282 3300009094 Ga0111539_10023835 Ga0111539_100238353 374
283 3300009098 Ga0105245_10089978 Ga0105245_100899782 374
284 3300013296 Ga0157374_10077598 Ga0157374_100775982 374
285 3300013297 Ga0157378_10002957 Ga0157378_100029574 374
286 3300013308 Ga0157375_10001956 Ga0157375_100019568 374
287 3300014969 Ga0157376_10001173 Ga0157376_1000117312 374
288 3300025907 Ga0207645_10018813 Ga0207645_100188134 374
289 3300025925 Ga0207650_10051553 Ga0207650_100515532 374
290 3300025926 Ga0207659_10072902 Ga0207659_100729022 374
291 3300025933 Ga0207706_10052677 Ga0207706_100526772 374
292 3300025940 Ga0207691_10000046 Ga0207691_1000004633 374
293 3300025960 Ga0207651_10000286 Ga0207651_100002866 374
294 3300025986 Ga0207658_10034003 Ga0207658_100340032 374
295 3300026121 Ga0207683_10002161 Ga0207683_1000216116 374
296 3300026142 Ga0207698_10225290 Ga0207698_102252902 374
297 3300027907 Ga0207428_10002500 Ga0207428_1000250014 374
298 3300027907 Ga0207428_10013204 Ga0207428_100132042 374
299 3300028379 Ga0268266_10045090 Ga0268266_100450903 374
300 3300031548 Ga0307408_100341400 Ga0307408_1003414002 374
301 3300044712 Ga0453684_0028283 Ga0453684_0028283_1893_3131 374
302 3300045051 Ga0451576_0106555 Ga0451576_0106555_260_1444 374
303 3300047444 Ga0495675_0106211 Ga0495675_0106211_89_1261 374
304 3300048907 Ga0496104_0038277 Ga0496104_0038277_2031_3194 374
305 3300048911 Ga0496108_0226110 Ga0496108_0226110_296_1459 374
306 3300048912 Ga0496109_0027115 Ga0496109_0027115_2343_3506 374
307 3300048917 Ga0496114_0006790 Ga0496114_0006790_4185_5348 374
308 3300049522 Ga0501299_010328 Ga0501299_010328_119_1282 374
309 3300050511 nmdc:mga08y16_16116_c1 nmdc:mga08y16_16116_c1_2226_3404 374
310 3300050511 nmdc:mga08y16_4242_c1 nmdc:mga08y16_4242_c1_6891_8054 374
311 3300037068 Ga0373925_0072375 Ga0373925_0072375_1404_2579 375
312 3300046473 Ga0495582_0009943 Ga0495582_0009943_2288_3463 375
313 3300046517 Ga0495630_0000192 Ga0495630_0000192_5399_6574 375
314 3300046526 Ga0495666_0004303 Ga0495666_0004303_3263_4438 375
315 3300046535 Ga0495586_0000115 Ga0495586_0000115_5407_6582 375
316 3300046681 Ga0495647_0018928 Ga0495647_0018928_417_1592 375
317 3300046689 Ga0495613_0094767 Ga0495613_0094767_535_1710 375
318 3300047319 Ga0495674_0007208 Ga0495674_0007208_4061_5236 375
319 3300047321 Ga0495676_0008402 Ga0495676_0008402_4736_5911 375
320 3300044712 Ga0453684_0004740 Ga0453684_0004740_12445_13623 376
321 3300046683 Ga0495658_0051247 Ga0495658_0051247_309_1583 376
322 iso_pu_bacteria 8007371054 8007371679 376
323 3300031711 Ga0265314_10001851 Ga0265314_1000185113 378
324 iso_pu_bacteria 2554235469 2556065904 378
325 iso_pu_bacteria 2643221729 2644704835 378
326 iso_pu_bacteria 2643221730 2644709529 378
327 iso_pu_bacteria 2671180330 2672336611 378
328 iso_pu_bacteria 2816332186 2816862941 378
329 iso_pu_bacteria 2818991443 2819578591 378
330 iso_pu_bacteria 2842682962 2842682990 378
331 iso_pu_bacteria 2849139964 2849144017 378
332 iso_pu_bacteria 2857581216 2857582679 378
333 iso_pu_bacteria 2938917290 2938919716 378
334 iso_pu_bacteria 8023438354 8023438702 378
335 iso_pu_bacteria 8023444577 8023446010 378
336 3300005563 Ga0068855_100002024 Ga0068855_1000020244 379
337 3300025949 Ga0207667_10003227 Ga0207667_100032272 379
338 iso_pu_bacteria 2551306519 2553395280 379
339 iso_pu_bacteria 2684622632 2685150356 379
340 iso_pu_bacteria 2718218445 2721505638 379
341 iso_pu_bacteria 2929233124 2929235548 379
342 iso_pu_bacteria 2965761152 2965763596 379
343 iso_pu_bacteria 2979083700 2979086052 379
344 iso_pu_bacteria 3001267043 3001269818 379
345 iso_pu_bacteria 3001272096 3001275159 379
346 iso_pu_bacteria 3006988479 3006990706 379
347 iso_pu_bacteria 8022621104 8022625449 379
348 3300009092 Ga0105250_10005344 Ga0105250_100053445 382
349 3300025294 Ga0209025_1004897 Ga0209025_10048973 382
350 3300025294 Ga0209025_1008393 Ga0209025_10083935 382
351 3300025711 Ga0207696_1013183 Ga0207696_10131833 382
352 3300048914 Ga0496111_0006436 Ga0496111_0006436_66_1271 382
353 3300003187 JGI25151J46595_10004597 JGI25151J46595_100045972 383
354 3300003187 JGI25151J46595_10014458 JGI25151J46595_100144583 383
355 3300009011 Ga0105251_10037307 Ga0105251_100373072 383
356 3300009036 Ga0105244_10005007 Ga0105244_100050073 383
357 3300009092 Ga0105250_10001847 Ga0105250_100018475 383
358 3300025294 Ga0209025_1000448 Ga0209025_100044834 383
359 3300025294 Ga0209025_1003962 Ga0209025_100396213 383
360 3300025294 Ga0209025_1004269 Ga0209025_10042695 383
361 3300025711 Ga0207696_1001137 Ga0207696_10011378 383
362 3300025728 Ga0207655_1002430 Ga0207655_10024308 383
363 3300038705 Ga0237819_00171 Ga0237819_00171_9785_10957 383
364 3300038705 Ga0237819_01401 Ga0237819_01401_2815_3969 383

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03702

AnmK

Anhydro-N-acetylmuramic acid kinase

42

421

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cqy-assembly1.cif.gz_A crystal structure of a functionally unknown protein (so_1313) from shewanella oneidensis mr-1 0.9672 2 378
8cpb-assembly1.cif.gz_B 1,6-anhydro-n-actetylmuramic acid kinase (anmk) in complex with amppnp, and anhmurnac at 1.7 angstroms resolution. 0.9575 1 381
3qbx-assembly1.cif.gz_A crystal structure of pseudomonas aeruginosa 1,6-anhydro-n-actetylmuramic acid kinase (anmk) bound to 1,6-anhydro-n-actetylmuramic acid 0.9569 1 381
8cp9-assembly1.cif.gz_A 1,6-anhydro-n-actetylmuramic acid kinase (anmk)in complex with non-hydrolyzable amppnp. 0.9551 2 381
8cpb-assembly1.cif.gz_B 1,6-anhydro-n-actetylmuramic acid kinase (anmk) in complex with amppnp, and anhmurnac at 1.7 angstroms resolution. 0.955 1 381
ID Description Score Start End Superfamily
3cqyB02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9515 149 339 3.30.420.40
af_P77570_5_144_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9454 3 147 3.30.420.40
3cqyB02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9414 149 339 3.30.420.40
af_Q54NM2_164_389_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9288 149 339 3.30.420.40
af_P77570_5_144_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9261 3 147 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A806QVK9-F1-model_v4 deleted 0.9849 202 336
AF-N1LRS3-F1-model_v4 deleted 0.9832 200 383
AF-Q81QG0-F1-model_v4 Anhydro-N-acetylmuramic acid kinase (EC 2.7.1.170) (AnhMurNAc kinase) 0.9816 1 382 GO:0005524
GO:0006040
GO:0009254
GO:0016301
GO:0016773
GO:0097175
AF-A0A800DR88-F1-model_v4 Anhydro-N-acetylmuramic acid kinase 0.9801 2 107 GO:0005524
GO:0006040
GO:0009254
GO:0016773
AF-Q81QG0-F1-model_v4 Anhydro-N-acetylmuramic acid kinase (EC 2.7.1.170) (AnhMurNAc kinase) 0.979 1 382 GO:0005524
GO:0006040
GO:0009254
GO:0016301
GO:0016773
GO:0097175

Feature Viewer

pLDDT pTM Quality
94.48 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map