F423243

General Info

Members Datasets Scaffolds Average Seq Length
364 194 728 272

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100000248|Ga0070665_10000024880
Length 299
Sequence MSPARRAWSKMSAAAFDAESKSVDTAMNDLSLAPASAPVKAGGAFFVETVTWVQHWTGSLFSFRTTRDPSLRFASGQFVMVGLTKEDGKPLVRAYSIASPSWHEELEFYSIKVPDGPLTSRLQKIKVGDEVLIGRKPTGTLVLDGLRPGKRLYMLGTGTGLAPWLSLARDPDVYERFDQVIVTHTVREIADLNYRELLSGALAQDELLGDLIGPKLRYYPTVTREPFQTEGRITDLIASGQLFRDLGNPPFNKDEDRVMLCGGPSVLADLKQQLLDLGYEEGSISSPGDFVLERAFVET

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
58 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
59 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
60 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
61 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
63 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
99 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
100 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
101 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
102 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
103 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
104 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
107 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
108 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
109 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
110 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
111 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
112 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
113 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
114 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
115 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
124 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
125 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
126 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
127 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
128 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
129 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
130 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
131 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
132 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
133 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
134 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
135 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
136 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
137 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
138 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
139 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
140 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
141 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
142 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
151 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
154 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
155 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
156 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
157 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
158 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
165 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
166 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
167 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
168 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
169 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
170 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
171 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
172 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
173 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
174 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
175 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
176 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
177 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
178 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
179 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
180 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
181 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
182 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
183 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
184 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
185 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
186 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
187 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
188 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
189 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
191 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
192 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
193 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
194 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.35
Metatranscriptomes 0.27
Isolates 1.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.09
Nodule 0
Rhizoplane 3.57
Rhizosphere 76.92
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100000248 3300005548 Bacteria 89239
2 JGI25406J46586_10001932 3300003203 Bacteria 9775
3 Ga0055536_1000070 3300003781 Bacteria 93736
4 Ga0055530_10000076 3300003791 Bacteria 84675
5 Ga0055530_10000188 3300003791 Bacteria 55307
6 Ga0055531_10005752 3300003794 Bacteria 7183
7 Ga0065165_1000029 3300005262 Bacteria 220342
8 Ga0070670_100117301 3300005331 Bacteria 2295
9 Ga0070666_10047259 3300005335 Bacteria 2889
10 Ga0070666_10189436 3300005335 Bacteria 1445
11 Ga0070680_100026527 3300005336 Bacteria 4634
12 Ga0070660_100126465 3300005339 Bacteria 2042
13 Ga0070691_10024488 3300005341 Bacteria 2805
14 Ga0070668_100001178 3300005347 Bacteria 18504
15 Ga0070668_100002233 3300005347 Bacteria 14239
16 Ga0070668_100010330 3300005347 Bacteria 6930
17 Ga0070668_100021184 3300005347 Bacteria 4914
18 Ga0070668_100022775 3300005347 Bacteria 4736
19 Ga0070668_100240781 3300005347 Bacteria 1498
20 Ga0070669_100055532 3300005353 Bacteria 2902
21 Ga0070669_100334233 3300005353 Bacteria 1226
22 Ga0070669_100478711 3300005353 Bacteria 1030
23 Ga0070671_100000153 3300005355 Bacteria 45037
24 Ga0070659_100000040 3300005366 Bacteria 104145
25 Ga0070667_100000299 3300005367 Bacteria 55531
26 Ga0070667_100004014 3300005367 Bacteria 12458
27 Ga0070667_100019418 3300005367 Bacteria 5639
28 Ga0070667_100106034 3300005367 Bacteria 2432
29 Ga0070667_100424074 3300005367 Bacteria 1213
30 Ga0070681_10024302 3300005458 Bacteria 6099
31 Ga0070681_10296576 3300005458 Bacteria 1526
32 Ga0070679_100024223 3300005530 Bacteria 5947
33 Ga0068853_100042558 3300005539 Bacteria 3884
34 Ga0068853_100410947 3300005539 Bacteria 1268
35 Ga0070665_100000867 3300005548 Bacteria 39214
36 Ga0070665_100001434 3300005548 Bacteria 27937
37 Ga0070665_100205278 3300005548 Bacteria 1971
38 Ga0070665_100226225 3300005548 Bacteria 1871
39 Ga0068855_100098172 3300005563 Bacteria 3374
40 Ga0068857_100423084 3300005577 Bacteria 1242
41 Ga0068856_100277936 3300005614 Bacteria 1691
42 Ga0068856_100286227 3300005614 Bacteria 1665
43 Ga0068852_100418533 3300005616 Bacteria 1321
44 Ga0068859_100000744 3300005617 Bacteria 32833
45 Ga0068859_100077982 3300005617 Bacteria 3354
46 Ga0068864_100000185 3300005618 Bacteria 57142
47 Ga0068864_100000238 3300005618 Bacteria 49284
48 Ga0068864_100001411 3300005618 Bacteria 19860
49 Ga0068864_100001967 3300005618 Bacteria 16895
50 Ga0068864_100370683 3300005618 Bacteria 1355
51 Ga0068863_100001211 3300005841 Bacteria 25783
52 Ga0068863_100002323 3300005841 Bacteria 18907
53 Ga0068863_100006056 3300005841 Bacteria 11870
54 Ga0068863_100205606 3300005841 Bacteria 1895
55 Ga0068863_100400845 3300005841 Bacteria 1342
56 Ga0068858_100000037 3300005842 Bacteria 137966
57 Ga0068858_100000206 3300005842 Bacteria 63692
58 Ga0068858_100001538 3300005842 Bacteria 23685
59 Ga0068858_100005345 3300005842 Bacteria 12603
60 Ga0068858_100183786 3300005842 Bacteria 1974
61 Ga0068860_100000420 3300005843 Bacteria 54633
62 Ga0068860_100000517 3300005843 Bacteria 47364
63 Ga0068860_100003590 3300005843 Bacteria 15950
64 Ga0068860_100064415 3300005843 Bacteria 3481
65 Ga0068860_100161217 3300005843 Bacteria 2162
66 Ga0068860_100316167 3300005843 Bacteria 1532
67 Ga0068862_100000786 3300005844 Bacteria 31460
68 Ga0068862_100009671 3300005844 Bacteria 7969
69 Ga0068862_100011439 3300005844 Bacteria 7324
70 Ga0068862_100012557 3300005844 Bacteria 7012
71 Ga0068862_100131374 3300005844 Bacteria 2215
72 Ga0068862_100132015 3300005844 Bacteria 2210
73 Ga0068862_100256907 3300005844 Bacteria 1594
74 Ga0081539_10000118 3300005985 Bacteria 184562
75 Ga0070717_10190335 3300006028 Bacteria 1793
76 Ga0075368_10002174 3300006042 Bacteria 6343
77 Ga0075363_100023395 3300006048 Bacteria 3131
78 Ga0075364_10000457 3300006051 Bacteria 20666
79 Ga0075362_10079064 3300006177 Bacteria 1513
80 Ga0075367_10001510 3300006178 Bacteria 10055
81 Ga0075366_10017086 3300006195 Bacteria 4171
82 Ga0075370_10067756 3300006353 Bacteria 2038
83 Ga0097620_100000744 3300006931 Bacteria 32833
84 Ga0097620_100077982 3300006931 Bacteria 3354
85 Ga0105251_10109068 3300009011 Bacteria 1262
86 Ga0105240_10000522 3300009093 Bacteria 70833
87 Ga0105240_10024604 3300009093 Bacteria 7931
88 Ga0105240_10034503 3300009093 Bacteria 6525
89 Ga0105240_10077997 3300009093 Bacteria 4080
90 Ga0105240_10135159 3300009093 Bacteria 2953
91 Ga0105240_10180005 3300009093 Bacteria 2495
92 Ga0105247_10175036 3300009101 Bacteria 1429
93 Ga0105242_10162005 3300009176 Bacteria 1959
94 Ga0105248_10002783 3300009177 Bacteria 19441
95 Ga0105248_10008987 3300009177 Bacteria 10985
96 Ga0105248_10009311 3300009177 Bacteria 10814
97 Ga0105248_10032461 3300009177 Bacteria 5836
98 Ga0105248_10056366 3300009177 Bacteria 4409
99 Ga0105248_10203496 3300009177 Bacteria 2231
100 Ga0105248_10327074 3300009177 Bacteria 1727
101 Ga0105237_10108394 3300009545 Bacteria 2769
102 Ga0105238_10005659 3300009551 Bacteria 12351
103 Ga0105238_10013681 3300009551 Bacteria 8195
104 Ga0105238_10042636 3300009551 Bacteria 4593
105 Ga0105249_10000356 3300009553 Bacteria 45856
106 Ga0105249_10164192 3300009553 Bacteria 2149
107 Ga0105239_10092191 3300010375 Bacteria 3344
108 Ga0105239_10127187 3300010375 Bacteria 2833
109 Ga0105239_10192463 3300010375 Bacteria 2283
110 Ga0105246_10583302 3300011119 Bacteria 963
111 Ga0157370_10266468 3300013104 Bacteria 1583
112 Ga0157374_10249117 3300013296 Bacteria 1748
113 Ga0157374_10395301 3300013296 Bacteria 1378
114 Ga0163162_10120960 3300013306 Bacteria 2723
115 Ga0157372_10193139 3300013307 Bacteria 2358
116 Ga0157375_10129456 3300013308 Bacteria 2642
117 Ga0157375_10370426 3300013308 Bacteria 1598
118 Ga0163163_10001756 3300014325 Bacteria 18264
119 Ga0163163_10074998 3300014325 Bacteria 3376
120 Ga0163163_10143276 3300014325 Bacteria 2432
121 Ga0163163_10457606 3300014325 Bacteria 1336
122 Ga0157379_10001581 3300014968 Bacteria 18756
123 Ga0157379_10006140 3300014968 Bacteria 10344
124 Ga0157379_10017507 3300014968 Bacteria 6308
125 Ga0157379_10170697 3300014968 Bacteria 1963
126 Ga0213872_10008384 3300021361 Bacteria 5004
127 Ga0213876_10013795 3300021384 Bacteria 4283
128 Ga0213876_10075190 3300021384 Bacteria 1784
129 Ga0213875_10005570 3300021388 Bacteria 6738
130 Ga0209026_1005037 3300025250 Bacteria 3690
131 Ga0209676_1000046 3300025292 Bacteria 409173
132 Ga0209758_1002875 3300025297 Bacteria 16680
133 Ga0209050_1000031 3300025298 Bacteria 458181
134 Ga0209050_1007299 3300025298 Bacteria 6240
135 Ga0209257_1000073 3300025304 Bacteria 325833
136 Ga0209257_1000191 3300025304 Bacteria 152659
137 Ga0209257_1000966 3300025304 Bacteria 39401
138 Ga0209257_1015093 3300025304 Bacteria 3248
139 Ga0207705_10077489 3300025909 Bacteria 2418
140 Ga0207695_10000987 3300025913 Bacteria 50463
141 Ga0207695_10001134 3300025913 Bacteria 46205
142 Ga0207695_10043719 3300025913 Bacteria 4772
143 Ga0207695_10113133 3300025913 Bacteria 2691
144 Ga0207660_10004369 3300025917 Bacteria 9219
145 Ga0207660_10077458 3300025917 Bacteria 2434
146 Ga0207657_10005615 3300025919 Bacteria 13091
147 Ga0207657_10009259 3300025919 Bacteria 9920
148 Ga0207652_10146316 3300025921 Bacteria 2115
149 Ga0207681_10169800 3300025923 Bacteria 1652
150 Ga0207694_10027260 3300025924 Bacteria 4350
151 Ga0207650_10000133 3300025925 Bacteria 90953
152 Ga0207650_10008733 3300025925 Bacteria 6920
153 Ga0207650_10075912 3300025925 Bacteria 2538
154 Ga0207650_10161822 3300025925 Bacteria 1774
155 Ga0207650_10246356 3300025925 Bacteria 1445
156 Ga0207644_10005355 3300025931 Bacteria 8370
157 Ga0207644_10129092 3300025931 Bacteria 1933
158 Ga0207690_10000134 3300025932 Bacteria 60374
159 Ga0207706_10031012 3300025933 Bacteria 4764
160 Ga0207669_10202661 3300025937 Bacteria 1442
161 Ga0207704_10001576 3300025938 Bacteria 10235
162 Ga0207711_10000625 3300025941 Bacteria 35512
163 Ga0207711_10004518 3300025941 Bacteria 11850
164 Ga0207711_10018358 3300025941 Bacteria 5813
165 Ga0207667_10026861 3300025949 Bacteria 6282
166 Ga0207667_10041133 3300025949 Bacteria 4917
167 Ga0207712_10000790 3300025961 Bacteria 23489
168 Ga0207712_10128257 3300025961 Bacteria 1929
169 Ga0207668_10000016 3300025972 Bacteria 159703
170 Ga0207668_10000662 3300025972 Bacteria 21158
171 Ga0207668_10002668 3300025972 Bacteria 10437
172 Ga0207668_10010033 3300025972 Bacteria 5702
173 Ga0207668_10015854 3300025972 Bacteria 4692
174 Ga0207668_10027975 3300025972 Bacteria 3680
175 Ga0207668_10030241 3300025972 Bacteria 3557
176 Ga0207658_10000931 3300025986 Bacteria 24185
177 Ga0207658_10013584 3300025986 Bacteria 5569
178 Ga0207658_10284177 3300025986 Bacteria 1419
179 Ga0207677_10481993 3300026023 Bacteria 1069
180 Ga0207703_10000086 3300026035 Bacteria 107307
181 Ga0207703_10000193 3300026035 Bacteria 70671
182 Ga0207703_10000228 3300026035 Bacteria 64483
183 Ga0207703_10003556 3300026035 Bacteria 13024
184 Ga0207703_10010955 3300026035 Bacteria 7066
185 Ga0207639_10022556 3300026041 Bacteria 4535
186 Ga0207639_10161126 3300026041 Bacteria 1890
187 Ga0207678_10324308 3300026067 Bacteria 1325
188 Ga0207702_10258697 3300026078 Bacteria 1638
189 Ga0207702_10373479 3300026078 Bacteria 1370
190 Ga0207641_10000003 3300026088 Bacteria 496984
191 Ga0207641_10000007 3300026088 Bacteria 441443
192 Ga0207641_10000027 3300026088 Bacteria 244787
193 Ga0207641_10003109 3300026088 Bacteria 14930
194 Ga0207641_10005335 3300026088 Bacteria 10980
195 Ga0207641_10303680 3300026088 Bacteria 1508
196 Ga0207676_10000109 3300026095 Bacteria 74080
197 Ga0207676_10000679 3300026095 Bacteria 27225
198 Ga0207676_10000734 3300026095 Bacteria 25702
199 Ga0207676_10000794 3300026095 Bacteria 24585
200 Ga0207676_10001962 3300026095 Bacteria 14986
201 Ga0207676_10385506 3300026095 Bacteria 1306
202 Ga0207674_10135594 3300026116 Bacteria 2424
203 Ga0207674_10264559 3300026116 Bacteria 1667
204 Ga0207675_100029840 3300026118 Bacteria 5078
205 Ga0209981_1002428 3300027378 Bacteria 2374
206 Ga0209999_1000319 3300027543 Bacteria 7192
207 Ga0209983_1001813 3300027665 Bacteria 4744
208 Ga0268266_10000005 3300028379 Bacteria 1448194
209 Ga0268266_10002063 3300028379 Bacteria 22264
210 Ga0268266_10013343 3300028379 Bacteria 7079
211 Ga0268266_10013577 3300028379 Bacteria 7015
212 Ga0268266_10254602 3300028379 Bacteria 1625
213 Ga0268265_10002377 3300028380 Bacteria 14227
214 Ga0268265_10004078 3300028380 Bacteria 10263
215 Ga0268265_10011342 3300028380 Bacteria 6028
216 Ga0268265_10013434 3300028380 Bacteria 5563
217 Ga0268265_10055372 3300028380 Bacteria 3013
218 Ga0268265_10069488 3300028380 Bacteria 2735
219 Ga0268265_10091049 3300028380 Bacteria 2438
220 Ga0268265_10125789 3300028380 Bacteria 2121
221 Ga0268265_10241483 3300028380 Bacteria 1594
222 Ga0268265_10331590 3300028380 Bacteria 1382
223 Ga0268264_10000110 3300028381 Bacteria 206663
224 Ga0268264_10000364 3300028381 Bacteria 67218
225 Ga0268264_10000416 3300028381 Bacteria 60203
226 Ga0268264_10091008 3300028381 Bacteria 2630
227 Ga0268264_10230038 3300028381 Bacteria 1712
228 Ga0265337_1054309 3300028556 Bacteria 1121
229 Ga0307517_10017137 3300028786 Bacteria 9463
230 Ga0307517_10077326 3300028786 Bacteria 2893
231 Ga0307517_10150313 3300028786 Bacteria 1600
232 Ga0265338_10249492 3300028800 Bacteria 1310
233 Ga0265327_10000394 3300031251 Bacteria 81965
234 Ga0265327_10000933 3300031251 Bacteria 42834
235 Ga0307513_10004304 3300031456 Bacteria 19024
236 Ga0307513_10007192 3300031456 Bacteria 14457
237 Ga0307513_10007802 3300031456 Bacteria 13803
238 Ga0307513_10041492 3300031456 Bacteria 5078
239 Ga0307516_10000539 3300031730 Bacteria 50564
240 Ga0307406_10001474 3300031901 Bacteria 12992
241 Ga0307412_10211907 3300031911 Bacteria 1479
242 Ga0307414_10076931 3300032004 Bacteria 2427
243 Ga0307414_10179456 3300032004 Bacteria 1701
244 Ga0307414_10203525 3300032004 Bacteria 1612
245 Ga0307510_10017593 3300033180 Bacteria 8428
246 Ga0373926_0029821 3300035083 Bacteria 1919
247 Ga0373934_0127912 3300035086 Bacteria 1035
248 Ga0373944_0015705 3300035089 Bacteria 2128
249 Ga0373946_0046802 3300035171 Bacteria 1794
250 Ga0373935_0166818 3300035692 Bacteria 1504
251 Ga0373927_0000130 3300035695 Bacteria 57890
252 Ga0373947_0072289 3300035725 Bacteria 2118
253 Ga0373925_0000022 3300037068 Bacteria 160046
254 Ga0373925_0235835 3300037068 Bacteria 1464
255 Ga0395899_0000984 3300037312 Bacteria 26243
256 Ga0395899_0029052 3300037312 Bacteria 4159
257 Ga0395899_0081615 3300037312 Bacteria 2352
258 Ga0395900_0000010 3300037418 Bacteria 461364
259 Ga0395900_0044298 3300037418 Bacteria 4585
260 Ga0395900_0210454 3300037418 Bacteria 1963
261 Ga0395898_0004653 3300037466 Bacteria 14958
262 Ga0395898_0024065 3300037466 Bacteria 6146
263 Ga0395898_0291679 3300037466 Bacteria 1556
264 Ga0395905_0001301 3300037471 Bacteria 30685
265 Ga0395905_0033175 3300037471 Bacteria 4851
266 Ga0395905_0039254 3300037471 Bacteria 4441
267 Ga0395905_0127790 3300037471 Bacteria 2390
268 Ga0395905_0133687 3300037471 Bacteria 2333
269 Ga0395905_0296381 3300037471 Bacteria 1504
270 Ga0436364_0514526 3300037853 Bacteria 11903
271 Ga0395901_0000007 3300038443 Bacteria 497408
272 Ga0395901_0229573 3300038443 Bacteria 1938
273 Ga0395901_0267294 3300038443 Bacteria 1779
274 Ga0436365_0508673 3300039437 Bacteria 2660
275 Ga0436361_0778597 3300039447 Bacteria 8376
276 Ga0439458_0029864 3300042157 Bacteria 1295
277 Ga0495605_0066208 3300046474 Bacteria 1717
278 Ga0495583_0075424 3300046506 Bacteria 1475
279 Ga0495610_0058681 3300046512 Bacteria 1840
280 Ga0495637_0038083 3300046520 Bacteria 2084
281 Ga0495643_0019541 3300046522 Bacteria 3917
282 Ga0495642_0019118 3300046528 Bacteria 2683
283 Ga0495597_0001893 3300046542 Bacteria 14240
284 Ga0495645_0005791 3300046543 Bacteria 8525
285 Ga0495622_0002466 3300046557 Bacteria 8963
286 Ga0495668_0079102 3300046616 Bacteria 1805
287 Ga0495668_0097245 3300046616 Bacteria 1611
288 Ga0495611_0002548 3300046648 Bacteria 8267
289 Ga0495625_0055450 3300046660 Bacteria 2826
290 Ga0495625_0114384 3300046660 Bacteria 1842
291 Ga0495669_0000001 3300046684 Bacteria 291866
292 Ga0495669_0000172 3300046684 Bacteria 40888
293 Ga0495636_0028685 3300047318 Bacteria 2271
294 Ga0495674_0127193 3300047319 Bacteria 2149
295 Ga0495687_015812 3300047443 Bacteria 3820
296 Ga0495687_021367 3300047443 Plasmid 3132
297 Ga0495677_0028675 3300047445 Bacteria 2023
298 Ga0495686_0006911 3300047472 Bacteria 8585
299 Ga0495686_0154320 3300047472 Bacteria 1346
300 Ga0496102_0069444 3300048905 Bacteria 3234
301 Ga0496102_0082361 3300048905 Bacteria 2967
302 Ga0496104_0232901 3300048907 Bacteria 1754
303 Ga0496107_0109602 3300048910 Bacteria 2028
304 Ga0496108_0076213 3300048911 Bacteria 2834
305 Ga0496109_0010443 3300048912 Bacteria 7934
306 Ga0496110_0154844 3300048913 Bacteria 2076
307 Ga0496110_0218771 3300048913 Bacteria 1732
308 Ga0496112_0032793 3300048915 Bacteria 5043
309 Ga0496113_0078572 3300048916 Bacteria 2525
310 Ga0496114_0660729 3300048917 Bacteria 919
311 Ga0496115_0001599 3300048918 Bacteria 16277
312 Ga0496115_0001643 3300048918 Bacteria 16076
313 Ga0496117_0144012 3300048920 Bacteria 1422
314 Ga0496118_0062687 3300048921 Bacteria 2741
315 Ga0496119_0020652 3300048922 Bacteria 4794
316 Ga0496121_0000135 3300048924 Bacteria 165485
317 Ga0496121_0000831 3300048924 Bacteria 56152
318 Ga0496121_0001187 3300048924 Bacteria 45612
319 Ga0496125_0001195 3300048928 Bacteria 39130
320 Ga0496125_0077065 3300048928 Bacteria 2572
321 Ga0501033_0004094 3300049570 Bacteria 11758
322 Ga0501034_0024267 3300049571 Bacteria 6167
323 Ga0501037_0015374 3300049573 Bacteria 5632
324 Ga0501039_0246247 3300049575 Bacteria 1406
325 Ga0501047_0071484 3300049581 Bacteria 3340
326 Ga0501047_0101781 3300049581 Bacteria 2752
327 Ga0501047_0272677 3300049581 Bacteria 1538
328 Ga0501047_0508357 3300049581 Bacteria 1031
329 Ga0501047_0571366 3300049581 Bacteria 954
330 Ga0501048_0347813 3300049582 Bacteria 1057
331 Ga0501072_0202531 3300049588 Bacteria 1583
332 Ga0501044_0004038 3300049823 Bacteria 16462
333 Ga0501044_0006448 3300049823 Bacteria 12959
334 Ga0501044_0145387 3300049823 Bacteria 2357
335 nmdc:mga03n38_6293_c1 3300050490 Bacteria 4113
336 nmdc:mga00v17_801_c1 3300050491 Bacteria 17106
337 nmdc:mga0k408_5702_c1 3300050493 Bacteria 6623
338 nmdc:mga06z11_3771_c1 3300050494 Bacteria 5895
339 Ga0500635_0000082 3300053080 Bacteria 62117
340 Ga0500643_008809 3300053087 Bacteria 3921
341 Ga0500651_0002702 3300053093 Bacteria 9453
342 Ga0500641_0060399 3300053096 Bacteria 1577
343 Ga0500555_001298 3300053103 Bacteria 7915
344 Ga0500562_000372 3300053108 Bacteria 10836
345 Ga0500569_000868 3300053109 Bacteria 5375
346 Ga0500595_002406 3300053119 Bacteria 9340
347 Ga0500608_009847 3300053122 Bacteria 4076
348 Ga0500614_001498 3300053123 Bacteria 5563
349 Ga0500559_0015493 3300053136 Bacteria 3219
350 Ga0500590_004891 3300053148 Bacteria 6395
351 Ga0500603_008938 3300053150 Bacteria 2235
352 Ga0500624_020797 3300053157 Bacteria 1054
353 Ga0500636_0024519 3300053177 Bacteria 3568
354 Ga0500637_0053162 3300053178 Bacteria 2311
355 Ga0500637_0124310 3300053178 Bacteria 1496
356 Ga0500625_034985 3300053729 Bacteria 2380
357 Ga0500645_009486 3300053730 Bacteria 3267
358 Ga0500596_000086 3300053735 Bacteria 12601
359 Ga0587128_015692 3300059630 Bacteria 1101
360 2643999345 2643221598 Bacteria 4578346
361 2644085612 2643221614 Bacteria 4260023
362 2644343163 2643221661 Bacteria 4267604
363 2644366463 2643221666 Bacteria 4265935
364 2894773236 2894772417 Bacteria 5305674
365 Ga0070665_100000248
366 JGI25406J46586_10001932
367 Ga0055536_1000070
368 Ga0055530_10000076
369 Ga0055530_10000188
370 Ga0055531_10005752
371 Ga0065165_1000029
372 Ga0070670_100117301
373 Ga0070666_10047259
374 Ga0070666_10189436
375 Ga0070680_100026527
376 Ga0070660_100126465
377 Ga0070691_10024488
378 Ga0070668_100001178
379 Ga0070668_100002233
380 Ga0070668_100010330
381 Ga0070668_100021184
382 Ga0070668_100022775
383 Ga0070668_100240781
384 Ga0070669_100055532
385 Ga0070669_100334233
386 Ga0070669_100478711
387 Ga0070671_100000153
388 Ga0070659_100000040
389 Ga0070667_100000299
390 Ga0070667_100004014
391 Ga0070667_100019418
392 Ga0070667_100106034
393 Ga0070667_100424074
394 Ga0070681_10024302
395 Ga0070681_10296576
396 Ga0070679_100024223
397 Ga0068853_100042558
398 Ga0068853_100410947
399 Ga0070665_100000867
400 Ga0070665_100001434
401 Ga0070665_100205278
402 Ga0070665_100226225
403 Ga0068855_100098172
404 Ga0068857_100423084
405 Ga0068856_100277936
406 Ga0068856_100286227
407 Ga0068852_100418533
408 Ga0068859_100000744
409 Ga0068859_100077982
410 Ga0068864_100000185
411 Ga0068864_100000238
412 Ga0068864_100001411
413 Ga0068864_100001967
414 Ga0068864_100370683
415 Ga0068863_100001211
416 Ga0068863_100002323
417 Ga0068863_100006056
418 Ga0068863_100205606
419 Ga0068863_100400845
420 Ga0068858_100000037
421 Ga0068858_100000206
422 Ga0068858_100001538
423 Ga0068858_100005345
424 Ga0068858_100183786
425 Ga0068860_100000420
426 Ga0068860_100000517
427 Ga0068860_100003590
428 Ga0068860_100064415
429 Ga0068860_100161217
430 Ga0068860_100316167
431 Ga0068862_100000786
432 Ga0068862_100009671
433 Ga0068862_100011439
434 Ga0068862_100012557
435 Ga0068862_100131374
436 Ga0068862_100132015
437 Ga0068862_100256907
438 Ga0081539_10000118
439 Ga0070717_10190335
440 Ga0075368_10002174
441 Ga0075363_100023395
442 Ga0075364_10000457
443 Ga0075362_10079064
444 Ga0075367_10001510
445 Ga0075366_10017086
446 Ga0075370_10067756
447 Ga0097620_100000744
448 Ga0097620_100077982
449 Ga0105251_10109068
450 Ga0105240_10000522
451 Ga0105240_10024604
452 Ga0105240_10034503
453 Ga0105240_10077997
454 Ga0105240_10135159
455 Ga0105240_10180005
456 Ga0105247_10175036
457 Ga0105242_10162005
458 Ga0105248_10002783
459 Ga0105248_10008987
460 Ga0105248_10009311
461 Ga0105248_10032461
462 Ga0105248_10056366
463 Ga0105248_10203496
464 Ga0105248_10327074
465 Ga0105237_10108394
466 Ga0105238_10005659
467 Ga0105238_10013681
468 Ga0105238_10042636
469 Ga0105249_10000356
470 Ga0105249_10164192
471 Ga0105239_10092191
472 Ga0105239_10127187
473 Ga0105239_10192463
474 Ga0105246_10583302
475 Ga0157370_10266468
476 Ga0157374_10249117
477 Ga0157374_10395301
478 Ga0163162_10120960
479 Ga0157372_10193139
480 Ga0157375_10129456
481 Ga0157375_10370426
482 Ga0163163_10001756
483 Ga0163163_10074998
484 Ga0163163_10143276
485 Ga0163163_10457606
486 Ga0157379_10001581
487 Ga0157379_10006140
488 Ga0157379_10017507
489 Ga0157379_10170697
490 Ga0213872_10008384
491 Ga0213876_10013795
492 Ga0213876_10075190
493 Ga0213875_10005570
494 Ga0209026_1005037
495 Ga0209676_1000046
496 Ga0209758_1002875
497 Ga0209050_1000031
498 Ga0209050_1007299
499 Ga0209257_1000073
500 Ga0209257_1000191
501 Ga0209257_1000966
502 Ga0209257_1015093
503 Ga0207705_10077489
504 Ga0207695_10000987
505 Ga0207695_10001134
506 Ga0207695_10043719
507 Ga0207695_10113133
508 Ga0207660_10004369
509 Ga0207660_10077458
510 Ga0207657_10005615
511 Ga0207657_10009259
512 Ga0207652_10146316
513 Ga0207681_10169800
514 Ga0207694_10027260
515 Ga0207650_10000133
516 Ga0207650_10008733
517 Ga0207650_10075912
518 Ga0207650_10161822
519 Ga0207650_10246356
520 Ga0207644_10005355
521 Ga0207644_10129092
522 Ga0207690_10000134
523 Ga0207706_10031012
524 Ga0207669_10202661
525 Ga0207704_10001576
526 Ga0207711_10000625
527 Ga0207711_10004518
528 Ga0207711_10018358
529 Ga0207667_10026861
530 Ga0207667_10041133
531 Ga0207712_10000790
532 Ga0207712_10128257
533 Ga0207668_10000016
534 Ga0207668_10000662
535 Ga0207668_10002668
536 Ga0207668_10010033
537 Ga0207668_10015854
538 Ga0207668_10027975
539 Ga0207668_10030241
540 Ga0207658_10000931
541 Ga0207658_10013584
542 Ga0207658_10284177
543 Ga0207677_10481993
544 Ga0207703_10000086
545 Ga0207703_10000193
546 Ga0207703_10000228
547 Ga0207703_10003556
548 Ga0207703_10010955
549 Ga0207639_10022556
550 Ga0207639_10161126
551 Ga0207678_10324308
552 Ga0207702_10258697
553 Ga0207702_10373479
554 Ga0207641_10000003
555 Ga0207641_10000007
556 Ga0207641_10000027
557 Ga0207641_10003109
558 Ga0207641_10005335
559 Ga0207641_10303680
560 Ga0207676_10000109
561 Ga0207676_10000679
562 Ga0207676_10000734
563 Ga0207676_10000794
564 Ga0207676_10001962
565 Ga0207676_10385506
566 Ga0207674_10135594
567 Ga0207674_10264559
568 Ga0207675_100029840
569 Ga0209981_1002428
570 Ga0209999_1000319
571 Ga0209983_1001813
572 Ga0268266_10000005
573 Ga0268266_10002063
574 Ga0268266_10013343
575 Ga0268266_10013577
576 Ga0268266_10254602
577 Ga0268265_10002377
578 Ga0268265_10004078
579 Ga0268265_10011342
580 Ga0268265_10013434
581 Ga0268265_10055372
582 Ga0268265_10069488
583 Ga0268265_10091049
584 Ga0268265_10125789
585 Ga0268265_10241483
586 Ga0268265_10331590
587 Ga0268264_10000110
588 Ga0268264_10000364
589 Ga0268264_10000416
590 Ga0268264_10091008
591 Ga0268264_10230038
592 Ga0265337_1054309
593 Ga0307517_10017137
594 Ga0307517_10077326
595 Ga0307517_10150313
596 Ga0265338_10249492
597 Ga0265327_10000394
598 Ga0265327_10000933
599 Ga0307513_10004304
600 Ga0307513_10007192
601 Ga0307513_10007802
602 Ga0307513_10041492
603 Ga0307516_10000539
604 Ga0307406_10001474
605 Ga0307412_10211907
606 Ga0307414_10076931
607 Ga0307414_10179456
608 Ga0307414_10203525
609 Ga0307510_10017593
610 Ga0373926_0029821
611 Ga0373934_0127912
612 Ga0373944_0015705
613 Ga0373946_0046802
614 Ga0373935_0166818
615 Ga0373927_0000130
616 Ga0373947_0072289
617 Ga0373925_0000022
618 Ga0373925_0235835
619 Ga0395899_0000984
620 Ga0395899_0029052
621 Ga0395899_0081615
622 Ga0395900_0000010
623 Ga0395900_0044298
624 Ga0395900_0210454
625 Ga0395898_0004653
626 Ga0395898_0024065
627 Ga0395898_0291679
628 Ga0395905_0001301
629 Ga0395905_0033175
630 Ga0395905_0039254
631 Ga0395905_0127790
632 Ga0395905_0133687
633 Ga0395905_0296381
634 Ga0436364_0514526
635 Ga0395901_0000007
636 Ga0395901_0229573
637 Ga0395901_0267294
638 Ga0436365_0508673
639 Ga0436361_0778597
640 Ga0439458_0029864
641 Ga0495605_0066208
642 Ga0495583_0075424
643 Ga0495610_0058681
644 Ga0495637_0038083
645 Ga0495643_0019541
646 Ga0495642_0019118
647 Ga0495597_0001893
648 Ga0495645_0005791
649 Ga0495622_0002466
650 Ga0495668_0079102
651 Ga0495668_0097245
652 Ga0495611_0002548
653 Ga0495625_0055450
654 Ga0495625_0114384
655 Ga0495669_0000001
656 Ga0495669_0000172
657 Ga0495636_0028685
658 Ga0495674_0127193
659 Ga0495687_015812
660 Ga0495687_021367
661 Ga0495677_0028675
662 Ga0495686_0006911
663 Ga0495686_0154320
664 Ga0496102_0069444
665 Ga0496102_0082361
666 Ga0496104_0232901
667 Ga0496107_0109602
668 Ga0496108_0076213
669 Ga0496109_0010443
670 Ga0496110_0154844
671 Ga0496110_0218771
672 Ga0496112_0032793
673 Ga0496113_0078572
674 Ga0496114_0660729
675 Ga0496115_0001599
676 Ga0496115_0001643
677 Ga0496117_0144012
678 Ga0496118_0062687
679 Ga0496119_0020652
680 Ga0496121_0000135
681 Ga0496121_0000831
682 Ga0496121_0001187
683 Ga0496125_0001195
684 Ga0496125_0077065
685 Ga0501033_0004094
686 Ga0501034_0024267
687 Ga0501037_0015374
688 Ga0501039_0246247
689 Ga0501047_0071484
690 Ga0501047_0101781
691 Ga0501047_0272677
692 Ga0501047_0508357
693 Ga0501047_0571366
694 Ga0501048_0347813
695 Ga0501072_0202531
696 Ga0501044_0004038
697 Ga0501044_0006448
698 Ga0501044_0145387
699 nmdc:mga03n38_6293_c1
700 nmdc:mga00v17_801_c1
701 nmdc:mga0k408_5702_c1
702 nmdc:mga06z11_3771_c1
703 Ga0500635_0000082
704 Ga0500643_008809
705 Ga0500651_0002702
706 Ga0500641_0060399
707 Ga0500555_001298
708 Ga0500562_000372
709 Ga0500569_000868
710 Ga0500595_002406
711 Ga0500608_009847
712 Ga0500614_001498
713 Ga0500559_0015493
714 Ga0500590_004891
715 Ga0500603_008938
716 Ga0500624_020797
717 Ga0500636_0024519
718 Ga0500637_0053162
719 Ga0500637_0124310
720 Ga0500625_034985
721 Ga0500645_009486
722 Ga0500596_000086
723 Ga0587128_015692
724 2643999345
725 2644085612
726 2644343163
727 2644366463
728 2894773236

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00970

FAD_binding_6

Oxidoreductase FAD-binding domain

46

143

0.86

PF00175

NAD_binding_1

Oxidoreductase NAD-binding domain

154

272

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rra-assembly1.cif.gz_A x-ray structure of the ferredoxin-nadp reductase from brucella ovis in complex with nadp 0.9863 15 271
5thx-assembly1.cif.gz_A crystal structure of a ferredoxin nadp+ reductase from neisseria gonorrhoeae with bound nadp and fad 0.9833 16 271
6rra-assembly1.cif.gz_A x-ray structure of the ferredoxin-nadp reductase from brucella ovis in complex with nadp 0.9825 15 271
1a8p-assembly1.cif.gz_A ferredoxin reductase from azotobacter vinelandii 0.98 16 271
4b4d-assembly1.cif.gz_A-2 crystal structure of fad-containing ferredoxin-nadp reductase from xanthomonas axonopodis pv. citri 0.9785 17 271
ID Description Score Start End Superfamily
1a8pA01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.9794 16 110 2.40.30.10
1a8pA01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.9694 16 110 2.40.30.10
2bgjA01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.9674 23 105 2.40.30.10
5ufaC01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.957 15 110 2.40.30.10
2bgiA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 0.9542 114 265 3.40.50.80
ID Description Score Start End GO Terms
AF-Q8KT46-F1-model_v4 Catechol 1,2-dioxygenase 0.9976 150 260 GO:0034599
GO:0042167
GO:0051213
AF-A0A0Q4XD38-F1-model_v4 ferredoxin--NADP(+) reductase (EC 1.18.1.2) 0.9946 15 190 GO:0000166
GO:0004324
GO:0034599
GO:0042167
AF-A0A496KI10-F1-model_v4 deleted 0.9904 15 143
AF-A0A7R7T721-F1-model_v4 ferredoxin--NADP(+) reductase (EC 1.18.1.2) 0.9898 15 271 GO:0000166
GO:0004324
GO:0034599
GO:0042167
AF-A0A0Q4XD38-F1-model_v4 ferredoxin--NADP(+) reductase (EC 1.18.1.2) 0.989 15 190 GO:0000166
GO:0004324
GO:0034599
GO:0042167

Map