F423247

General Info

Members Datasets Scaffolds Average Seq Length
364 203 728 196

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100002688|Ga0068855_1000026887
Length 211
Sequence MTLGAITHYLITNWVELAGFITTALGIWLTTKRLLICWPVVFAADILYLIVFYRARLLSDSLLQVFFIAFTLYGWXXXXRGVREDGEVRVEPLGLRAFVVAIIAGIAGTFILGEIAKHLQAALPWLDAALASFSLVGSWWQARKHVANWWLWIIVNLAYIGEYIYKDLWITAVLYAGLVVLAILGLRDWRRAARSAQTAACTTLSSGSPAI

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
46 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
47 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
75 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
76 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
77 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
118 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
124 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
125 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
126 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
129 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
130 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
137 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
138 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
139 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
142 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
143 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
144 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
145 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
146 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
147 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
148 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
149 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
150 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
151 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
152 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
153 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
154 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
155 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
156 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
157 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
158 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
159 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
160 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
161 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
162 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
163 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
164 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
170 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
171 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
172 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
173 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
174 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
175 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
176 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
177 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
178 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
181 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
182 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
183 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
184 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
185 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
186 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
187 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
188 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
189 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
190 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
191 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
192 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
193 2818991457 Xanthomonas translucens 569 Isolate Unclassified
194 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
195 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
196 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
197 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
198 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
199 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
200 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
201 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
202 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
203 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.51
Metatranscriptomes 0
Isolates 5.49

Biome Distribution

Category Percentage (%)
Aerial Root 0.82
Bulb 0
Endosphere 3.57
Nodule 0.27
Rhizoplane 2.2
Rhizosphere 84.07
Stem 0
Stem Tuber 0
Unclassified 9.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100002688 3300005563 Bacteria 21925
2 SwRhRL2b_contig_3237251 2162886007 Bacteria 2092
3 SwRhRL2b_contig_405574 2162886007 Bacteria 2720
4 JGI24743J22301_10045710 3300001991 Unclassified 886
5 Ga0055536_1000154 3300003781 Bacteria 59301
6 Ga0055530_10000171 3300003791 Bacteria 59301
7 Ga0055540_1000214 3300003792 Bacteria 54779
8 Ga0065704_10072202 3300005289 Bacteria 8954
9 Ga0065704_10075902 3300005289 Bacteria 5363
10 Ga0065712_10101746 3300005290 Bacteria 2011
11 Ga0070658_10046972 3300005327 Bacteria 3494
12 Ga0070658_10074673 3300005327 Bacteria 2780
13 Ga0070658_10199734 3300005327 Bacteria 1687
14 Ga0070683_100002041 3300005329 Bacteria 15901
15 Ga0070683_100002260 3300005329 Bacteria 15260
16 Ga0070683_100019183 3300005329 Bacteria 6072
17 Ga0070683_100133078 3300005329 Bacteria 2353
18 Ga0070683_100599664 3300005329 Bacteria 1054
19 Ga0070670_100024775 3300005331 Bacteria 5161
20 Ga0070670_100079126 3300005331 Bacteria 2825
21 Ga0068869_100001577 3300005334 Bacteria 13554
22 Ga0070666_10092030 3300005335 Bacteria 2084
23 Ga0070680_100528864 3300005336 Bacteria 1010
24 Ga0070682_100001445 3300005337 Bacteria 13369
25 Ga0068868_100000066 3300005338 Bacteria 59945
26 Ga0068868_100084157 3300005338 Bacteria 2554
27 Ga0070661_100010869 3300005344 Bacteria 6340
28 Ga0070661_100026342 3300005344 Bacteria 4182
29 Ga0070661_100191749 3300005344 Bacteria 1559
30 Ga0070669_100426431 3300005353 Bacteria 1089
31 Ga0070671_100007733 3300005355 Bacteria 8586
32 Ga0070667_100009812 3300005367 Bacteria 7936
33 Ga0070714_100046267 3300005435 Bacteria 3690
34 Ga0070713_100142163 3300005436 Bacteria 2127
35 Ga0070713_100936767 3300005436 Unclassified 834
36 Ga0070685_10231720 3300005466 Bacteria 1215
37 Ga0070679_100047148 3300005530 Bacteria 4296
38 Ga0070684_100003753 3300005535 Bacteria 11466
39 Ga0070684_100007640 3300005535 Bacteria 8429
40 Ga0070684_100221275 3300005535 Bacteria 1727
41 Ga0070684_100254603 3300005535 Bacteria 1605
42 Ga0068853_100000222 3300005539 Bacteria 40206
43 Ga0068853_100058702 3300005539 Bacteria 3322
44 Ga0070693_100068411 3300005547 Bacteria 2084
45 Ga0070693_100529643 3300005547 Bacteria 840
46 Ga0070665_100005637 3300005548 Bacteria 12872
47 Ga0070665_100055769 3300005548 Unclassified 3963
48 Ga0068855_100000277 3300005563 Bacteria 63213
49 Ga0068855_100022916 3300005563 Bacteria 7484
50 Ga0068855_100413161 3300005563 Bacteria 1477
51 Ga0070664_100555456 3300005564 Bacteria 1062
52 Ga0068857_100003191 3300005577 Bacteria 13595
53 Ga0068857_100012548 3300005577 Bacteria 7379
54 Ga0068854_100231423 3300005578 Unclassified 1467
55 Ga0068856_100000512 3300005614 Bacteria 42666
56 Ga0068856_100003529 3300005614 Bacteria 15773
57 Ga0068856_100009265 3300005614 Bacteria 9564
58 Ga0068856_100057243 3300005614 Bacteria 3848
59 Ga0068856_100173748 3300005614 Bacteria 2167
60 Ga0068856_100539666 3300005614 Bacteria 1187
61 Ga0068852_100000019 3300005616 Bacteria 129021
62 Ga0068852_100000097 3300005616 Bacteria 59430
63 Ga0068852_100114751 3300005616 Bacteria 2455
64 Ga0068852_100122301 3300005616 Unclassified 2385
65 Ga0068852_100429192 3300005616 Unclassified 1305
66 Ga0068852_100471125 3300005616 Bacteria 1246
67 Ga0068852_100664226 3300005616 Unclassified 1050
68 Ga0068859_100023025 3300005617 Bacteria 6247
69 Ga0068864_100000625 3300005618 Bacteria 29830
70 Ga0068851_10007082 3300005834 Bacteria 5137
71 Ga0068851_10048948 3300005834 Bacteria 2143
72 Ga0068851_10060565 3300005834 Bacteria 1938
73 Ga0068851_10075055 3300005834 Unclassified 1756
74 Ga0068863_100001753 3300005841 Bacteria 21524
75 Ga0068858_100012165 3300005842 Bacteria 8114
76 Ga0068860_100000689 3300005843 Bacteria 38878
77 Ga0068862_100023070 3300005844 Bacteria 5212
78 Ga0075364_10442332 3300006051 Bacteria 888
79 Ga0097621_100000349 3300006237 Bacteria 31779
80 Ga0068871_100002325 3300006358 Bacteria 12946
81 Ga0097620_100023025 3300006931 Bacteria 6247
82 Ga0079104_1029024 3300006946 Bacteria 1398
83 Ga0105251_10000321 3300009011 Bacteria 48031
84 Ga0105251_10002159 3300009011 Bacteria 15778
85 Ga0105250_10032148 3300009092 Bacteria 2108
86 Ga0105240_10000372 3300009093 Bacteria 84325
87 Ga0105240_10000496 3300009093 Bacteria 72575
88 Ga0105240_10001856 3300009093 Bacteria 35314
89 Ga0105240_10064615 3300009093 Bacteria 4546
90 Ga0105240_10068360 3300009093 Unclassified 4400
91 Ga0105240_10085557 3300009093 Bacteria 3863
92 Ga0105240_10127298 3300009093 Bacteria 3059
93 Ga0105240_10311427 3300009093 Bacteria 1798
94 Ga0105245_10000486 3300009098 Bacteria 36378
95 Ga0105247_10002346 3300009101 Bacteria 12922
96 Ga0105243_10022374 3300009148 Bacteria 4804
97 Ga0105241_10000026 3300009174 Bacteria 132695
98 Ga0105241_10000121 3300009174 Bacteria 57041
99 Ga0105241_10009216 3300009174 Bacteria 7261
100 Ga0105241_10059096 3300009174 Unclassified 2947
101 Ga0105241_10186853 3300009174 Bacteria 1723
102 Ga0105248_10034015 3300009177 Bacteria 5697
103 Ga0105248_10081067 3300009177 Unclassified 3648
104 Ga0105237_10000590 3300009545 Bacteria 50564
105 Ga0105237_10041670 3300009545 Unclassified 4630
106 Ga0105237_10477611 3300009545 Bacteria 1253
107 Ga0105237_10482805 3300009545 Bacteria 1245
108 Ga0105237_10899893 3300009545 Unclassified 892
109 Ga0105238_10000197 3300009551 Bacteria 66637
110 Ga0105238_10000509 3300009551 Bacteria 40868
111 Ga0105238_10119680 3300009551 Unclassified 2613
112 Ga0105238_10276290 3300009551 Bacteria 1661
113 Ga0105249_10120013 3300009553 Bacteria 2498
114 Ga0105239_10001891 3300010375 Bacteria 27379
115 Ga0105239_10021514 3300010375 Bacteria 7110
116 Ga0105239_10052641 3300010375 Unclassified 4464
117 Ga0105246_10000006 3300011119 Bacteria 83887
118 Ga0105246_10001192 3300011119 Bacteria 15150
119 Ga0157373_10701603 3300013100 Bacteria 742
120 Ga0157371_10000333 3300013102 Bacteria 60809
121 Ga0157371_10065246 3300013102 Bacteria 2579
122 Ga0157370_10000005 3300013104 Bacteria 288514
123 Ga0157369_10000085 3300013105 Bacteria 129025
124 Ga0157369_10000430 3300013105 Bacteria 55736
125 Ga0157369_10016814 3300013105 Bacteria 8221
126 Ga0157369_10024598 3300013105 Bacteria 6696
127 Ga0157369_10026044 3300013105 Bacteria 6489
128 Ga0157369_10140829 3300013105 Unclassified 2552
129 Ga0157369_10463439 3300013105 Bacteria 1312
130 Ga0157374_10031721 3300013296 Bacteria 4805
131 Ga0157374_10182413 3300013296 Bacteria 2051
132 Ga0157374_10198663 3300013296 Bacteria 1963
133 Ga0157378_10004251 3300013297 Bacteria 12630
134 Ga0157378_10018090 3300013297 Bacteria 6188
135 Ga0157378_10425368 3300013297 Unclassified 1313
136 Ga0163162_10010079 3300013306 Bacteria 9185
137 Ga0163162_10080239 3300013306 Bacteria 3330
138 Ga0163162_10500306 3300013306 Bacteria 1346
139 Ga0157372_10000217 3300013307 Bacteria 63667
140 Ga0157372_10009734 3300013307 Bacteria 10222
141 Ga0157372_10017083 3300013307 Bacteria 7789
142 Ga0157372_10020181 3300013307 Bacteria 7185
143 Ga0157372_10082332 3300013307 Bacteria 3643
144 Ga0157372_10105164 3300013307 Bacteria 3229
145 Ga0157372_10163132 3300013307 Bacteria 2576
146 Ga0157372_10210743 3300013307 Bacteria 2252
147 Ga0157375_11225608 3300013308 Bacteria 881
148 Ga0163163_10001161 3300014325 Bacteria 22403
149 Ga0157377_10060827 3300014745 Bacteria 2157
150 Ga0157377_10210870 3300014745 Bacteria 1238
151 Ga0157379_10002312 3300014968 Bacteria 15882
152 Ga0157379_10224971 3300014968 Unclassified 1700
153 Ga0157376_10000296 3300014969 Bacteria 33604
154 Ga0157376_10012770 3300014969 Bacteria 6246
155 Ga0182006_1008227 3300015261 Bacteria 4732
156 Ga0163161_10000853 3300017792 Bacteria 23771
157 Ga0163161_10063024 3300017792 Bacteria 2701
158 Ga0213874_10100155 3300021377 Bacteria 962
159 Ga0209759_1007978 3300025256 Bacteria 3345
160 Ga0209129_1000392 3300025258 Bacteria 35184
161 Ga0209676_1000147 3300025292 Bacteria 172386
162 Ga0209758_1007929 3300025297 Bacteria 7044
163 Ga0209050_1000062 3300025298 Bacteria 316538
164 Ga0209051_1000409 3300025303 Bacteria 59325
165 Ga0207656_10004048 3300025321 Bacteria 5084
166 Ga0207696_1000016 3300025711 Bacteria 502467
167 Ga0207713_1000222 3300025735 Bacteria 76645
168 Ga0207713_1000884 3300025735 Bacteria 27297
169 Ga0207710_10000487 3300025900 Bacteria 25053
170 Ga0207680_10219124 3300025903 Bacteria 1304
171 Ga0207705_10026733 3300025909 Bacteria 4113
172 Ga0207705_10036415 3300025909 Bacteria 3522
173 Ga0207654_10000054 3300025911 Bacteria 82347
174 Ga0207654_10000281 3300025911 Bacteria 30979
175 Ga0207654_10003128 3300025911 Bacteria 8380
176 Ga0207654_10109085 3300025911 Bacteria 1718
177 Ga0207707_10016561 3300025912 Bacteria 6428
178 Ga0207695_10000080 3300025913 Bacteria 287868
179 Ga0207695_10000113 3300025913 Bacteria 247240
180 Ga0207695_10000167 3300025913 Bacteria 194371
181 Ga0207695_10005013 3300025913 Bacteria 17778
182 Ga0207695_10037312 3300025913 Bacteria 5244
183 Ga0207695_10060369 3300025913 Bacteria 3925
184 Ga0207671_10000065 3300025914 Bacteria 166743
185 Ga0207671_10000123 3300025914 Bacteria 119385
186 Ga0207671_10000139 3300025914 Bacteria 111786
187 Ga0207671_10227416 3300025914 Bacteria 1463
188 Ga0207671_10414112 3300025914 Bacteria 1072
189 Ga0207649_10063255 3300025920 Unclassified 2335
190 Ga0207649_10657902 3300025920 Bacteria 810
191 Ga0207652_10109533 3300025921 Bacteria 2449
192 Ga0207681_10353290 3300025923 Bacteria 1177
193 Ga0207694_10000248 3300025924 Bacteria 51461
194 Ga0207694_10000855 3300025924 Bacteria 27098
195 Ga0207694_10012616 3300025924 Bacteria 6368
196 Ga0207694_10053280 3300025924 Bacteria 3137
197 Ga0207694_10166466 3300025924 Bacteria 1783
198 Ga0207650_10056727 3300025925 Bacteria 2911
199 Ga0207650_10063539 3300025925 Bacteria 2760
200 Ga0207687_10000978 3300025927 Bacteria 19404
201 Ga0207687_10061410 3300025927 Unclassified 2654
202 Ga0207687_10112060 3300025927 Bacteria 2027
203 Ga0207700_10154360 3300025928 Unclassified 1901
204 Ga0207664_10083411 3300025929 Bacteria 2605
205 Ga0207644_10004420 3300025931 Bacteria 9123
206 Ga0207709_10094141 3300025935 Bacteria 1966
207 Ga0207711_10060353 3300025941 Unclassified 3267
208 Ga0207711_10273081 3300025941 Bacteria 1556
209 Ga0207689_10000724 3300025942 Bacteria 31641
210 Ga0207661_10001283 3300025944 Bacteria 16799
211 Ga0207661_10018246 3300025944 Bacteria 5211
212 Ga0207661_10192435 3300025944 Bacteria 1789
213 Ga0207661_10966606 3300025944 Bacteria 784
214 Ga0207679_10024591 3300025945 Unclassified 4131
215 Ga0207667_10006194 3300025949 Bacteria 14522
216 Ga0207667_10007990 3300025949 Bacteria 12622
217 Ga0207667_10048192 3300025949 Bacteria 4506
218 Ga0207667_10153024 3300025949 Unclassified 2374
219 Ga0207667_10407028 3300025949 Bacteria 1385
220 Ga0207712_10110215 3300025961 Bacteria 2063
221 Ga0207640_10020377 3300025981 Bacteria 3937
222 Ga0207658_10003428 3300025986 Bacteria 11222
223 Ga0207677_10000143 3300026023 Bacteria 58337
224 Ga0207677_10085080 3300026023 Bacteria 2281
225 Ga0207703_10004820 3300026035 Bacteria 10980
226 Ga0207639_10000088 3300026041 Bacteria 78742
227 Ga0207639_10061122 3300026041 Bacteria 2908
228 Ga0207639_10319936 3300026041 Bacteria 1377
229 Ga0207702_10001334 3300026078 Bacteria 24682
230 Ga0207702_10002672 3300026078 Bacteria 16738
231 Ga0207702_10015520 3300026078 Bacteria 6306
232 Ga0207702_10109911 3300026078 Bacteria 2449
233 Ga0207702_10197544 3300026078 Unclassified 1862
234 Ga0207641_10011936 3300026088 Bacteria 7127
235 Ga0207676_10002595 3300026095 Bacteria 12891
236 Ga0207674_10000669 3300026116 Bacteria 44573
237 Ga0207674_10003068 3300026116 Bacteria 20665
238 Ga0207674_10307226 3300026116 Unclassified 1535
239 Ga0207698_10000003 3300026142 Bacteria 321303
240 Ga0207698_10000708 3300026142 Bacteria 19330
241 Ga0207698_10525140 3300026142 Bacteria 1156
242 Ga0265356_1010246 3300028017 Unclassified 1046
243 Ga0265357_1008033 3300028023 Unclassified 1030
244 Ga0268266_10068745 3300028379 Bacteria 3068
245 Ga0268266_10098647 3300028379 Bacteria 2571
246 Ga0268264_10000598 3300028381 Bacteria 43640
247 Ga0265323_10007390 3300028653 Bacteria 4569
248 Ga0265338_10004495 3300028800 Bacteria 18805
249 Ga0265338_10114279 3300028800 Bacteria 2167
250 Ga0265338_10307429 3300028800 Unclassified 1151
251 Ga0265324_10075921 3300029957 Bacteria 1144
252 Ga0265330_10002162 3300031235 Bacteria 10830
253 Ga0265330_10014322 3300031235 Bacteria 3681
254 Ga0265339_10000194 3300031249 Bacteria 50375
255 Ga0265339_10101482 3300031249 Bacteria 1497
256 Ga0265316_10000352 3300031344 Bacteria 51670
257 Ga0265316_10056454 3300031344 Bacteria 3066
258 Ga0265316_10058084 3300031344 Bacteria 3016
259 Ga0265316_10323321 3300031344 Bacteria 1120
260 Ga0307408_100000004 3300031548 Bacteria 572889
261 Ga0316575_10012827 3300031665 Bacteria 3124
262 Ga0265314_10009910 3300031711 Bacteria 7992
263 Ga0265314_10110795 3300031711 Unclassified 1745
264 Ga0265342_10001536 3300031712 Bacteria 21355
265 Ga0265342_10002441 3300031712 Bacteria 16049
266 Ga0265342_10082053 3300031712 Bacteria 1861
267 Ga0307405_10000897 3300031731 Bacteria 11819
268 Ga0373927_0272039 3300035695 Bacteria 1114
269 Ga0373937_0377362 3300036401 Unclassified 1345
270 Ga0373937_0438256 3300036401 Bacteria 1240
271 Ga0395899_0015555 3300037312 Bacteria 5801
272 Ga0395901_0010291 3300038443 Bacteria 9472
273 Ga0395901_0012867 3300038443 Bacteria 8485
274 Ga0436363_0913429 3300039450 Bacteria 974
275 Ga0451851_0085375 3300041507 Bacteria 755
276 Ga0439464_0035256 3300042439 Bacteria 1412
277 Ga0466963_0000494 3300044694 Bacteria 18341
278 Ga0466967_0029373 3300045976 Unclassified 4600
279 Ga0495627_000039 3300046453 Bacteria 197253
280 Ga0495627_000078 3300046453 Bacteria 119920
281 Ga0495627_037945 3300046453 Bacteria 1492
282 Ga0495629_0017355 3300046459 Bacteria 5158
283 Ga0495629_0024210 3300046459 Bacteria 4323
284 Ga0495607_0017584 3300046501 Bacteria 4584
285 Ga0495583_0002316 3300046506 Bacteria 16594
286 Ga0495606_0000054 3300046507 Bacteria 200380
287 Ga0495610_0001902 3300046512 Bacteria 18014
288 Ga0495610_0078259 3300046512 Bacteria 1525
289 Ga0495620_0004313 3300046515 Bacteria 8039
290 Ga0495632_0029255 3300046519 Bacteria 2870
291 Ga0495643_0000081 3300046522 Bacteria 160004
292 Ga0495643_0022213 3300046522 Bacteria 3623
293 Ga0495648_0001153 3300046524 Bacteria 26712
294 Ga0495652_0048616 3300046529 Bacteria 3633
295 Ga0495652_0531857 3300046529 Bacteria 811
296 Ga0495654_0003891 3300046530 Bacteria 9027
297 Ga0495654_0092786 3300046530 Bacteria 1399
298 Ga0495587_0108134 3300046536 Bacteria 1599
299 Ga0495633_0008408 3300046558 Bacteria 5818
300 Ga0495611_0128548 3300046648 Bacteria 1182
301 Ga0495625_0025897 3300046660 Bacteria 4439
302 Ga0495625_0157388 3300046660 Bacteria 1524
303 Ga0495625_0441197 3300046660 Bacteria 806
304 Ga0495661_0000505 3300046665 Bacteria 40769
305 Ga0495613_0066602 3300046689 Unclassified 2630
306 Ga0495613_0081507 3300046689 Bacteria 2351
307 Ga0495671_0001437 3300046692 Bacteria 15995
308 Ga0495649_0000582 3300046694 Bacteria 30652
309 Ga0495649_0076345 3300046694 Bacteria 1793
310 Ga0495604_0118324 3300047317 Bacteria 1921
311 Ga0495683_0000086 3300047323 Bacteria 92967
312 Ga0495679_000316 3300047446 Bacteria 38517
313 Ga0495679_000618 3300047446 Bacteria 23992
314 Ga0495681_0015970 3300047470 Bacteria 4234
315 Ga0496105_0232622 3300048908 Bacteria 1497
316 Ga0496110_0750671 3300048913 Bacteria 879
317 Ga0496114_0211501 3300048917 Bacteria 1701
318 Ga0496115_0044591 3300048918 Unclassified 3538
319 Ga0496117_0000522 3300048920 Bacteria 63473
320 Ga0496117_0001048 3300048920 Bacteria 42168
321 Ga0496117_0125341 3300048920 Bacteria 1569
322 Ga0496118_0000246 3300048921 Bacteria 96199
323 Ga0496118_0091639 3300048921 Bacteria 2089
324 Ga0496118_0174125 3300048921 Bacteria 1310
325 Ga0496119_0000464 3300048922 Bacteria 55314
326 Ga0496120_0000587 3300048923 Bacteria 55315
327 Ga0496122_0000888 3300048925 Bacteria 55669
328 Ga0496123_0000687 3300048926 Bacteria 55771
329 Ga0496124_0000480 3300048927 Bacteria 68741
330 Ga0496124_0011604 3300048927 Bacteria 8793
331 Ga0496124_0041594 3300048927 Bacteria 3964
332 Ga0496124_0181427 3300048927 Bacteria 1619
333 Ga0496124_0446288 3300048927 Bacteria 883
334 Ga0496125_0000068 3300048928 Bacteria 247765
335 Ga0496125_0045981 3300048928 Bacteria 3667
336 Ga0496126_0009252 3300048929 Bacteria 10501
337 Ga0496126_0019570 3300048929 Bacteria 6663
338 Ga0495678_036781 3300049459 Bacteria 1995
339 Ga0501034_1134802 3300049571 Bacteria 662
340 Ga0495601_0148368 3300053077 Unclassified 1531
341 Ga0500644_0093138 3300053088 Bacteria 1132
342 Ga0500573_0065089 3300053140 Bacteria 2084
343 Ga0500634_0000085 3300053161 Bacteria 36085
344 Ga0500634_0000863 3300053161 Bacteria 10788
345 2599883309 2599185288 Bacteria 6666191
346 2600444695 2600254954 Bacteria 5100516
347 2602012012 2600255389 Bacteria 5275336
348 2735817377 2734482258 Unclassified 2930739
349 2738811450 2738541294 Bacteria 6925949
350 2738898810 2738541309 Bacteria 6926455
351 2739288508 2738543020 Bacteria 5718238
352 2739293820 2738543021 Bacteria 5718241
353 2748019439 2747842501 Bacteria 5293829
354 2819662551 2818991457 Bacteria 5323295
355 2823423655 2823421272 Bacteria 5372474
356 2919503408 2919501602 Bacteria 5286340
357 2926066021 2926063275 Bacteria 5285848
358 2928028130 2928027323 Bacteria 4382488
359 2984558459 2984555340 Bacteria 4247089
360 2984567134 2984564862 Bacteria 4339992
361 2993358225 2993356040 Bacteria 4247105
362 8021625747 8021622325 Bacteria 4844743
363 8021650321 8021648035 Bacteria 4772378
364 8034964775 8034962539 Bacteria 4884839
365 Ga0068855_100002688
366 SwRhRL2b_contig_3237251
367 SwRhRL2b_contig_405574
368 JGI24743J22301_10045710
369 Ga0055536_1000154
370 Ga0055530_10000171
371 Ga0055540_1000214
372 Ga0065704_10072202
373 Ga0065704_10075902
374 Ga0065712_10101746
375 Ga0070658_10046972
376 Ga0070658_10074673
377 Ga0070658_10199734
378 Ga0070683_100002041
379 Ga0070683_100002260
380 Ga0070683_100019183
381 Ga0070683_100133078
382 Ga0070683_100599664
383 Ga0070670_100024775
384 Ga0070670_100079126
385 Ga0068869_100001577
386 Ga0070666_10092030
387 Ga0070680_100528864
388 Ga0070682_100001445
389 Ga0068868_100000066
390 Ga0068868_100084157
391 Ga0070661_100010869
392 Ga0070661_100026342
393 Ga0070661_100191749
394 Ga0070669_100426431
395 Ga0070671_100007733
396 Ga0070667_100009812
397 Ga0070714_100046267
398 Ga0070713_100142163
399 Ga0070713_100936767
400 Ga0070685_10231720
401 Ga0070679_100047148
402 Ga0070684_100003753
403 Ga0070684_100007640
404 Ga0070684_100221275
405 Ga0070684_100254603
406 Ga0068853_100000222
407 Ga0068853_100058702
408 Ga0070693_100068411
409 Ga0070693_100529643
410 Ga0070665_100005637
411 Ga0070665_100055769
412 Ga0068855_100000277
413 Ga0068855_100022916
414 Ga0068855_100413161
415 Ga0070664_100555456
416 Ga0068857_100003191
417 Ga0068857_100012548
418 Ga0068854_100231423
419 Ga0068856_100000512
420 Ga0068856_100003529
421 Ga0068856_100009265
422 Ga0068856_100057243
423 Ga0068856_100173748
424 Ga0068856_100539666
425 Ga0068852_100000019
426 Ga0068852_100000097
427 Ga0068852_100114751
428 Ga0068852_100122301
429 Ga0068852_100429192
430 Ga0068852_100471125
431 Ga0068852_100664226
432 Ga0068859_100023025
433 Ga0068864_100000625
434 Ga0068851_10007082
435 Ga0068851_10048948
436 Ga0068851_10060565
437 Ga0068851_10075055
438 Ga0068863_100001753
439 Ga0068858_100012165
440 Ga0068860_100000689
441 Ga0068862_100023070
442 Ga0075364_10442332
443 Ga0097621_100000349
444 Ga0068871_100002325
445 Ga0097620_100023025
446 Ga0079104_1029024
447 Ga0105251_10000321
448 Ga0105251_10002159
449 Ga0105250_10032148
450 Ga0105240_10000372
451 Ga0105240_10000496
452 Ga0105240_10001856
453 Ga0105240_10064615
454 Ga0105240_10068360
455 Ga0105240_10085557
456 Ga0105240_10127298
457 Ga0105240_10311427
458 Ga0105245_10000486
459 Ga0105247_10002346
460 Ga0105243_10022374
461 Ga0105241_10000026
462 Ga0105241_10000121
463 Ga0105241_10009216
464 Ga0105241_10059096
465 Ga0105241_10186853
466 Ga0105248_10034015
467 Ga0105248_10081067
468 Ga0105237_10000590
469 Ga0105237_10041670
470 Ga0105237_10477611
471 Ga0105237_10482805
472 Ga0105237_10899893
473 Ga0105238_10000197
474 Ga0105238_10000509
475 Ga0105238_10119680
476 Ga0105238_10276290
477 Ga0105249_10120013
478 Ga0105239_10001891
479 Ga0105239_10021514
480 Ga0105239_10052641
481 Ga0105246_10000006
482 Ga0105246_10001192
483 Ga0157373_10701603
484 Ga0157371_10000333
485 Ga0157371_10065246
486 Ga0157370_10000005
487 Ga0157369_10000085
488 Ga0157369_10000430
489 Ga0157369_10016814
490 Ga0157369_10024598
491 Ga0157369_10026044
492 Ga0157369_10140829
493 Ga0157369_10463439
494 Ga0157374_10031721
495 Ga0157374_10182413
496 Ga0157374_10198663
497 Ga0157378_10004251
498 Ga0157378_10018090
499 Ga0157378_10425368
500 Ga0163162_10010079
501 Ga0163162_10080239
502 Ga0163162_10500306
503 Ga0157372_10000217
504 Ga0157372_10009734
505 Ga0157372_10017083
506 Ga0157372_10020181
507 Ga0157372_10082332
508 Ga0157372_10105164
509 Ga0157372_10163132
510 Ga0157372_10210743
511 Ga0157375_11225608
512 Ga0163163_10001161
513 Ga0157377_10060827
514 Ga0157377_10210870
515 Ga0157379_10002312
516 Ga0157379_10224971
517 Ga0157376_10000296
518 Ga0157376_10012770
519 Ga0182006_1008227
520 Ga0163161_10000853
521 Ga0163161_10063024
522 Ga0213874_10100155
523 Ga0209759_1007978
524 Ga0209129_1000392
525 Ga0209676_1000147
526 Ga0209758_1007929
527 Ga0209050_1000062
528 Ga0209051_1000409
529 Ga0207656_10004048
530 Ga0207696_1000016
531 Ga0207713_1000222
532 Ga0207713_1000884
533 Ga0207710_10000487
534 Ga0207680_10219124
535 Ga0207705_10026733
536 Ga0207705_10036415
537 Ga0207654_10000054
538 Ga0207654_10000281
539 Ga0207654_10003128
540 Ga0207654_10109085
541 Ga0207707_10016561
542 Ga0207695_10000080
543 Ga0207695_10000113
544 Ga0207695_10000167
545 Ga0207695_10005013
546 Ga0207695_10037312
547 Ga0207695_10060369
548 Ga0207671_10000065
549 Ga0207671_10000123
550 Ga0207671_10000139
551 Ga0207671_10227416
552 Ga0207671_10414112
553 Ga0207649_10063255
554 Ga0207649_10657902
555 Ga0207652_10109533
556 Ga0207681_10353290
557 Ga0207694_10000248
558 Ga0207694_10000855
559 Ga0207694_10012616
560 Ga0207694_10053280
561 Ga0207694_10166466
562 Ga0207650_10056727
563 Ga0207650_10063539
564 Ga0207687_10000978
565 Ga0207687_10061410
566 Ga0207687_10112060
567 Ga0207700_10154360
568 Ga0207664_10083411
569 Ga0207644_10004420
570 Ga0207709_10094141
571 Ga0207711_10060353
572 Ga0207711_10273081
573 Ga0207689_10000724
574 Ga0207661_10001283
575 Ga0207661_10018246
576 Ga0207661_10192435
577 Ga0207661_10966606
578 Ga0207679_10024591
579 Ga0207667_10006194
580 Ga0207667_10007990
581 Ga0207667_10048192
582 Ga0207667_10153024
583 Ga0207667_10407028
584 Ga0207712_10110215
585 Ga0207640_10020377
586 Ga0207658_10003428
587 Ga0207677_10000143
588 Ga0207677_10085080
589 Ga0207703_10004820
590 Ga0207639_10000088
591 Ga0207639_10061122
592 Ga0207639_10319936
593 Ga0207702_10001334
594 Ga0207702_10002672
595 Ga0207702_10015520
596 Ga0207702_10109911
597 Ga0207702_10197544
598 Ga0207641_10011936
599 Ga0207676_10002595
600 Ga0207674_10000669
601 Ga0207674_10003068
602 Ga0207674_10307226
603 Ga0207698_10000003
604 Ga0207698_10000708
605 Ga0207698_10525140
606 Ga0265356_1010246
607 Ga0265357_1008033
608 Ga0268266_10068745
609 Ga0268266_10098647
610 Ga0268264_10000598
611 Ga0265323_10007390
612 Ga0265338_10004495
613 Ga0265338_10114279
614 Ga0265338_10307429
615 Ga0265324_10075921
616 Ga0265330_10002162
617 Ga0265330_10014322
618 Ga0265339_10000194
619 Ga0265339_10101482
620 Ga0265316_10000352
621 Ga0265316_10056454
622 Ga0265316_10058084
623 Ga0265316_10323321
624 Ga0307408_100000004
625 Ga0316575_10012827
626 Ga0265314_10009910
627 Ga0265314_10110795
628 Ga0265342_10001536
629 Ga0265342_10002441
630 Ga0265342_10082053
631 Ga0307405_10000897
632 Ga0373927_0272039
633 Ga0373937_0377362
634 Ga0373937_0438256
635 Ga0395899_0015555
636 Ga0395901_0010291
637 Ga0395901_0012867
638 Ga0436363_0913429
639 Ga0451851_0085375
640 Ga0439464_0035256
641 Ga0466963_0000494
642 Ga0466967_0029373
643 Ga0495627_000039
644 Ga0495627_000078
645 Ga0495627_037945
646 Ga0495629_0017355
647 Ga0495629_0024210
648 Ga0495607_0017584
649 Ga0495583_0002316
650 Ga0495606_0000054
651 Ga0495610_0001902
652 Ga0495610_0078259
653 Ga0495620_0004313
654 Ga0495632_0029255
655 Ga0495643_0000081
656 Ga0495643_0022213
657 Ga0495648_0001153
658 Ga0495652_0048616
659 Ga0495652_0531857
660 Ga0495654_0003891
661 Ga0495654_0092786
662 Ga0495587_0108134
663 Ga0495633_0008408
664 Ga0495611_0128548
665 Ga0495625_0025897
666 Ga0495625_0157388
667 Ga0495625_0441197
668 Ga0495661_0000505
669 Ga0495613_0066602
670 Ga0495613_0081507
671 Ga0495671_0001437
672 Ga0495649_0000582
673 Ga0495649_0076345
674 Ga0495604_0118324
675 Ga0495683_0000086
676 Ga0495679_000316
677 Ga0495679_000618
678 Ga0495681_0015970
679 Ga0496105_0232622
680 Ga0496110_0750671
681 Ga0496114_0211501
682 Ga0496115_0044591
683 Ga0496117_0000522
684 Ga0496117_0001048
685 Ga0496117_0125341
686 Ga0496118_0000246
687 Ga0496118_0091639
688 Ga0496118_0174125
689 Ga0496119_0000464
690 Ga0496120_0000587
691 Ga0496122_0000888
692 Ga0496123_0000687
693 Ga0496124_0000480
694 Ga0496124_0011604
695 Ga0496124_0041594
696 Ga0496124_0181427
697 Ga0496124_0446288
698 Ga0496125_0000068
699 Ga0496125_0045981
700 Ga0496126_0009252
701 Ga0496126_0019570
702 Ga0495678_036781
703 Ga0501034_1134802
704 Ga0495601_0148368
705 Ga0500644_0093138
706 Ga0500573_0065089
707 Ga0500634_0000085
708 Ga0500634_0000863
709 2599883309
710 2600444695
711 2602012012
712 2735817377
713 2738811450
714 2738898810
715 2739288508
716 2739293820
717 2748019439
718 2819662551
719 2823423655
720 2919503408
721 2926066021
722 2928028130
723 2984558459
724 2984567134
725 2993358225
726 8021625747
727 8021650321
728 8034964775

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04973

NMN_transporter

Nicotinamide mononucleotide transporter

13

191

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qtn-assembly1.cif.gz_B crystal structure of the vitamin b3 transporter pnuc 0.8029 4 181
4qtn-assembly1.cif.gz_B crystal structure of the vitamin b3 transporter pnuc 0.7268 4 181
2gez-assembly1.cif.gz_A crystal structure of potassium-independent plant asparaginase 0.5618 70 129
6w2q-assembly1.cif.gz_A junction 34, dhr53-dhr4 0.5398 4 133
8e12-assembly1.cif.gz_C homotrimeric variant of tctrp9, bgl14 0.5033 52 180
ID Description Score Start End Superfamily
af_A0A0R0F5V1_132_225_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.5799 92 193 1.20.1280.290
af_A0A0R0F5V1_132_225_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.5633 92 193 1.20.1280.290
af_A0A1X7RBT7_30_120_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.5587 89 182 1.20.1280.290
af_O44620_4_91_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.5585 88 182 1.20.1280.290
af_Q550E0_234_487_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5571 80 194 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A511BVH4-F1-model_v4 Nicotinamide riboside transporter PnuC 0.986 1 186 GO:0005886
GO:0034257
AF-A0A850PCL3-F1-model_v4 Nicotinamide riboside transporter PnuC 0.9836 1 184 GO:0005886
GO:0034257
AF-A0A4Y6UK11-F1-model_v4 Nicotinamide riboside transporter PnuC 0.9805 1 187 GO:0005886
GO:0034257
AF-A0A6P1QFZ4-F1-model_v4 deleted 0.9801 1 182
AF-A0A1B4BXJ4-F1-model_v4 deleted 0.9776 1 189

Map