F423385

General Info

Members Datasets Scaffolds Average Seq Length
364 231 728 223

Family's Representative Sequence

Representative Sequence 3300035398|Ga0316574_0390175|Ga0316574_0390175_46_786
Length 246
Sequence MRTTMIMRAAGTITLTIGVRRARAMSTITELARLLQLASPTLPVGAFSYSQGLEAAIEAGVVHDRASAEQWIGELLELSLARMEAPILVRLIEAWRTDDAAGAARWNETFLASRETSELRAETVQMGYSLCALLAQLEDAAPLVAMEEPSFPAAYAYVVARWGIAPQAALVAYLWAWLENQVMAALKAVPLGQTDGQRVLLSLGARLEAITAEVEALEDDDLGACAPGLALLSARHETQYSRLFRS

Samples

Sample ID Description Type Environment
1 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
120 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
121 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
122 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
123 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
124 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
125 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
126 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
136 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
137 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
138 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
139 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
140 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
141 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
142 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
143 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
144 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
145 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
149 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
150 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
151 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
152 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
153 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
158 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
159 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
160 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
163 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
164 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
165 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
166 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
167 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
168 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
169 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
170 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
171 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
172 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
173 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
174 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
175 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
176 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
177 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
178 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
179 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
180 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
181 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
182 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
183 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
184 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
185 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
186 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
187 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
188 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
189 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
190 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
191 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
192 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
193 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
194 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
195 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
196 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
197 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
198 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
203 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
204 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
205 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
212 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
213 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
214 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
215 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
216 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
217 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
221 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
222 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
223 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
224 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
225 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
226 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
227 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
228 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
229 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
230 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
231 639633007 Azoarcus olearius BH72 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.9
Metatranscriptomes 0
Isolates 1.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.2
Nodule 0
Rhizoplane 5.77
Rhizosphere 89.56
Stem 0
Stem Tuber 0
Unclassified 0.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316574_0390175 3300035398 Bacteria 877
2 Ga0065712_10079509 3300005290 Bacteria 3209
3 Ga0070658_10010363 3300005327 Bacteria 7477
4 Ga0070676_10058865 3300005328 Bacteria 2278
5 Ga0070683_100000736 3300005329 Bacteria 23963
6 Ga0070670_100002066 3300005331 Bacteria 16443
7 Ga0070670_100056581 3300005331 Bacteria 3366
8 Ga0070677_10015500 3300005333 Bacteria 2700
9 Ga0068869_100103405 3300005334 Bacteria 2158
10 Ga0070666_10005441 3300005335 Bacteria 7806
11 Ga0070680_100160225 3300005336 Bacteria 1891
12 Ga0068868_100001142 3300005338 Bacteria 18155
13 Ga0070660_100001948 3300005339 Bacteria 14236
14 Ga0070660_100511519 3300005339 Unclassified 999
15 Ga0070661_100001362 3300005344 Bacteria 17076
16 Ga0070661_100121504 3300005344 Bacteria 1957
17 Ga0070668_100018003 3300005347 Bacteria 5300
18 Ga0070675_100002888 3300005354 Bacteria 12956
19 Ga0070671_100000219 3300005355 Bacteria 38310
20 Ga0070674_100123052 3300005356 Bacteria 1923
21 Ga0070673_100008810 3300005364 Bacteria 6736
22 Ga0070659_100019058 3300005366 Bacteria 5189
23 Ga0070659_100040442 3300005366 Bacteria 3643
24 Ga0070659_100327090 3300005366 Bacteria 1282
25 Ga0070667_100285800 3300005367 Bacteria 1482
26 Ga0070667_100353988 3300005367 Bacteria 1330
27 Ga0070705_100340063 3300005440 Bacteria 1090
28 Ga0070663_100184825 3300005455 Bacteria 1619
29 Ga0070678_100000219 3300005456 Bacteria 25787
30 Ga0070662_100244360 3300005457 Bacteria 1440
31 Ga0070681_10031305 3300005458 Bacteria 5341
32 Ga0068867_100013032 3300005459 Bacteria 5884
33 Ga0070706_100109290 3300005467 Bacteria 2573
34 Ga0070707_100250445 3300005468 Bacteria 1724
35 Ga0070698_100464494 3300005471 Bacteria 1202
36 Ga0070698_100495075 3300005471 Bacteria 1160
37 Ga0070684_100040304 3300005535 Bacteria 4021
38 Ga0068853_100043286 3300005539 Bacteria 3852
39 Ga0068853_100469357 3300005539 Bacteria 1185
40 Ga0070672_100000090 3300005543 Bacteria 44222
41 Ga0070693_100088045 3300005547 Bacteria 1866
42 Ga0070665_100070766 3300005548 Bacteria 3495
43 Ga0068855_100839354 3300005563 Bacteria 974
44 Ga0068855_100884554 3300005563 Bacteria 944
45 Ga0070664_100000706 3300005564 Bacteria 25517
46 Ga0070664_100084738 3300005564 Bacteria 2736
47 Ga0068854_100003478 3300005578 Bacteria 9835
48 Ga0070702_100146282 3300005615 Bacteria 1511
49 Ga0068852_100000201 3300005616 Bacteria 40698
50 Ga0068852_100397914 3300005616 Bacteria 1354
51 Ga0068852_100624821 3300005616 Bacteria 1083
52 Ga0068859_100350930 3300005617 Bacteria 1570
53 Ga0068864_100063520 3300005618 Bacteria 3200
54 Ga0068864_100279080 3300005618 Bacteria 1559
55 Ga0068861_100101800 3300005719 Bacteria 2286
56 Ga0068851_10006143 3300005834 Bacteria 5480
57 Ga0068851_10044784 3300005834 Bacteria 2235
58 Ga0068870_10011762 3300005840 Bacteria 4069
59 Ga0068863_100014933 3300005841 Bacteria 7459
60 Ga0068863_100186113 3300005841 Bacteria 1995
61 Ga0068863_100390888 3300005841 Bacteria 1359
62 Ga0068858_100074819 3300005842 Bacteria 3145
63 Ga0068860_100165632 3300005843 Bacteria 2134
64 Ga0068862_100314497 3300005844 Bacteria 1444
65 Ga0070716_100215863 3300006173 Bacteria 1285
66 Ga0075369_10048468 3300006186 Bacteria 1833
67 Ga0075366_10226996 3300006195 Bacteria 1138
68 Ga0097621_100001608 3300006237 Bacteria 15476
69 Ga0097621_100428550 3300006237 Bacteria 1188
70 Ga0068871_100000434 3300006358 Bacteria 28753
71 Ga0068871_100711072 3300006358 Bacteria 921
72 Ga0075428_100010329 3300006844 Bacteria 10361
73 Ga0075434_100515091 3300006871 Bacteria 1217
74 Ga0075429_100003036 3300006880 Bacteria 14225
75 Ga0068865_100203594 3300006881 Bacteria 1538
76 Ga0097620_100350947 3300006931 Bacteria 1570
77 Ga0099794_10073686 3300007265 Bacteria 1676
78 Ga0099794_10095800 3300007265 Bacteria 1477
79 Ga0099795_10138434 3300007788 Bacteria 988
80 Ga0105240_10261280 3300009093 Bacteria 1997
81 Ga0111539_10009509 3300009094 Bacteria 12269
82 Ga0111539_10321565 3300009094 Bacteria 1800
83 Ga0105241_10102386 3300009174 Bacteria 2279
84 Ga0105237_10018064 3300009545 Bacteria 7305
85 Ga0105238_10829989 3300009551 Bacteria 941
86 Ga0105239_10032736 3300010375 Bacteria 5712
87 Ga0157374_10112407 3300013296 Bacteria 2621
88 Ga0157378_10006979 3300013297 Bacteria 9852
89 Ga0163162_10597907 3300013306 Unclassified 1229
90 Ga0157375_10008297 3300013308 Bacteria 9099
91 Ga0157377_10085779 3300014745 Bacteria 1849
92 Ga0157377_10101922 3300014745 Bacteria 1712
93 Ga0157376_10001714 3300014969 Bacteria 14578
94 Ga0157376_11119479 3300014969 Bacteria 814
95 Ga0163161_10076132 3300017792 Bacteria 2463
96 Ga0213876_10257920 3300021384 Bacteria 926
97 Ga0209563_100003 3300025230 Bacteria 1932942
98 Ga0207656_10003373 3300025321 Bacteria 5485
99 Ga0207656_10073371 3300025321 Bacteria 1525
100 Ga0207682_10009505 3300025893 Bacteria 3836
101 Ga0207680_10027276 3300025903 Bacteria 3178
102 Ga0207645_10067300 3300025907 Bacteria 2289
103 Ga0207645_10150024 3300025907 Bacteria 1521
104 Ga0207705_10057225 3300025909 Bacteria 2812
105 Ga0207684_10088966 3300025910 Bacteria 2631
106 Ga0207707_10014168 3300025912 Bacteria 6948
107 Ga0207671_10027018 3300025914 Bacteria 4293
108 Ga0207660_10137475 3300025917 Bacteria 1866
109 Ga0207660_10225020 3300025917 Bacteria 1474
110 Ga0207657_10005710 3300025919 Bacteria 12986
111 Ga0207649_10001985 3300025920 Bacteria 11675
112 Ga0207649_10151164 3300025920 Bacteria 1599
113 Ga0207649_10491914 3300025920 Bacteria 932
114 Ga0207646_10131901 3300025922 Bacteria 2249
115 Ga0207650_10000726 3300025925 Bacteria 25560
116 Ga0207659_10001009 3300025926 Bacteria 16741
117 Ga0207687_10483339 3300025927 Bacteria 1031
118 Ga0207644_10001328 3300025931 Bacteria 15860
119 Ga0207690_10037101 3300025932 Bacteria 3162
120 Ga0207706_10200302 3300025933 Bacteria 1751
121 Ga0207669_10034282 3300025937 Bacteria 2875
122 Ga0207669_10117332 3300025937 Bacteria 1798
123 Ga0207704_10417922 3300025938 Bacteria 1062
124 Ga0207691_10000431 3300025940 Bacteria 41756
125 Ga0207691_10041907 3300025940 Bacteria 4223
126 Ga0207661_10009440 3300025944 Bacteria 6999
127 Ga0207679_10003464 3300025945 Bacteria 9752
128 Ga0207679_10159128 3300025945 Bacteria 1847
129 Ga0207667_10015388 3300025949 Bacteria 8694
130 Ga0207667_10553241 3300025949 Bacteria 1164
131 Ga0207668_10012687 3300025972 Bacteria 5167
132 Ga0207668_10046942 3300025972 Bacteria 2954
133 Ga0207658_10021219 3300025986 Bacteria 4506
134 Ga0207658_10068955 3300025986 Bacteria 2670
135 Ga0207677_10000983 3300026023 Bacteria 15693
136 Ga0207703_10102368 3300026035 Bacteria 2430
137 Ga0207639_10012130 3300026041 Bacteria 5995
138 Ga0207678_10173187 3300026067 Bacteria 1843
139 Ga0207678_10276951 3300026067 Bacteria 1439
140 Ga0207702_10316531 3300026078 Bacteria 1485
141 Ga0207641_10090054 3300026088 Bacteria 2682
142 Ga0207641_10269604 3300026088 Bacteria 1597
143 Ga0207641_10328808 3300026088 Bacteria 1451
144 Ga0207641_10378112 3300026088 Bacteria 1356
145 Ga0207648_10019505 3300026089 Bacteria 6121
146 Ga0207648_10136083 3300026089 Bacteria 2164
147 Ga0207676_10067689 3300026095 Bacteria 2853
148 Ga0207676_10150810 3300026095 Bacteria 2002
149 Ga0207674_11129592 3300026116 Bacteria 753
150 Ga0207675_100023354 3300026118 Bacteria 5751
151 Ga0207675_100055460 3300026118 Bacteria 3697
152 Ga0207683_10000536 3300026121 Bacteria 35159
153 Ga0207683_10756508 3300026121 Bacteria 901
154 Ga0207698_10099237 3300026142 Bacteria 2408
155 Ga0209588_1012345 3300027671 Bacteria 2593
156 Ga0207428_10005264 3300027907 Bacteria 12081
157 Ga0268266_10044374 3300028379 Bacteria 3801
158 Ga0268266_10076283 3300028379 Bacteria 2913
159 Ga0268265_10024024 3300028380 Bacteria 4306
160 Ga0268265_10237119 3300028380 Bacteria 1607
161 Ga0268264_10114999 3300028381 Bacteria 2363
162 Ga0265332_10005048 3300031238 Bacteria 6129
163 Ga0265316_10227854 3300031344 Bacteria 1373
164 Ga0316575_10009477 3300031665 Bacteria 3565
165 Ga0316575_10020449 3300031665 Bacteria 2540
166 Ga0316579_10011623 3300031691 Bacteria 3745
167 Ga0316583_10026740 3300032133 Bacteria 2059
168 Ga0373942_0066042 3300035207 Bacteria 1046
169 Ga0373927_0049773 3300035695 Bacteria 2709
170 Ga0373933_0131395 3300035724 Bacteria 1575
171 Ga0373937_0056489 3300036401 Bacteria 3605
172 Ga0373937_0204254 3300036401 Bacteria 1858
173 Ga0373937_0584874 3300036401 Bacteria 1060
174 Ga0316582_0024434 3300036647 Bacteria 3616
175 Ga0395899_0007987 3300037312 Bacteria 8150
176 Ga0395899_0091268 3300037312 Bacteria 2207
177 Ga0395899_0134092 3300037312 Bacteria 1766
178 Ga0395899_0348926 3300037312 Bacteria 990
179 Ga0395899_0592128 3300037312 Bacteria 707
180 Ga0395900_0011425 3300037418 Bacteria 9087
181 Ga0395900_0028215 3300037418 Bacteria 5749
182 Ga0395900_0036060 3300037418 Bacteria 5096
183 Ga0395900_0065088 3300037418 Bacteria 3744
184 Ga0395900_0187475 3300037418 Bacteria 2099
185 Ga0395900_0271708 3300037418 Bacteria 1689
186 Ga0395898_0037901 3300037466 Bacteria 4779
187 Ga0395898_0076273 3300037466 Bacteria 3237
188 Ga0395898_0200674 3300037466 Bacteria 1904
189 Ga0395898_0216835 3300037466 Bacteria 1825
190 Ga0395898_0523949 3300037466 Bacteria 1127
191 Ga0395905_0106586 3300037471 Bacteria 2631
192 Ga0395905_0304833 3300037471 Bacteria 1480
193 Ga0395905_0604470 3300037471 Bacteria 998
194 Ga0395905_0640756 3300037471 Bacteria 964
195 Ga0316581_0048842 3300037588 Bacteria 1295
196 Ga0395901_0219350 3300038443 Bacteria 1988
197 Ga0395901_0312010 3300038443 Bacteria 1628
198 Ga0395901_0810448 3300038443 Bacteria 924
199 Ga0436365_1767096 3300039437 Bacteria 1716
200 Ga0436360_0546983 3300039438 Bacteria 1893
201 Ga0451853_0422689 3300041512 Unclassified 1056
202 Ga0439450_001146 3300042008 Bacteria 3775
203 Ga0439455_0014898 3300042012 Bacteria 1781
204 Ga0439455_0068310 3300042012 Bacteria 951
205 Ga0439458_0013157 3300042157 Bacteria 1862
206 Ga0451577_0003785 3300042876 Bacteria 16468
207 Ga0451577_0142308 3300042876 Bacteria 2156
208 Ga0451577_0229074 3300042876 Bacteria 1680
209 Ga0466969_0034830 3300044656 Bacteria 2550
210 Ga0466969_0085706 3300044656 Bacteria 1497
211 Ga0466972_0000380 3300044658 Bacteria 23789
212 Ga0466972_0155049 3300044658 Bacteria 1076
213 Ga0453683_0259313 3300044673 Bacteria 1109
214 Ga0466965_0002093 3300044683 Bacteria 8366
215 Ga0466966_0008572 3300044684 Bacteria 6766
216 Ga0466966_0082494 3300044684 Bacteria 2000
217 Ga0466966_0147195 3300044684 Bacteria 1437
218 Ga0466961_0336900 3300044693 Bacteria 919
219 Ga0466964_0002325 3300044706 Bacteria 6742
220 Ga0466964_0129735 3300044706 Bacteria 1146
221 Ga0453684_0356134 3300044712 Bacteria 1649
222 Ga0453684_0549727 3300044712 Bacteria 1272
223 Ga0466968_0001426 3300044735 Bacteria 8574
224 Ga0466957_0048813 3300044842 Bacteria 2572
225 Ga0466957_0181120 3300044842 Bacteria 1376
226 Ga0466960_0031249 3300044901 Bacteria 2456
227 Ga0466960_0550289 3300044901 Bacteria 681
228 Ga0466959_0100736 3300045049 Bacteria 2067
229 Ga0466959_0224316 3300045049 Bacteria 1302
230 Ga0466959_0497201 3300045049 Bacteria 824
231 Ga0451576_0000591 3300045051 Bacteria 76735
232 Ga0451576_0141734 3300045051 Bacteria 2506
233 Ga0466958_0188962 3300045836 Bacteria 1309
234 Ga0466958_0283456 3300045836 Bacteria 1062
235 Ga0466967_0012418 3300045976 Bacteria 6513
236 Ga0466967_0256064 3300045976 Bacteria 1673
237 Ga0495590_0117397 3300046457 Bacteria 952
238 Ga0495591_000051 3300046458 Bacteria 137457
239 Ga0495651_0239007 3300046462 Bacteria 1247
240 Ga0495650_0005257 3300046471 Bacteria 8479
241 Ga0495580_0176902 3300046472 Bacteria 1474
242 Ga0495605_0000130 3300046474 Bacteria 98652
243 Ga0495605_0057460 3300046474 Bacteria 1872
244 Ga0495584_0000024 3300046491 Bacteria 117259
245 Ga0495584_0000164 3300046491 Bacteria 46886
246 Ga0495584_0003779 3300046491 Bacteria 8252
247 Ga0495584_0021499 3300046491 Bacteria 3276
248 Ga0495585_0002536 3300046492 Bacteria 12973
249 Ga0495585_0012871 3300046492 Bacteria 4917
250 Ga0495596_0002915 3300046500 Bacteria 8898
251 Ga0495596_0009424 3300046500 Bacteria 4294
252 Ga0495596_0123183 3300046500 Bacteria 1006
253 Ga0495607_0000715 3300046501 Bacteria 32055
254 Ga0495607_0005576 3300046501 Bacteria 8978
255 Ga0495607_0010021 3300046501 Bacteria 6384
256 Ga0495607_0027169 3300046501 Bacteria 3543
257 Ga0495607_0208609 3300046501 Bacteria 962
258 Ga0495583_0000738 3300046506 Bacteria 41545
259 Ga0495583_0041224 3300046506 Bacteria 2164
260 Ga0495610_0014285 3300046512 Bacteria 4673
261 Ga0495616_0002668 3300046513 Bacteria 11703
262 Ga0495616_0049972 3300046513 Bacteria 2093
263 Ga0495631_0006992 3300046518 Bacteria 5775
264 Ga0495637_0000009 3300046520 Bacteria 402028
265 Ga0495643_0001833 3300046522 Bacteria 18075
266 Ga0495643_0018411 3300046522 Bacteria 4060
267 Ga0495643_0043773 3300046522 Bacteria 2434
268 Ga0495643_0103219 3300046522 Bacteria 1458
269 Ga0495644_0076530 3300046523 Bacteria 1260
270 Ga0495648_0008758 3300046524 Bacteria 7921
271 Ga0495648_0009013 3300046524 Bacteria 7789
272 Ga0495642_0000791 3300046528 Bacteria 15345
273 Ga0495642_0002396 3300046528 Bacteria 7636
274 Ga0495642_0094907 3300046528 Bacteria 1265
275 Ga0495586_0019746 3300046535 Bacteria 3588
276 Ga0495587_0175836 3300046536 Bacteria 1215
277 Ga0495609_0000001 3300046538 Bacteria 1060094
278 Ga0495609_0005956 3300046538 Bacteria 6302
279 Ga0495609_0011462 3300046538 Bacteria 4221
280 Ga0495621_0032016 3300046539 Bacteria 1807
281 Ga0495633_0011581 3300046558 Bacteria 4746
282 Ga0495656_0092004 3300046615 Bacteria 1388
283 Ga0495656_0126951 3300046615 Bacteria 1210
284 Ga0495611_0000013 3300046648 Bacteria 130500
285 Ga0495625_0087758 3300046660 Bacteria 2156
286 Ga0495659_0269942 3300046664 Bacteria 713
287 Ga0495661_0000023 3300046665 Bacteria 189053
288 Ga0495661_0009805 3300046665 Bacteria 6553
289 Ga0495661_0010079 3300046665 Bacteria 6462
290 Ga0495588_0000041 3300046674 Bacteria 377896
291 Ga0495669_0055327 3300046684 Bacteria 1786
292 Ga0495669_0125005 3300046684 Bacteria 1208
293 Ga0495671_0298329 3300046692 Bacteria 775
294 Ga0495649_0000062 3300046694 Bacteria 96596
295 Ga0495649_0096817 3300046694 Bacteria 1570
296 Ga0495589_0000027 3300046794 Bacteria 181084
297 Ga0495589_0000034 3300046794 Bacteria 162449
298 Ga0495589_0049262 3300046794 Bacteria 2084
299 Ga0495600_0314011 3300046809 Bacteria 987
300 Ga0495660_0000132 3300046810 Bacteria 81849
301 Ga0495660_0008925 3300046810 Bacteria 5857
302 Ga0495660_0031643 3300046810 Bacteria 2974
303 Ga0495660_0057434 3300046810 Bacteria 2099
304 Ga0495672_0000055 3300047320 Bacteria 229428
305 Ga0495672_0000231 3300047320 Bacteria 79748
306 Ga0495672_0011034 3300047320 Bacteria 6399
307 Ga0495683_0000222 3300047323 Bacteria 53417
308 Ga0495687_000012 3300047443 Bacteria 391586
309 Ga0495687_000023 3300047443 Bacteria 317750
310 Ga0495687_000027 3300047443 Bacteria 299689
311 Ga0495687_000535 3300047443 Bacteria 45436
312 Ga0495677_0000001 3300047445 Bacteria 715000
313 Ga0495677_0000216 3300047445 Bacteria 26250
314 Ga0495677_0013621 3300047445 Bacteria 2960
315 Ga0495686_0003619 3300047472 Bacteria 13255
316 Ga0495626_0000037 3300048091 Bacteria 178573
317 Ga0495626_0003279 3300048091 Bacteria 10448
318 Ga0495626_0011356 3300048091 Bacteria 4716
319 Ga0495626_0071233 3300048091 Bacteria 1562
320 Ga0495626_0177039 3300048091 Bacteria 886
321 Ga0496101_0053258 3300048904 Bacteria 2919
322 Ga0496101_0545903 3300048904 Bacteria 916
323 Ga0496102_0104274 3300048905 Bacteria 2637
324 Ga0496102_0109846 3300048905 Bacteria 2570
325 Ga0496102_0166547 3300048905 Bacteria 2074
326 Ga0496102_0209691 3300048905 Bacteria 1837
327 Ga0496104_0207985 3300048907 Bacteria 1869
328 Ga0496105_0114046 3300048908 Bacteria 2229
329 Ga0496106_0026845 3300048909 Bacteria 4288
330 Ga0496106_0217309 3300048909 Bacteria 1524
331 Ga0496106_0338222 3300048909 Bacteria 1209
332 Ga0496107_0165792 3300048910 Bacteria 1638
333 Ga0496107_0257586 3300048910 Bacteria 1298
334 Ga0496108_0001774 3300048911 Bacteria 17187
335 Ga0496109_0011704 3300048912 Bacteria 7546
336 Ga0496110_0003126 3300048913 Bacteria 12576
337 Ga0496110_0258230 3300048913 Bacteria 1586
338 Ga0496111_0042555 3300048914 Bacteria 3262
339 Ga0496113_0031785 3300048916 Bacteria 3833
340 Ga0496114_0080912 3300048917 Bacteria 2743
341 Ga0496114_0440462 3300048917 Bacteria 1154
342 Ga0496122_0003090 3300048925 Bacteria 22393
343 Ga0496122_0137724 3300048925 Bacteria 1534
344 Ga0496123_0002837 3300048926 Bacteria 20496
345 Ga0496125_0186551 3300048928 Bacteria 1375
346 Ga0495678_000025 3300049459 Bacteria 227891
347 Ga0501080_0103244 3300049742 Bacteria 2644
348 nmdc:mga09592_9747_c1 3300050508 Bacteria 7803
349 nmdc:mga0qj67_325332_c1 3300050509 Bacteria 1244
350 nmdc:mga08y16_154340_c1 3300050511 Bacteria 2386
351 nmdc:mga08y16_4233_c1 3300050511 Bacteria 14974
352 nmdc:mga0n895_852498_c1 3300050512 Bacteria 899
353 nmdc:mga0a205_483830_c1 3300050515 Bacteria 1096
354 nmdc:mga0sz30_53386_c1 3300050516 Bacteria 1717
355 Ga0495619_0278519 3300053085 Bacteria 1159
356 Ga0500641_0073190 3300053096 Bacteria 1445
357 Ga0500607_037414 3300053121 Bacteria 2645
358 Ga0500636_0000720 3300053177 Bacteria 17792
359 Ga0500637_0001657 3300053178 Bacteria 9584
360 Ga0501082_0452468 3300060353 Bacteria 1122
361 2574431204 2574179768 Bacteria 4907129
362 2809142941 2808606418 Bacteria 6724496
363 2891634401 2891633521 Bacteria 4602265
364 639788668 639633007 Bacteria 4376040
365 Ga0316574_0390175
366 Ga0065712_10079509
367 Ga0070658_10010363
368 Ga0070676_10058865
369 Ga0070683_100000736
370 Ga0070670_100002066
371 Ga0070670_100056581
372 Ga0070677_10015500
373 Ga0068869_100103405
374 Ga0070666_10005441
375 Ga0070680_100160225
376 Ga0068868_100001142
377 Ga0070660_100001948
378 Ga0070660_100511519
379 Ga0070661_100001362
380 Ga0070661_100121504
381 Ga0070668_100018003
382 Ga0070675_100002888
383 Ga0070671_100000219
384 Ga0070674_100123052
385 Ga0070673_100008810
386 Ga0070659_100019058
387 Ga0070659_100040442
388 Ga0070659_100327090
389 Ga0070667_100285800
390 Ga0070667_100353988
391 Ga0070705_100340063
392 Ga0070663_100184825
393 Ga0070678_100000219
394 Ga0070662_100244360
395 Ga0070681_10031305
396 Ga0068867_100013032
397 Ga0070706_100109290
398 Ga0070707_100250445
399 Ga0070698_100464494
400 Ga0070698_100495075
401 Ga0070684_100040304
402 Ga0068853_100043286
403 Ga0068853_100469357
404 Ga0070672_100000090
405 Ga0070693_100088045
406 Ga0070665_100070766
407 Ga0068855_100839354
408 Ga0068855_100884554
409 Ga0070664_100000706
410 Ga0070664_100084738
411 Ga0068854_100003478
412 Ga0070702_100146282
413 Ga0068852_100000201
414 Ga0068852_100397914
415 Ga0068852_100624821
416 Ga0068859_100350930
417 Ga0068864_100063520
418 Ga0068864_100279080
419 Ga0068861_100101800
420 Ga0068851_10006143
421 Ga0068851_10044784
422 Ga0068870_10011762
423 Ga0068863_100014933
424 Ga0068863_100186113
425 Ga0068863_100390888
426 Ga0068858_100074819
427 Ga0068860_100165632
428 Ga0068862_100314497
429 Ga0070716_100215863
430 Ga0075369_10048468
431 Ga0075366_10226996
432 Ga0097621_100001608
433 Ga0097621_100428550
434 Ga0068871_100000434
435 Ga0068871_100711072
436 Ga0075428_100010329
437 Ga0075434_100515091
438 Ga0075429_100003036
439 Ga0068865_100203594
440 Ga0097620_100350947
441 Ga0099794_10073686
442 Ga0099794_10095800
443 Ga0099795_10138434
444 Ga0105240_10261280
445 Ga0111539_10009509
446 Ga0111539_10321565
447 Ga0105241_10102386
448 Ga0105237_10018064
449 Ga0105238_10829989
450 Ga0105239_10032736
451 Ga0157374_10112407
452 Ga0157378_10006979
453 Ga0163162_10597907
454 Ga0157375_10008297
455 Ga0157377_10085779
456 Ga0157377_10101922
457 Ga0157376_10001714
458 Ga0157376_11119479
459 Ga0163161_10076132
460 Ga0213876_10257920
461 Ga0209563_100003
462 Ga0207656_10003373
463 Ga0207656_10073371
464 Ga0207682_10009505
465 Ga0207680_10027276
466 Ga0207645_10067300
467 Ga0207645_10150024
468 Ga0207705_10057225
469 Ga0207684_10088966
470 Ga0207707_10014168
471 Ga0207671_10027018
472 Ga0207660_10137475
473 Ga0207660_10225020
474 Ga0207657_10005710
475 Ga0207649_10001985
476 Ga0207649_10151164
477 Ga0207649_10491914
478 Ga0207646_10131901
479 Ga0207650_10000726
480 Ga0207659_10001009
481 Ga0207687_10483339
482 Ga0207644_10001328
483 Ga0207690_10037101
484 Ga0207706_10200302
485 Ga0207669_10034282
486 Ga0207669_10117332
487 Ga0207704_10417922
488 Ga0207691_10000431
489 Ga0207691_10041907
490 Ga0207661_10009440
491 Ga0207679_10003464
492 Ga0207679_10159128
493 Ga0207667_10015388
494 Ga0207667_10553241
495 Ga0207668_10012687
496 Ga0207668_10046942
497 Ga0207658_10021219
498 Ga0207658_10068955
499 Ga0207677_10000983
500 Ga0207703_10102368
501 Ga0207639_10012130
502 Ga0207678_10173187
503 Ga0207678_10276951
504 Ga0207702_10316531
505 Ga0207641_10090054
506 Ga0207641_10269604
507 Ga0207641_10328808
508 Ga0207641_10378112
509 Ga0207648_10019505
510 Ga0207648_10136083
511 Ga0207676_10067689
512 Ga0207676_10150810
513 Ga0207674_11129592
514 Ga0207675_100023354
515 Ga0207675_100055460
516 Ga0207683_10000536
517 Ga0207683_10756508
518 Ga0207698_10099237
519 Ga0209588_1012345
520 Ga0207428_10005264
521 Ga0268266_10044374
522 Ga0268266_10076283
523 Ga0268265_10024024
524 Ga0268265_10237119
525 Ga0268264_10114999
526 Ga0265332_10005048
527 Ga0265316_10227854
528 Ga0316575_10009477
529 Ga0316575_10020449
530 Ga0316579_10011623
531 Ga0316583_10026740
532 Ga0373942_0066042
533 Ga0373927_0049773
534 Ga0373933_0131395
535 Ga0373937_0056489
536 Ga0373937_0204254
537 Ga0373937_0584874
538 Ga0316582_0024434
539 Ga0395899_0007987
540 Ga0395899_0091268
541 Ga0395899_0134092
542 Ga0395899_0348926
543 Ga0395899_0592128
544 Ga0395900_0011425
545 Ga0395900_0028215
546 Ga0395900_0036060
547 Ga0395900_0065088
548 Ga0395900_0187475
549 Ga0395900_0271708
550 Ga0395898_0037901
551 Ga0395898_0076273
552 Ga0395898_0200674
553 Ga0395898_0216835
554 Ga0395898_0523949
555 Ga0395905_0106586
556 Ga0395905_0304833
557 Ga0395905_0604470
558 Ga0395905_0640756
559 Ga0316581_0048842
560 Ga0395901_0219350
561 Ga0395901_0312010
562 Ga0395901_0810448
563 Ga0436365_1767096
564 Ga0436360_0546983
565 Ga0451853_0422689
566 Ga0439450_001146
567 Ga0439455_0014898
568 Ga0439455_0068310
569 Ga0439458_0013157
570 Ga0451577_0003785
571 Ga0451577_0142308
572 Ga0451577_0229074
573 Ga0466969_0034830
574 Ga0466969_0085706
575 Ga0466972_0000380
576 Ga0466972_0155049
577 Ga0453683_0259313
578 Ga0466965_0002093
579 Ga0466966_0008572
580 Ga0466966_0082494
581 Ga0466966_0147195
582 Ga0466961_0336900
583 Ga0466964_0002325
584 Ga0466964_0129735
585 Ga0453684_0356134
586 Ga0453684_0549727
587 Ga0466968_0001426
588 Ga0466957_0048813
589 Ga0466957_0181120
590 Ga0466960_0031249
591 Ga0466960_0550289
592 Ga0466959_0100736
593 Ga0466959_0224316
594 Ga0466959_0497201
595 Ga0451576_0000591
596 Ga0451576_0141734
597 Ga0466958_0188962
598 Ga0466958_0283456
599 Ga0466967_0012418
600 Ga0466967_0256064
601 Ga0495590_0117397
602 Ga0495591_000051
603 Ga0495651_0239007
604 Ga0495650_0005257
605 Ga0495580_0176902
606 Ga0495605_0000130
607 Ga0495605_0057460
608 Ga0495584_0000024
609 Ga0495584_0000164
610 Ga0495584_0003779
611 Ga0495584_0021499
612 Ga0495585_0002536
613 Ga0495585_0012871
614 Ga0495596_0002915
615 Ga0495596_0009424
616 Ga0495596_0123183
617 Ga0495607_0000715
618 Ga0495607_0005576
619 Ga0495607_0010021
620 Ga0495607_0027169
621 Ga0495607_0208609
622 Ga0495583_0000738
623 Ga0495583_0041224
624 Ga0495610_0014285
625 Ga0495616_0002668
626 Ga0495616_0049972
627 Ga0495631_0006992
628 Ga0495637_0000009
629 Ga0495643_0001833
630 Ga0495643_0018411
631 Ga0495643_0043773
632 Ga0495643_0103219
633 Ga0495644_0076530
634 Ga0495648_0008758
635 Ga0495648_0009013
636 Ga0495642_0000791
637 Ga0495642_0002396
638 Ga0495642_0094907
639 Ga0495586_0019746
640 Ga0495587_0175836
641 Ga0495609_0000001
642 Ga0495609_0005956
643 Ga0495609_0011462
644 Ga0495621_0032016
645 Ga0495633_0011581
646 Ga0495656_0092004
647 Ga0495656_0126951
648 Ga0495611_0000013
649 Ga0495625_0087758
650 Ga0495659_0269942
651 Ga0495661_0000023
652 Ga0495661_0009805
653 Ga0495661_0010079
654 Ga0495588_0000041
655 Ga0495669_0055327
656 Ga0495669_0125005
657 Ga0495671_0298329
658 Ga0495649_0000062
659 Ga0495649_0096817
660 Ga0495589_0000027
661 Ga0495589_0000034
662 Ga0495589_0049262
663 Ga0495600_0314011
664 Ga0495660_0000132
665 Ga0495660_0008925
666 Ga0495660_0031643
667 Ga0495660_0057434
668 Ga0495672_0000055
669 Ga0495672_0000231
670 Ga0495672_0011034
671 Ga0495683_0000222
672 Ga0495687_000012
673 Ga0495687_000023
674 Ga0495687_000027
675 Ga0495687_000535
676 Ga0495677_0000001
677 Ga0495677_0000216
678 Ga0495677_0013621
679 Ga0495686_0003619
680 Ga0495626_0000037
681 Ga0495626_0003279
682 Ga0495626_0011356
683 Ga0495626_0071233
684 Ga0495626_0177039
685 Ga0496101_0053258
686 Ga0496101_0545903
687 Ga0496102_0104274
688 Ga0496102_0109846
689 Ga0496102_0166547
690 Ga0496102_0209691
691 Ga0496104_0207985
692 Ga0496105_0114046
693 Ga0496106_0026845
694 Ga0496106_0217309
695 Ga0496106_0338222
696 Ga0496107_0165792
697 Ga0496107_0257586
698 Ga0496108_0001774
699 Ga0496109_0011704
700 Ga0496110_0003126
701 Ga0496110_0258230
702 Ga0496111_0042555
703 Ga0496113_0031785
704 Ga0496114_0080912
705 Ga0496114_0440462
706 Ga0496122_0003090
707 Ga0496122_0137724
708 Ga0496123_0002837
709 Ga0496125_0186551
710 Ga0495678_000025
711 Ga0501080_0103244
712 nmdc:mga09592_9747_c1
713 nmdc:mga0qj67_325332_c1
714 nmdc:mga08y16_154340_c1
715 nmdc:mga08y16_4233_c1
716 nmdc:mga0n895_852498_c1
717 nmdc:mga0a205_483830_c1
718 nmdc:mga0sz30_53386_c1
719 Ga0495619_0278519
720 Ga0500641_0073190
721 Ga0500607_037414
722 Ga0500636_0000720
723 Ga0500637_0001657
724 Ga0501082_0452468
725 2574431204
726 2809142941
727 2891634401
728 639788668

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01730

UreF

UreF

62

204

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jc4-assembly2.cif.gz_C crystal structure of the urease accessory protein uref from klebsiella pneumoniae 0.9101 6 204
3o1q-assembly1.cif.gz_A native crystal structure of helicobacter pylori urease accessory protein uref 0.9012 10 209
3o1q-assembly2.cif.gz_B native crystal structure of helicobacter pylori urease accessory protein uref 0.8989 10 205
3cxn-assembly2.cif.gz_C structure of the urease accessory protein uref from helicobacter pylori 0.8963 10 209
4hi0-assembly1.cif.gz_C crystal structure of helicobacter pylori urease accessory protein uref/h/g complex 0.8926 10 229
ID Description Score Start End Superfamily
af_Q2G2K7_3_207_1.10.4190.10 Mainly Alpha;Orthogonal Bundle;Urease accessory protein UreF;Urease accessory protein UreF 0.9209 7 205 1.10.4190.10
3cxnC00 Mainly Alpha;Orthogonal Bundle;Urease accessory protein UreF;Urease accessory protein UreF 0.9049 10 209 1.10.4190.10
af_Q2G2K7_3_207_1.10.4190.10 Mainly Alpha;Orthogonal Bundle;Urease accessory protein UreF;Urease accessory protein UreF 0.8913 7 205 1.10.4190.10
3sf5C00 Mainly Alpha;Orthogonal Bundle;Urease accessory protein UreF;Urease accessory protein UreF 0.8862 10 229 1.10.4190.10
3cxnC00 Mainly Alpha;Orthogonal Bundle;Urease accessory protein UreF;Urease accessory protein UreF 0.8666 10 209 1.10.4190.10
ID Description Score Start End GO Terms
AF-A0A0K1W3W6-F1-model_v4 UreF (EC 3.5.1.5) 0.9473 26 182 GO:0009039
GO:0016151
AF-F3FLI9-F1-model_v4 Urease accessory protein UreF 0.9425 5 192 GO:0016151
AF-A0A6L3NFR1-F1-model_v4 Urease accessory protein UreF 0.94 1 195 GO:0016151
AF-A0A839VMH5-F1-model_v4 Urease accessory protein 0.936 54 229 GO:0016151
AF-A0A0K1W3W6-F1-model_v4 UreF (EC 3.5.1.5) 0.9358 26 182 GO:0009039
GO:0016151

Map