F423447

General Info

Members Datasets Scaffolds Average Seq Length
364 239 728 155

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0000039|Ga0496102_0000039_159674_160195
Length 173
Sequence LPGAGAPEAVADRLDWAAMASVEVQGVEGMQAVIGQEIGPSEWRPVTQDDINAFAELSGDHQWIHVDVERAKNESPFGTTIAHGNLTLSLVDGFRGELIDATGFALGVNYGWDKIRFPAPVPVDSKVRARAEVVSVEEKGGGWYQVVTRFTIEVEGSDKPCFVGDSVTRVMAP

Samples

Sample ID Description Type Environment
1 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
117 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
118 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
119 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
120 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
121 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
122 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
123 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
124 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
125 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
126 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
130 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
131 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
132 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
133 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
134 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
137 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
138 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
139 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
140 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
141 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
142 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
143 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
144 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
145 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
146 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
147 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
148 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
149 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
150 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
151 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
152 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
153 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
154 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
155 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
156 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
157 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
158 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
159 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
160 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
161 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
162 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
163 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
164 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
165 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
166 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
169 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
170 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
171 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
172 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
173 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
174 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
175 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
176 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
177 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
178 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
179 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
180 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
181 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
182 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
183 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
196 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
211 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
212 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
213 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
214 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
215 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
216 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
217 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
218 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
219 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
220 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
224 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
225 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
226 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
230 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
231 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
232 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
233 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
234 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
235 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
236 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
237 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
238 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
239 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.02
Nodule 0
Rhizoplane 9.62
Rhizosphere 85.44
Stem 0
Stem Tuber 0
Unclassified 0.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496102_0000039 3300048905 Bacteria 198306
2 JGI24740J21852_10005942 3300001979 Bacteria 5110
3 JGI24034J26672_10000104 3300002239 Bacteria 13847
4 Ga0070683_100003871 3300005329 Bacteria 12238
5 Ga0070683_100019566 3300005329 Bacteria 6015
6 Ga0070683_100070694 3300005329 Bacteria 3256
7 Ga0070670_100070148 3300005331 Bacteria 3009
8 Ga0070677_10000004 3300005333 Bacteria 81101
9 Ga0070666_10076243 3300005335 Bacteria 2287
10 Ga0070691_10192855 3300005341 Bacteria 1067
11 Ga0070661_100000023 3300005344 Bacteria 123104
12 Ga0070692_10209913 3300005345 Bacteria 1145
13 Ga0070668_100025413 3300005347 Bacteria 4490
14 Ga0070675_100000101 3300005354 Bacteria 50140
15 Ga0070671_101021113 3300005355 Bacteria 725
16 Ga0070674_100000008 3300005356 Bacteria 143844
17 Ga0070674_100019260 3300005356 Bacteria 4333
18 Ga0070673_100003790 3300005364 Bacteria 9488
19 Ga0070688_100002163 3300005365 Bacteria 9906
20 Ga0070667_100006509 3300005367 Bacteria 9712
21 Ga0070667_100176137 3300005367 Bacteria 1890
22 Ga0070714_100853365 3300005435 Bacteria 883
23 Ga0070714_101442416 3300005435 Bacteria 672
24 Ga0070701_10519251 3300005438 Bacteria 776
25 Ga0070694_100903855 3300005444 Bacteria 729
26 Ga0070678_100002401 3300005456 Bacteria 10255
27 Ga0070681_10008992 3300005458 Bacteria 9822
28 Ga0068867_100003840 3300005459 Bacteria 10558
29 Ga0068867_100087137 3300005459 Bacteria 2363
30 Ga0070685_10000127 3300005466 Bacteria 48844
31 Ga0070679_100000388 3300005530 Bacteria 37491
32 Ga0070684_100029222 3300005535 Bacteria 4670
33 Ga0070684_100142518 3300005535 Bacteria 2168
34 Ga0068853_100019448 3300005539 Bacteria 5630
35 Ga0070672_100000027 3300005543 Bacteria 67016
36 Ga0070686_100433092 3300005544 Bacteria 1007
37 Ga0070665_100000106 3300005548 Bacteria 157315
38 Ga0070665_100071875 3300005548 Bacteria 3467
39 Ga0070665_100106782 3300005548 Bacteria 2802
40 Ga0070704_100184774 3300005549 Bacteria 1670
41 Ga0070704_100301423 3300005549 Bacteria 1335
42 Ga0070664_100221268 3300005564 Bacteria 1694
43 Ga0068857_100927813 3300005577 Bacteria 836
44 Ga0068854_100038451 3300005578 Bacteria 3365
45 Ga0068856_100000577 3300005614 Bacteria 40018
46 Ga0068856_100001983 3300005614 Bacteria 21342
47 Ga0068856_100201243 3300005614 Bacteria 2006
48 Ga0068852_100000156 3300005616 Bacteria 45492
49 Ga0068852_100045492 3300005616 Bacteria 3734
50 Ga0068866_10000031 3300005718 Bacteria 56943
51 Ga0068851_10012772 3300005834 Bacteria 3967
52 Ga0068863_100341471 3300005841 Bacteria 1457
53 Ga0068858_100000216 3300005842 Bacteria 62188
54 Ga0068858_100002989 3300005842 Bacteria 16955
55 Ga0068858_100073944 3300005842 Bacteria 3164
56 Ga0068860_100022494 3300005843 Bacteria 6097
57 Ga0068862_100000973 3300005844 Bacteria 27530
58 Ga0081455_10094209 3300005937 Bacteria 2419
59 Ga0081539_10017380 3300005985 Bacteria 5054
60 Ga0075365_10045437 3300006038 Bacteria 2881
61 Ga0075368_10075457 3300006042 Bacteria 1367
62 Ga0075364_10012976 3300006051 Bacteria 5113
63 Ga0070712_100153811 3300006175 Bacteria 1769
64 Ga0097621_100075314 3300006237 Bacteria 2797
65 Ga0068871_100180037 3300006358 Bacteria 1816
66 Ga0068871_100210104 3300006358 Bacteria 1683
67 Ga0075430_101431747 3300006846 Bacteria 568
68 Ga0075431_100374469 3300006847 Bacteria 1429
69 Ga0105250_10272521 3300009092 Bacteria 727
70 Ga0105245_10000016 3300009098 Bacteria 204372
71 Ga0105245_10002273 3300009098 Bacteria 17380
72 Ga0105245_10002516 3300009098 Bacteria 16526
73 Ga0105245_10041043 3300009098 Bacteria 4124
74 Ga0105247_10000393 3300009101 Bacteria 37140
75 Ga0105247_10026982 3300009101 Bacteria 3472
76 Ga0114129_10550437 3300009147 Bacteria 1500
77 Ga0114129_10933648 3300009147 Bacteria 1097
78 Ga0105243_10061927 3300009148 Bacteria 2994
79 Ga0105243_10559038 3300009148 Bacteria 1094
80 Ga0105242_10000893 3300009176 Bacteria 23179
81 Ga0105242_10016681 3300009176 Bacteria 5713
82 Ga0105242_10284841 3300009176 Bacteria 1502
83 Ga0105242_11590899 3300009176 Bacteria 687
84 Ga0105249_10000068 3300009553 Bacteria 148594
85 Ga0105249_10073937 3300009553 Bacteria 3154
86 Ga0105033_103659 3300009986 Bacteria 1298
87 Ga0105239_10503225 3300010375 Bacteria 1377
88 Ga0105239_11094898 3300010375 Bacteria 917
89 Ga0105246_10560908 3300011119 Bacteria 980
90 Ga0157373_10912814 3300013100 Bacteria 652
91 Ga0157370_10819718 3300013104 Bacteria 846
92 Ga0157369_10000110 3300013105 Bacteria 115514
93 Ga0157378_10012156 3300013297 Bacteria 7538
94 Ga0163162_10385727 3300013306 Bacteria 1534
95 Ga0163162_12096304 3300013306 Bacteria 649
96 Ga0157375_10000112 3300013308 Bacteria 79146
97 Ga0157375_10013392 3300013308 Bacteria 7296
98 Ga0163163_11562365 3300014325 Bacteria 721
99 Ga0157380_10000093 3300014326 Bacteria 48915
100 Ga0157380_10000408 3300014326 Bacteria 26076
101 Ga0157377_11047363 3300014745 Bacteria 621
102 Ga0157379_10011898 3300014968 Bacteria 7603
103 Ga0157379_10081052 3300014968 Bacteria 2907
104 Ga0157379_10913928 3300014968 Bacteria 833
105 Ga0163161_10168060 3300017792 Bacteria 1676
106 Ga0163161_10432419 3300017792 Bacteria 1061
107 Ga0206356_10271379 3300020070 Bacteria 4405
108 Ga0207656_10001033 3300025321 Bacteria 9088
109 Ga0207682_10000031 3300025893 Bacteria 57806
110 Ga0207642_10057799 3300025899 Bacteria 1786
111 Ga0207710_10001665 3300025900 Bacteria 10816
112 Ga0207710_10017087 3300025900 Bacteria 3075
113 Ga0207680_10002602 3300025903 Bacteria 8417
114 Ga0207684_11037080 3300025910 Bacteria 685
115 Ga0207707_10081222 3300025912 Bacteria 2830
116 Ga0207693_10007557 3300025915 Bacteria 8931
117 Ga0207660_10165358 3300025917 Bacteria 1709
118 Ga0207649_10000063 3300025920 Bacteria 96360
119 Ga0207652_10000349 3300025921 Bacteria 47896
120 Ga0207650_10169990 3300025925 Bacteria 1732
121 Ga0207659_10000010 3300025926 Bacteria 286639
122 Ga0207687_10000007 3300025927 Bacteria 604185
123 Ga0207687_10000018 3300025927 Bacteria 236159
124 Ga0207687_10000177 3300025927 Bacteria 42164
125 Ga0207687_11268819 3300025927 Bacteria 633
126 Ga0207664_10502348 3300025929 Bacteria 1086
127 Ga0207644_10633404 3300025931 Bacteria 889
128 Ga0207690_10431558 3300025932 Bacteria 1056
129 Ga0207686_10000033 3300025934 Bacteria 143602
130 Ga0207686_10000505 3300025934 Bacteria 25546
131 Ga0207686_10025200 3300025934 Bacteria 3456
132 Ga0207686_10210749 3300025934 Unclassified 1397
133 Ga0207709_10033982 3300025935 Bacteria 3000
134 Ga0207709_11045128 3300025935 Bacteria 669
135 Ga0207670_10567530 3300025936 Bacteria 929
136 Ga0207669_10000004 3300025937 Bacteria 196828
137 Ga0207704_10000236 3300025938 Bacteria 27317
138 Ga0207711_10410955 3300025941 Bacteria 1258
139 Ga0207661_10000095 3300025944 Bacteria 56458
140 Ga0207661_10001779 3300025944 Bacteria 14743
141 Ga0207661_10010418 3300025944 Bacteria 6691
142 Ga0207661_10050985 3300025944 Bacteria 3300
143 Ga0207679_10495576 3300025945 Bacteria 1089
144 Ga0207667_10719070 3300025949 Bacteria 1000
145 Ga0207651_10000460 3300025960 Bacteria 17106
146 Ga0207712_10000007 3300025961 Bacteria 539589
147 Ga0207712_10188583 3300025961 Bacteria 1626
148 Ga0207712_10394225 3300025961 Bacteria 1162
149 Ga0207668_10013681 3300025972 Bacteria 5006
150 Ga0207640_10034680 3300025981 Bacteria 3151
151 Ga0207658_10102136 3300025986 Bacteria 2248
152 Ga0207703_10000023 3300026035 Bacteria 222018
153 Ga0207703_10000040 3300026035 Bacteria 168191
154 Ga0207703_10248322 3300026035 Bacteria 1603
155 Ga0207639_10046572 3300026041 Bacteria 3273
156 Ga0207702_10000060 3300026078 Bacteria 125473
157 Ga0207702_10005811 3300026078 Bacteria 10731
158 Ga0207702_10164937 3300026078 Bacteria 2026
159 Ga0207702_10212290 3300026078 Unclassified 1800
160 Ga0207641_10355352 3300026088 Bacteria 1397
161 Ga0207648_10000766 3300026089 Bacteria 36117
162 Ga0207648_10098838 3300026089 Bacteria 2555
163 Ga0207648_10460910 3300026089 Bacteria 1158
164 Ga0207683_10111693 3300026121 Bacteria 2447
165 Ga0207698_10000012 3300026142 Bacteria 260061
166 Ga0207698_10014991 3300026142 Bacteria 5175
167 Ga0268266_10000047 3300028379 Bacteria 310996
168 Ga0268266_10022322 3300028379 Bacteria 5394
169 Ga0268266_10036577 3300028379 Bacteria 4180
170 Ga0268266_10077557 3300028379 Bacteria 2889
171 Ga0268266_10253266 3300028379 Bacteria 1629
172 Ga0268266_11667964 3300028379 Bacteria 613
173 Ga0268265_10001017 3300028380 Bacteria 25271
174 Ga0268265_11291589 3300028380 Bacteria 730
175 Ga0268264_10162342 3300028381 Bacteria 2014
176 Ga0265319_1000025 3300028563 Bacteria 142639
177 Ga0265338_10000473 3300028800 Bacteria 71777
178 Ga0307511_10064940 3300030521 Bacteria 2738
179 Ga0265325_10045392 3300031241 Bacteria 2283
180 Ga0265331_10042078 3300031250 Bacteria 2217
181 Ga0265327_10300504 3300031251 Bacteria 707
182 Ga0307415_100074049 3300032126 Bacteria 2405
183 Ga0316583_10094205 3300032133 Bacteria 1044
184 Ga0316583_10199743 3300032133 Bacteria 694
185 Ga0373957_0254598 3300035120 Bacteria 739
186 Ga0373955_0658970 3300035172 Bacteria 642
187 Ga0373933_0216470 3300035724 Bacteria 1228
188 Ga0373937_0342227 3300036401 Bacteria 1416
189 Ga0395900_0444789 3300037418 Bacteria 1253
190 Ga0436364_1239672 3300037853 Bacteria 705
191 Ga0451833_0680149 3300041491 Bacteria 1384
192 Ga0451839_0851673 3300041496 Bacteria 3544
193 Ga0451853_3015507 3300041512 Bacteria 1495
194 Ga0451853_3469497 3300041512 Bacteria 1485
195 Ga0466963_0089795 3300044694 Bacteria 2091
196 Ga0466957_0011141 3300044842 Bacteria 5178
197 Ga0466967_0000065 3300045976 Bacteria 39018
198 Ga0495592_0000036 3300046454 Bacteria 125461
199 Ga0495592_0098344 3300046454 Bacteria 2089
200 Ga0495592_0229994 3300046454 Bacteria 1235
201 Ga0495603_0009565 3300046455 Bacteria 5858
202 Ga0495590_0341302 3300046457 Bacteria 568
203 Ga0495629_0001591 3300046459 Bacteria 17859
204 Ga0495629_0002306 3300046459 Bacteria 14717
205 Ga0495638_0011100 3300046460 Bacteria 6227
206 Ga0495641_0000044 3300046461 Bacteria 77415
207 Ga0495641_0089564 3300046461 Bacteria 1375
208 Ga0495641_0136955 3300046461 Bacteria 1093
209 Ga0495651_0056753 3300046462 Bacteria 3007
210 Ga0495653_0065815 3300046463 Bacteria 2727
211 Ga0495662_0012288 3300046476 Bacteria 4181
212 Ga0495664_0899471 3300046477 Bacteria 518
213 Ga0495596_0183127 3300046500 Bacteria 814
214 Ga0495606_0000752 3300046507 Bacteria 50099
215 Ga0495620_0000144 3300046515 Bacteria 58204
216 Ga0495628_0001219 3300046516 Bacteria 23555
217 Ga0495628_0002850 3300046516 Bacteria 15497
218 Ga0495628_0063493 3300046516 Bacteria 2893
219 Ga0495630_0000056 3300046517 Bacteria 91477
220 Ga0495630_0004181 3300046517 Bacteria 10108
221 Ga0495630_0020497 3300046517 Bacteria 4875
222 Ga0495637_0184269 3300046520 Bacteria 773
223 Ga0495644_0000985 3300046523 Bacteria 11830
224 Ga0495652_0000019 3300046529 Bacteria 190248
225 Ga0495652_0658865 3300046529 Bacteria 708
226 Ga0495640_0009074 3300046533 Bacteria 7758
227 Ga0495640_0009622 3300046533 Bacteria 7518
228 Ga0495587_0033929 3300046536 Bacteria 3079
229 Ga0495598_0016264 3300046537 Bacteria 1895
230 Ga0495645_0184023 3300046543 Bacteria 1429
231 Ga0495645_0426074 3300046543 Bacteria 841
232 Ga0495667_0133595 3300046559 Bacteria 1600
233 Ga0495656_0339121 3300046615 Bacteria 777
234 Ga0495634_0094136 3300046642 Bacteria 1942
235 Ga0495634_0233676 3300046642 Bacteria 1130
236 Ga0495625_0000766 3300046660 Bacteria 44778
237 Ga0495635_0000016 3300046663 Bacteria 214088
238 Ga0495635_0010919 3300046663 Bacteria 6367
239 Ga0495588_0000165 3300046674 Bacteria 85841
240 Ga0495647_0000008 3300046681 Bacteria 101193
241 Ga0495647_0000511 3300046681 Bacteria 11317
242 Ga0495647_0056561 3300046681 Bacteria 1538
243 Ga0495658_0003907 3300046683 Bacteria 7364
244 Ga0495669_0000088 3300046684 Bacteria 61314
245 Ga0495669_0403423 3300046684 Bacteria 663
246 Ga0495613_0000203 3300046689 Bacteria 58232
247 Ga0495613_0040417 3300046689 Bacteria 3456
248 Ga0495613_0179642 3300046689 Bacteria 1499
249 Ga0495624_0000267 3300046690 Bacteria 41318
250 Ga0495624_0465935 3300046690 Bacteria 757
251 Ga0495649_0000554 3300046694 Bacteria 31688
252 Ga0495600_0232695 3300046809 Bacteria 1176
253 Ga0495604_0000019 3300047317 Bacteria 175064
254 Ga0495674_0000251 3300047319 Bacteria 45351
255 Ga0495672_0067403 3300047320 Bacteria 2039
256 Ga0495672_0226053 3300047320 Bacteria 921
257 Ga0495676_0000299 3300047321 Bacteria 40098
258 Ga0495676_0002794 3300047321 Bacteria 15713
259 Ga0495676_0028453 3300047321 Bacteria 4771
260 Ga0495676_0053466 3300047321 Bacteria 3218
261 Ga0495676_0071460 3300047321 Bacteria 2668
262 Ga0495676_0146628 3300047321 Bacteria 1685
263 Ga0495680_0003349 3300047322 Bacteria 15838
264 Ga0495680_0072561 3300047322 Bacteria 2618
265 Ga0495680_0202820 3300047322 Bacteria 1422
266 Ga0495675_0011895 3300047444 Bacteria 5469
267 Ga0495679_014302 3300047446 Bacteria 2946
268 Ga0495686_0083069 3300047472 Bacteria 1954
269 Ga0495593_0022777 3300047673 Bacteria 3485
270 Ga0495593_0183209 3300047673 Bacteria 1054
271 Ga0495602_0069036 3300048088 Bacteria 3032
272 Ga0495602_0268488 3300048088 Bacteria 1262
273 Ga0496100_0000002 3300048903 Bacteria 489057
274 Ga0496100_0000018 3300048903 Bacteria 162451
275 Ga0496101_0000001 3300048904 Bacteria 489057
276 Ga0496101_0000062 3300048904 Bacteria 126595
277 Ga0496102_0107249 3300048905 Bacteria 2601
278 Ga0496102_0775855 3300048905 Bacteria 881
279 Ga0496103_0000008 3300048906 Bacteria 340474
280 Ga0496103_0123816 3300048906 Bacteria 1648
281 Ga0496104_0000009 3300048907 Bacteria 488055
282 Ga0496105_0000027 3300048908 Bacteria 148197
283 Ga0496106_0000098 3300048909 Bacteria 66098
284 Ga0496106_0000145 3300048909 Bacteria 52447
285 Ga0496107_0000006 3300048910 Bacteria 258746
286 Ga0496107_0000013 3300048910 Bacteria 178284
287 Ga0496107_0646248 3300048910 Bacteria 780
288 Ga0496108_0000062 3300048911 Bacteria 122391
289 Ga0496108_0001785 3300048911 Bacteria 17141
290 Ga0496108_0001921 3300048911 Bacteria 16645
291 Ga0496108_0002120 3300048911 Bacteria 15892
292 Ga0496109_0000007 3300048912 Bacteria 247554
293 Ga0496109_0000168 3300048912 Bacteria 64462
294 Ga0496109_0003727 3300048912 Bacteria 12737
295 Ga0496109_0159050 3300048912 Bacteria 2116
296 Ga0496110_0005580 3300048913 Bacteria 9877
297 Ga0496110_0208823 3300048913 Bacteria 1775
298 Ga0496110_0557756 3300048913 Bacteria 1041
299 Ga0496111_0034618 3300048914 Bacteria 3607
300 Ga0496111_0637852 3300048914 Bacteria 778
301 Ga0496113_0004279 3300048916 Bacteria 8748
302 Ga0496114_0000014 3300048917 Bacteria 297902
303 Ga0496114_0036910 3300048917 Bacteria 4040
304 Ga0496114_0610730 3300048917 Bacteria 961
305 Ga0496115_0000003 3300048918 Bacteria 354994
306 Ga0496115_0000125 3300048918 Bacteria 69936
307 Ga0496116_0251226 3300048919 Bacteria 880
308 Ga0501031_0372047 3300049568 Bacteria 924
309 Ga0501032_0079729 3300049569 Bacteria 2179
310 Ga0501033_0037099 3300049570 Bacteria 3649
311 Ga0501034_0488046 3300049571 Bacteria 1147
312 Ga0501036_0623693 3300049572 Bacteria 893
313 Ga0501037_0147619 3300049573 Bacteria 1681
314 Ga0501038_0519694 3300049574 Bacteria 908
315 Ga0501039_0263914 3300049575 Bacteria 1353
316 Ga0501039_1006808 3300049575 Bacteria 647
317 Ga0501040_0119344 3300049576 Bacteria 1850
318 Ga0501040_0519663 3300049576 Bacteria 858
319 Ga0501042_0016287 3300049578 Bacteria 5102
320 Ga0501042_0169040 3300049578 Bacteria 1578
321 Ga0501043_0248210 3300049579 Bacteria 1372
322 Ga0501046_0433476 3300049580 Bacteria 946
323 Ga0501047_0582467 3300049581 Bacteria 941
324 Ga0501048_0057489 3300049582 Bacteria 2759
325 Ga0501048_0567343 3300049582 Bacteria 814
326 Ga0501068_0080902 3300049584 Bacteria 1994
327 Ga0501068_0460255 3300049584 Bacteria 823
328 Ga0501069_0420241 3300049585 Bacteria 792
329 Ga0501070_0004059 3300049586 Bacteria 12581
330 Ga0501070_0393511 3300049586 Bacteria 1121
331 Ga0501071_0286749 3300049587 Bacteria 1246
332 Ga0501072_0088574 3300049588 Bacteria 2456
333 Ga0501073_0320979 3300049589 Bacteria 1069
334 Ga0501073_0614409 3300049589 Bacteria 750
335 Ga0501074_0746071 3300049590 Bacteria 690
336 Ga0501075_0036263 3300049591 Bacteria 3680
337 Ga0501076_0170789 3300049592 Bacteria 1772
338 Ga0501079_0967876 3300049741 Bacteria 670
339 Ga0501080_0024675 3300049742 Bacteria 5576
340 Ga0501035_0009143 3300049822 Bacteria 9215
341 Ga0501044_0011985 3300049823 Bacteria 9392
342 Ga0501045_0021708 3300049824 Bacteria 4595
343 nmdc:mga00v17_22597_c1 3300050491 Bacteria 3630
344 nmdc:mga0yw44_126845_c1 3300050492 Bacteria 1649
345 nmdc:mga0yw44_7714_c1 3300050492 Bacteria 5313
346 nmdc:mga04h51_116590_c1 3300050495 Bacteria 990
347 nmdc:mga05p37_445709_c1 3300050507 Bacteria 1500
348 nmdc:mga05p37_493983_c1 3300050507 Bacteria 1406
349 nmdc:mga06r32_1033331_c1 3300050510 Bacteria 773
350 nmdc:mga08y16_246485_c1 3300050511 Unclassified 1846
351 Ga0495601_0000326 3300053077 Bacteria 25282
352 Ga0495612_0000915 3300053078 Bacteria 12062
353 Ga0495612_0009906 3300053078 Bacteria 3860
354 Ga0495612_0144758 3300053078 Bacteria 1032
355 Ga0495655_0000001 3300053083 Bacteria 419518
356 Ga0495595_0000172 3300053084 Bacteria 25608
357 Ga0495619_0000021 3300053085 Bacteria 187095
358 Ga0495619_0000589 3300053085 Bacteria 24114
359 Ga0495619_0001139 3300053085 Bacteria 17465
360 Ga0500566_0009974 3300053094 Bacteria 5608
361 Ga0500641_0040526 3300053096 Bacteria 1881
362 Ga0500614_000324 3300053123 Bacteria 12378
363 Ga0500628_000010 3300053129 Bacteria 122210
364 Ga0501082_0921127 3300060353 Bacteria 764
365 Ga0496102_0000039
366 JGI24740J21852_10005942
367 JGI24034J26672_10000104
368 Ga0070683_100003871
369 Ga0070683_100019566
370 Ga0070683_100070694
371 Ga0070670_100070148
372 Ga0070677_10000004
373 Ga0070666_10076243
374 Ga0070691_10192855
375 Ga0070661_100000023
376 Ga0070692_10209913
377 Ga0070668_100025413
378 Ga0070675_100000101
379 Ga0070671_101021113
380 Ga0070674_100000008
381 Ga0070674_100019260
382 Ga0070673_100003790
383 Ga0070688_100002163
384 Ga0070667_100006509
385 Ga0070667_100176137
386 Ga0070714_100853365
387 Ga0070714_101442416
388 Ga0070701_10519251
389 Ga0070694_100903855
390 Ga0070678_100002401
391 Ga0070681_10008992
392 Ga0068867_100003840
393 Ga0068867_100087137
394 Ga0070685_10000127
395 Ga0070679_100000388
396 Ga0070684_100029222
397 Ga0070684_100142518
398 Ga0068853_100019448
399 Ga0070672_100000027
400 Ga0070686_100433092
401 Ga0070665_100000106
402 Ga0070665_100071875
403 Ga0070665_100106782
404 Ga0070704_100184774
405 Ga0070704_100301423
406 Ga0070664_100221268
407 Ga0068857_100927813
408 Ga0068854_100038451
409 Ga0068856_100000577
410 Ga0068856_100001983
411 Ga0068856_100201243
412 Ga0068852_100000156
413 Ga0068852_100045492
414 Ga0068866_10000031
415 Ga0068851_10012772
416 Ga0068863_100341471
417 Ga0068858_100000216
418 Ga0068858_100002989
419 Ga0068858_100073944
420 Ga0068860_100022494
421 Ga0068862_100000973
422 Ga0081455_10094209
423 Ga0081539_10017380
424 Ga0075365_10045437
425 Ga0075368_10075457
426 Ga0075364_10012976
427 Ga0070712_100153811
428 Ga0097621_100075314
429 Ga0068871_100180037
430 Ga0068871_100210104
431 Ga0075430_101431747
432 Ga0075431_100374469
433 Ga0105250_10272521
434 Ga0105245_10000016
435 Ga0105245_10002273
436 Ga0105245_10002516
437 Ga0105245_10041043
438 Ga0105247_10000393
439 Ga0105247_10026982
440 Ga0114129_10550437
441 Ga0114129_10933648
442 Ga0105243_10061927
443 Ga0105243_10559038
444 Ga0105242_10000893
445 Ga0105242_10016681
446 Ga0105242_10284841
447 Ga0105242_11590899
448 Ga0105249_10000068
449 Ga0105249_10073937
450 Ga0105033_103659
451 Ga0105239_10503225
452 Ga0105239_11094898
453 Ga0105246_10560908
454 Ga0157373_10912814
455 Ga0157370_10819718
456 Ga0157369_10000110
457 Ga0157378_10012156
458 Ga0163162_10385727
459 Ga0163162_12096304
460 Ga0157375_10000112
461 Ga0157375_10013392
462 Ga0163163_11562365
463 Ga0157380_10000093
464 Ga0157380_10000408
465 Ga0157377_11047363
466 Ga0157379_10011898
467 Ga0157379_10081052
468 Ga0157379_10913928
469 Ga0163161_10168060
470 Ga0163161_10432419
471 Ga0206356_10271379
472 Ga0207656_10001033
473 Ga0207682_10000031
474 Ga0207642_10057799
475 Ga0207710_10001665
476 Ga0207710_10017087
477 Ga0207680_10002602
478 Ga0207684_11037080
479 Ga0207707_10081222
480 Ga0207693_10007557
481 Ga0207660_10165358
482 Ga0207649_10000063
483 Ga0207652_10000349
484 Ga0207650_10169990
485 Ga0207659_10000010
486 Ga0207687_10000007
487 Ga0207687_10000018
488 Ga0207687_10000177
489 Ga0207687_11268819
490 Ga0207664_10502348
491 Ga0207644_10633404
492 Ga0207690_10431558
493 Ga0207686_10000033
494 Ga0207686_10000505
495 Ga0207686_10025200
496 Ga0207686_10210749
497 Ga0207709_10033982
498 Ga0207709_11045128
499 Ga0207670_10567530
500 Ga0207669_10000004
501 Ga0207704_10000236
502 Ga0207711_10410955
503 Ga0207661_10000095
504 Ga0207661_10001779
505 Ga0207661_10010418
506 Ga0207661_10050985
507 Ga0207679_10495576
508 Ga0207667_10719070
509 Ga0207651_10000460
510 Ga0207712_10000007
511 Ga0207712_10188583
512 Ga0207712_10394225
513 Ga0207668_10013681
514 Ga0207640_10034680
515 Ga0207658_10102136
516 Ga0207703_10000023
517 Ga0207703_10000040
518 Ga0207703_10248322
519 Ga0207639_10046572
520 Ga0207702_10000060
521 Ga0207702_10005811
522 Ga0207702_10164937
523 Ga0207702_10212290
524 Ga0207641_10355352
525 Ga0207648_10000766
526 Ga0207648_10098838
527 Ga0207648_10460910
528 Ga0207683_10111693
529 Ga0207698_10000012
530 Ga0207698_10014991
531 Ga0268266_10000047
532 Ga0268266_10022322
533 Ga0268266_10036577
534 Ga0268266_10077557
535 Ga0268266_10253266
536 Ga0268266_11667964
537 Ga0268265_10001017
538 Ga0268265_11291589
539 Ga0268264_10162342
540 Ga0265319_1000025
541 Ga0265338_10000473
542 Ga0307511_10064940
543 Ga0265325_10045392
544 Ga0265331_10042078
545 Ga0265327_10300504
546 Ga0307415_100074049
547 Ga0316583_10094205
548 Ga0316583_10199743
549 Ga0373957_0254598
550 Ga0373955_0658970
551 Ga0373933_0216470
552 Ga0373937_0342227
553 Ga0395900_0444789
554 Ga0436364_1239672
555 Ga0451833_0680149
556 Ga0451839_0851673
557 Ga0451853_3015507
558 Ga0451853_3469497
559 Ga0466963_0089795
560 Ga0466957_0011141
561 Ga0466967_0000065
562 Ga0495592_0000036
563 Ga0495592_0098344
564 Ga0495592_0229994
565 Ga0495603_0009565
566 Ga0495590_0341302
567 Ga0495629_0001591
568 Ga0495629_0002306
569 Ga0495638_0011100
570 Ga0495641_0000044
571 Ga0495641_0089564
572 Ga0495641_0136955
573 Ga0495651_0056753
574 Ga0495653_0065815
575 Ga0495662_0012288
576 Ga0495664_0899471
577 Ga0495596_0183127
578 Ga0495606_0000752
579 Ga0495620_0000144
580 Ga0495628_0001219
581 Ga0495628_0002850
582 Ga0495628_0063493
583 Ga0495630_0000056
584 Ga0495630_0004181
585 Ga0495630_0020497
586 Ga0495637_0184269
587 Ga0495644_0000985
588 Ga0495652_0000019
589 Ga0495652_0658865
590 Ga0495640_0009074
591 Ga0495640_0009622
592 Ga0495587_0033929
593 Ga0495598_0016264
594 Ga0495645_0184023
595 Ga0495645_0426074
596 Ga0495667_0133595
597 Ga0495656_0339121
598 Ga0495634_0094136
599 Ga0495634_0233676
600 Ga0495625_0000766
601 Ga0495635_0000016
602 Ga0495635_0010919
603 Ga0495588_0000165
604 Ga0495647_0000008
605 Ga0495647_0000511
606 Ga0495647_0056561
607 Ga0495658_0003907
608 Ga0495669_0000088
609 Ga0495669_0403423
610 Ga0495613_0000203
611 Ga0495613_0040417
612 Ga0495613_0179642
613 Ga0495624_0000267
614 Ga0495624_0465935
615 Ga0495649_0000554
616 Ga0495600_0232695
617 Ga0495604_0000019
618 Ga0495674_0000251
619 Ga0495672_0067403
620 Ga0495672_0226053
621 Ga0495676_0000299
622 Ga0495676_0002794
623 Ga0495676_0028453
624 Ga0495676_0053466
625 Ga0495676_0071460
626 Ga0495676_0146628
627 Ga0495680_0003349
628 Ga0495680_0072561
629 Ga0495680_0202820
630 Ga0495675_0011895
631 Ga0495679_014302
632 Ga0495686_0083069
633 Ga0495593_0022777
634 Ga0495593_0183209
635 Ga0495602_0069036
636 Ga0495602_0268488
637 Ga0496100_0000002
638 Ga0496100_0000018
639 Ga0496101_0000001
640 Ga0496101_0000062
641 Ga0496102_0107249
642 Ga0496102_0775855
643 Ga0496103_0000008
644 Ga0496103_0123816
645 Ga0496104_0000009
646 Ga0496105_0000027
647 Ga0496106_0000098
648 Ga0496106_0000145
649 Ga0496107_0000006
650 Ga0496107_0000013
651 Ga0496107_0646248
652 Ga0496108_0000062
653 Ga0496108_0001785
654 Ga0496108_0001921
655 Ga0496108_0002120
656 Ga0496109_0000007
657 Ga0496109_0000168
658 Ga0496109_0003727
659 Ga0496109_0159050
660 Ga0496110_0005580
661 Ga0496110_0208823
662 Ga0496110_0557756
663 Ga0496111_0034618
664 Ga0496111_0637852
665 Ga0496113_0004279
666 Ga0496114_0000014
667 Ga0496114_0036910
668 Ga0496114_0610730
669 Ga0496115_0000003
670 Ga0496115_0000125
671 Ga0496116_0251226
672 Ga0501031_0372047
673 Ga0501032_0079729
674 Ga0501033_0037099
675 Ga0501034_0488046
676 Ga0501036_0623693
677 Ga0501037_0147619
678 Ga0501038_0519694
679 Ga0501039_0263914
680 Ga0501039_1006808
681 Ga0501040_0119344
682 Ga0501040_0519663
683 Ga0501042_0016287
684 Ga0501042_0169040
685 Ga0501043_0248210
686 Ga0501046_0433476
687 Ga0501047_0582467
688 Ga0501048_0057489
689 Ga0501048_0567343
690 Ga0501068_0080902
691 Ga0501068_0460255
692 Ga0501069_0420241
693 Ga0501070_0004059
694 Ga0501070_0393511
695 Ga0501071_0286749
696 Ga0501072_0088574
697 Ga0501073_0320979
698 Ga0501073_0614409
699 Ga0501074_0746071
700 Ga0501075_0036263
701 Ga0501076_0170789
702 Ga0501079_0967876
703 Ga0501080_0024675
704 Ga0501035_0009143
705 Ga0501044_0011985
706 Ga0501045_0021708
707 nmdc:mga00v17_22597_c1
708 nmdc:mga0yw44_126845_c1
709 nmdc:mga0yw44_7714_c1
710 nmdc:mga04h51_116590_c1
711 nmdc:mga05p37_445709_c1
712 nmdc:mga05p37_493983_c1
713 nmdc:mga06r32_1033331_c1
714 nmdc:mga08y16_246485_c1
715 Ga0495601_0000326
716 Ga0495612_0000915
717 Ga0495612_0009906
718 Ga0495612_0144758
719 Ga0495655_0000001
720 Ga0495595_0000172
721 Ga0495619_0000021
722 Ga0495619_0000589
723 Ga0495619_0001139
724 Ga0500566_0009974
725 Ga0500641_0040526
726 Ga0500614_000324
727 Ga0500628_000010
728 Ga0501082_0921127

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01575

MaoC_dehydratas

MaoC like domain

29

155

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2c2i-assembly1.cif.gz_B structure and function of rv0130, a conserved hypothetical protein from m.tuberculosis 0.9366 2 142
2c2i-assembly1.cif.gz_B structure and function of rv0130, a conserved hypothetical protein from m.tuberculosis 0.8883 2 142
4ffu-assembly2.cif.gz_K crystal structure of putative maoc-like (monoamine oxidase-like) protein, similar to nodn from sinorhizo bium meliloti 1021 0.8659 9 139
4e3e-assembly1.cif.gz_A crystal structure of putative maoc domain protein dehydratase from chloroflexus aurantiacus j-10-fl 0.8508 5 144
1q6w-assembly2.cif.gz_C x-ray structure of monoamine oxidase regulatory protein from archaeoglobus fulgius 0.8492 5 145
ID Description Score Start End Superfamily
af_B0G197_51_201_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9581 1 141 3.10.129.10
2c2iB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9353 2 142 3.10.129.10
af_B0G197_51_201_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9139 1 141 3.10.129.10
af_I6Y9H2_24_180_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8739 5 143 3.10.129.10
4ffuK00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8626 9 139 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A538IFD0-F1-model_v4 MaoC family dehydratase 0.997 3 144
AF-A0A7V9GS93-F1-model_v4 MaoC family dehydratase 0.9927 3 144
AF-A0A2T2ZNJ6-F1-model_v4 Dehydratase 0.9823 2 142
AF-A0A1A2D8V3-F1-model_v4 Dehydratase 0.9811 2 142
AF-A0A1R0UQA5-F1-model_v4 Dehydratase 0.9809 2 142

Map