F423448

General Info

Members Datasets Scaffolds Average Seq Length
364 225 728 174

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0116898|Ga0496104_0116898_490_1047
Length 185
Sequence MRLSSDVSEVMADRPFNVLFLCTGNSARSILAEAILNKLGAGKFRAYSAGSQPKERIHPETIQLLQGLGYDTSGLRSKSWGEFAKPGAPHLDFVFTVCDNAAAEACPVWPGQPMTAHWGVPDPAQATGSPAEIGLAFKDAYRMLHQRIGIFTALPLRSLDQLSLQRRLQDIGRMQGAAAKASEPS

Samples

Sample ID Description Type Environment
1 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
52 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
101 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
102 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
103 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
104 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
105 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
106 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
107 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
108 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
109 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
110 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
112 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
113 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
114 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
115 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
116 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
117 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
118 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
119 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
120 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
121 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
122 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
123 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
124 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
125 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
126 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
128 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
129 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
134 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
135 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
138 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
139 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
142 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
143 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
144 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
145 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
146 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
147 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
148 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
149 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
150 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
151 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
152 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
153 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
154 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
155 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
156 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
157 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
158 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
159 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
160 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
161 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
162 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
163 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
164 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
165 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
166 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
167 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
168 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
169 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
170 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
171 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
172 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
173 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
176 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
177 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
178 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
179 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
180 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
181 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
182 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
183 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
203 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
204 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
205 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
206 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
207 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
208 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
209 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
210 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
211 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
212 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
213 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
217 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
220 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
221 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
222 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
223 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
224 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
225 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.45
Metatranscriptomes 0.55
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.77
Nodule 0
Rhizoplane 14.84
Rhizosphere 78.57
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496104_0116898 3300048907 Bacteria 2559
2 JGI25406J46586_10023712 3300003203 Bacteria 2422
3 Ga0070670_100563936 3300005331 Bacteria 1017
4 Ga0070682_100046473 3300005337 Bacteria 2694
5 Ga0068868_100072094 3300005338 Bacteria 2755
6 Ga0070687_100143966 3300005343 Bacteria 1391
7 Ga0070661_100208919 3300005344 Bacteria 1494
8 Ga0070671_100481437 3300005355 Bacteria 1066
9 Ga0070674_100100727 3300005356 Bacteria 2104
10 Ga0070688_100051564 3300005365 Bacteria 2567
11 Ga0070709_10147615 3300005434 Bacteria 1622
12 Ga0070714_101002715 3300005435 Bacteria 813
13 Ga0070713_100000923 3300005436 Bacteria 18738
14 Ga0070710_10027268 3300005437 Bacteria 3044
15 Ga0070711_100011070 3300005439 Bacteria 5597
16 Ga0070711_100315587 3300005439 Bacteria 1247
17 Ga0070663_100039645 3300005455 Bacteria 3293
18 Ga0070678_100065354 3300005456 Bacteria 2700
19 Ga0070662_100646252 3300005457 Bacteria 892
20 Ga0070681_10230479 3300005458 Bacteria 1767
21 Ga0070706_100725626 3300005467 Bacteria 921
22 Ga0070698_101466736 3300005471 Bacteria 633
23 Ga0070699_100220461 3300005518 Bacteria 1690
24 Ga0070679_100435825 3300005530 Bacteria 1255
25 Ga0070679_100454019 3300005530 Bacteria 1226
26 Ga0070684_100096208 3300005535 Bacteria 2639
27 Ga0070684_100516838 3300005535 Bacteria 1106
28 Ga0070693_100053361 3300005547 Bacteria 2321
29 Ga0070693_100495940 3300005547 Bacteria 865
30 Ga0070665_100064056 3300005548 Bacteria 3686
31 Ga0070665_100779400 3300005548 Bacteria 969
32 Ga0070664_100155230 3300005564 Bacteria 2022
33 Ga0070702_100003770 3300005615 Bacteria 6843
34 Ga0068859_101653921 3300005617 Bacteria 707
35 Ga0068864_100492282 3300005618 Bacteria 1178
36 Ga0068858_100054706 3300005842 Bacteria 3690
37 Ga0068862_100644728 3300005844 Bacteria 1021
38 Ga0081539_10001543 3300005985 Bacteria 38502
39 Ga0070717_10141074 3300006028 Bacteria 2078
40 Ga0075363_100626137 3300006048 Bacteria 646
41 Ga0075364_10014489 3300006051 Bacteria 4873
42 Ga0075364_10039104 3300006051 Bacteria 3074
43 Ga0070715_10002518 3300006163 Bacteria 5646
44 Ga0070716_100004152 3300006173 Bacteria 6879
45 Ga0070712_100013258 3300006175 Bacteria 5263
46 Ga0070712_100100241 3300006175 Bacteria 2139
47 Ga0070712_100198200 3300006175 Bacteria 1575
48 Ga0075362_10080107 3300006177 Bacteria 1504
49 Ga0075362_10197510 3300006177 Bacteria 978
50 Ga0075367_10263525 3300006178 Bacteria 1082
51 Ga0075369_10013588 3300006186 Bacteria 3236
52 Ga0075366_10182903 3300006195 Bacteria 1273
53 Ga0097621_100006628 3300006237 Bacteria 8228
54 Ga0068871_100006454 3300006358 Bacteria 8299
55 Ga0068871_100174634 3300006358 Bacteria 1844
56 Ga0075433_10126702 3300006852 Bacteria 2267
57 Ga0075433_10318637 3300006852 Bacteria 1376
58 Ga0075434_100096529 3300006871 Bacteria 2961
59 Ga0075434_100141659 3300006871 Bacteria 2425
60 Ga0075434_100423457 3300006871 Bacteria 1352
61 Ga0068865_100092177 3300006881 Bacteria 2201
62 Ga0097620_100812177 3300006931 Bacteria 1022
63 Ga0097620_101653643 3300006931 Bacteria 707
64 Ga0075435_100037053 3300007076 Bacteria 3881
65 Ga0075435_100111482 3300007076 Bacteria 2276
66 Ga0099795_10086650 3300007788 Bacteria 1207
67 Ga0105251_10084715 3300009011 Bacteria 1462
68 Ga0111539_10226284 3300009094 Bacteria 2178
69 Ga0111539_10396615 3300009094 Bacteria 1607
70 Ga0105245_10075199 3300009098 Bacteria 3075
71 Ga0114129_10275155 3300009147 Bacteria 2251
72 Ga0105243_10989341 3300009148 Bacteria 843
73 Ga0105242_10182118 3300009176 Bacteria 1854
74 Ga0105242_10354469 3300009176 Bacteria 1356
75 Ga0105238_10154592 3300009551 Bacteria 2269
76 Ga0105239_10273385 3300010375 Bacteria 1901
77 Ga0105246_10019389 3300011119 Bacteria 4345
78 Ga0157339_1005452 3300012505 Bacteria 1004
79 Ga0157378_10019818 3300013297 Bacteria 5914
80 Ga0157378_10447329 3300013297 Bacteria 1282
81 Ga0163162_10019721 3300013306 Bacteria 6621
82 Ga0157375_10166503 3300013308 Bacteria 2349
83 Ga0157375_10190306 3300013308 Bacteria 2206
84 Ga0163163_10014823 3300014325 Bacteria 7178
85 Ga0163163_10129576 3300014325 Bacteria 2562
86 Ga0163163_10181214 3300014325 Bacteria 2154
87 Ga0182008_10135533 3300014497 Bacteria 1230
88 Ga0157379_10156614 3300014968 Bacteria 2055
89 Ga0157379_10833430 3300014968 Bacteria 872
90 Ga0157376_10027383 3300014969 Bacteria 4517
91 Ga0163161_10057061 3300017792 Bacteria 2837
92 Ga0163161_10309418 3300017792 Bacteria 1246
93 Ga0207713_1107827 3300025735 Bacteria 951
94 Ga0207692_10001856 3300025898 Bacteria 8035
95 Ga0207642_10108251 3300025899 Bacteria 1410
96 Ga0207710_10032194 3300025900 Bacteria 2297
97 Ga0207685_10000848 3300025905 Bacteria 5735
98 Ga0207699_10557200 3300025906 Bacteria 832
99 Ga0207684_10547817 3300025910 Bacteria 990
100 Ga0207693_10012093 3300025915 Bacteria 6978
101 Ga0207693_10022117 3300025915 Bacteria 5055
102 Ga0207693_10234792 3300025915 Bacteria 1440
103 Ga0207693_10323919 3300025915 Bacteria 1206
104 Ga0207693_11228906 3300025915 Bacteria 564
105 Ga0207663_10178809 3300025916 Bacteria 1513
106 Ga0207652_10790225 3300025921 Bacteria 843
107 Ga0207694_10212943 3300025924 Bacteria 1574
108 Ga0207700_10002289 3300025928 Bacteria 10987
109 Ga0207644_10023350 3300025931 Bacteria 4235
110 Ga0207706_10357250 3300025933 Bacteria 1270
111 Ga0207686_10400070 3300025934 Bacteria 1046
112 Ga0207704_10018360 3300025938 Bacteria 3649
113 Ga0207665_10000223 3300025939 Bacteria 38647
114 Ga0207689_10081901 3300025942 Bacteria 2653
115 Ga0207679_10162348 3300025945 Bacteria 1830
116 Ga0207679_10182287 3300025945 Bacteria 1738
117 Ga0207677_10061693 3300026023 Bacteria 2597
118 Ga0207677_10091784 3300026023 Bacteria 2210
119 Ga0207678_10019073 3300026067 Bacteria 6021
120 Ga0207678_10077002 3300026067 Bacteria 2857
121 Ga0207641_10013191 3300026088 Bacteria 6775
122 Ga0207648_10983841 3300026089 Bacteria 790
123 Ga0207676_10054332 3300026095 Bacteria 3139
124 Ga0207683_10015344 3300026121 Bacteria 6524
125 Ga0207428_10231313 3300027907 Bacteria 1383
126 Ga0268266_10008517 3300028379 Bacteria 9112
127 Ga0268266_10208949 3300028379 Bacteria 1790
128 Ga0268266_10277595 3300028379 Bacteria 1557
129 Ga0268266_10328257 3300028379 Bacteria 1433
130 Ga0265338_10021348 3300028800 Bacteria 6757
131 Ga0265770_1084427 3300030878 Bacteria 625
132 Ga0265760_10046186 3300031090 Bacteria 1306
133 Ga0265330_10131665 3300031235 Bacteria 1064
134 Ga0265313_10193944 3300031595 Bacteria 848
135 Ga0373950_0004250 3300034818 Bacteria 2089
136 Ga0373959_0023550 3300034820 Bacteria 1198
137 Ga0373938_0002329 3300034957 Bacteria 3059
138 Ga0373926_0102356 3300035083 Bacteria 1072
139 Ga0373928_0014544 3300035084 Bacteria 1593
140 Ga0373929_0030212 3300035085 Bacteria 1154
141 Ga0373944_0041979 3300035089 Bacteria 1417
142 Ga0373949_0018257 3300035090 Bacteria 1588
143 Ga0373923_0000023 3300035111 Bacteria 23047
144 Ga0373936_0000171 3300035113 Bacteria 21558
145 Ga0373939_0014941 3300035114 Bacteria 2023
146 Ga0373945_0433694 3300035116 Bacteria 579
147 Ga0373953_0000572 3300035117 Bacteria 10237
148 Ga0373954_0002827 3300035118 Bacteria 7308
149 Ga0373954_0174421 3300035118 Bacteria 1054
150 Ga0373956_0028006 3300035119 Bacteria 2450
151 Ga0373956_0082300 3300035119 Bacteria 1478
152 Ga0373957_0100511 3300035120 Bacteria 1157
153 Ga0373960_0033193 3300035121 Bacteria 1454
154 Ga0373943_0003257 3300035170 Bacteria 7373
155 Ga0373946_0000384 3300035171 Bacteria 14370
156 Ga0373955_0000031 3300035172 Bacteria 56668
157 Ga0373955_0254945 3300035172 Bacteria 1052
158 Ga0373955_0297224 3300035172 Bacteria 973
159 Ga0373961_0098842 3300035241 Bacteria 942
160 Ga0373962_0011279 3300035242 Bacteria 2239
161 Ga0373924_0003376 3300035410 Bacteria 5484
162 Ga0373931_0020608 3300035691 Bacteria 3300
163 Ga0373935_0000461 3300035692 Bacteria 21136
164 Ga0373935_0082873 3300035692 Bacteria 2087
165 Ga0373935_1283538 3300035692 Bacteria 546
166 Ga0373927_0020575 3300035695 Bacteria 4327
167 Ga0373927_0024019 3300035695 Bacteria 3988
168 Ga0373927_0123584 3300035695 Bacteria 1689
169 Ga0373927_0350388 3300035695 Bacteria 973
170 Ga0373933_0000638 3300035724 Bacteria 21867
171 Ga0373933_0044607 3300035724 Bacteria 2627
172 Ga0373947_0000244 3300035725 Bacteria 30605
173 Ga0373947_0022220 3300035725 Bacteria 3676
174 Ga0373947_0187474 3300035725 Bacteria 1349
175 Ga0373947_0224131 3300035725 Bacteria 1237
176 Ga0373937_0000098 3300036401 Bacteria 81900
177 Ga0373937_0013615 3300036401 Bacteria 7167
178 Ga0373937_0306840 3300036401 Bacteria 1501
179 Ga0373925_0000198 3300037068 Bacteria 65543
180 Ga0373925_0042420 3300037068 Bacteria 3375
181 Ga0436365_1830451 3300039437 Bacteria 692
182 Ga0436360_0347635 3300039438 Bacteria 840
183 Ga0436360_1257918 3300039438 Bacteria 1042
184 Ga0436363_0489187 3300039450 Bacteria 787
185 Ga0466959_0156996 3300045049 Bacteria 1601
186 Ga0466967_0696762 3300045976 Bacteria 1006
187 Ga0495592_0000119 3300046454 Bacteria 69687
188 Ga0495603_0021037 3300046455 Bacteria 3950
189 Ga0495590_0148920 3300046457 Bacteria 848
190 Ga0495629_0003106 3300046459 Bacteria 12592
191 Ga0495629_0011277 3300046459 Bacteria 6492
192 Ga0495641_0025903 3300046461 Bacteria 2872
193 Ga0495641_0255549 3300046461 Bacteria 788
194 Ga0495651_0001083 3300046462 Bacteria 21013
195 Ga0495651_0018225 3300046462 Bacteria 5437
196 Ga0495653_0000030 3300046463 Bacteria 142668
197 Ga0495653_0499371 3300046463 Bacteria 759
198 Ga0495580_0319279 3300046472 Bacteria 1056
199 Ga0495582_0002101 3300046473 Bacteria 11145
200 Ga0495582_0061592 3300046473 Bacteria 2072
201 Ga0495605_0356589 3300046474 Bacteria 613
202 Ga0495662_0001102 3300046476 Bacteria 13286
203 Ga0495662_0364642 3300046476 Bacteria 710
204 Ga0495664_0000003 3300046477 Bacteria 551602
205 Ga0495584_0043815 3300046491 Bacteria 2259
206 Ga0495607_0235685 3300046501 Bacteria 888
207 Ga0495608_0000011 3300046511 Bacteria 248514
208 Ga0495618_0000025 3300046514 Bacteria 116027
209 Ga0495618_0073039 3300046514 Bacteria 2183
210 Ga0495628_0000001 3300046516 Bacteria 917742
211 Ga0495628_0292027 3300046516 Bacteria 1208
212 Ga0495630_0000551 3300046517 Bacteria 27325
213 Ga0495630_0245717 3300046517 Bacteria 1367
214 Ga0495652_0000002 3300046529 Bacteria 946606
215 Ga0495652_0792547 3300046529 Bacteria 631
216 Ga0495665_0182652 3300046531 Bacteria 1090
217 Ga0495665_0235589 3300046531 Bacteria 944
218 Ga0495665_0421321 3300046531 Bacteria 676
219 Ga0495665_0442215 3300046531 Bacteria 658
220 Ga0495640_0000002 3300046533 Bacteria 646434
221 Ga0495640_0188492 3300046533 Bacteria 1312
222 Ga0495640_0257846 3300046533 Bacteria 1090
223 Ga0495586_0641590 3300046535 Bacteria 613
224 Ga0495587_0000001 3300046536 Bacteria 724132
225 Ga0495645_0000002 3300046543 Bacteria 651644
226 Ga0495645_0064928 3300046543 Bacteria 2641
227 Ga0495667_0000004 3300046559 Bacteria 295297
228 Ga0495667_0038825 3300046559 Bacteria 3170
229 Ga0495634_0000010 3300046642 Bacteria 143792
230 Ga0495634_0038303 3300046642 Bacteria 3270
231 Ga0495634_0080856 3300046642 Bacteria 2126
232 Ga0495635_0000001 3300046663 Bacteria 704901
233 Ga0495635_0217653 3300046663 Bacteria 1292
234 Ga0495635_0308480 3300046663 Bacteria 1060
235 Ga0495657_0000369 3300046675 Bacteria 41664
236 Ga0495657_0058862 3300046675 Bacteria 2550
237 Ga0495657_0453511 3300046675 Bacteria 751
238 Ga0495599_0000013 3300046678 Bacteria 179828
239 Ga0495623_0000024 3300046679 Bacteria 96499
240 Ga0495646_0000009 3300046680 Bacteria 200698
241 Ga0495647_0097454 3300046681 Bacteria 1214
242 Ga0495658_0002761 3300046683 Bacteria 8820
243 Ga0495658_0015270 3300046683 Bacteria 3938
244 Ga0495658_0073899 3300046683 Bacteria 1986
245 Ga0495658_0925093 3300046683 Bacteria 557
246 Ga0495613_0048627 3300046689 Bacteria 3132
247 Ga0495624_0011364 3300046690 Bacteria 6119
248 Ga0495600_0000071 3300046809 Bacteria 55914
249 Ga0495600_0007217 3300046809 Bacteria 6784
250 Ga0495581_0105810 3300047315 Bacteria 1635
251 Ga0495604_0000129 3300047317 Bacteria 63593
252 Ga0495604_0128021 3300047317 Bacteria 1828
253 Ga0495604_0596046 3300047317 Bacteria 709
254 Ga0495674_0000002 3300047319 Bacteria 642785
255 Ga0495674_0007187 3300047319 Bacteria 10651
256 Ga0495674_0829762 3300047319 Bacteria 717
257 Ga0495676_0085976 3300047321 Bacteria 2368
258 Ga0495680_0000853 3300047322 Bacteria 33888
259 Ga0495680_0057647 3300047322 Bacteria 3003
260 Ga0495680_0075530 3300047322 Bacteria 2557
261 Ga0495675_0000274 3300047444 Bacteria 37360
262 Ga0495677_0062076 3300047445 Bacteria 1387
263 Ga0495684_0000083 3300047471 Bacteria 65861
264 Ga0495684_0092572 3300047471 Bacteria 2290
265 Ga0495684_0196475 3300047471 Bacteria 1489
266 Ga0495593_0005774 3300047673 Bacteria 7299
267 Ga0495602_0000024 3300048088 Bacteria 151162
268 Ga0495602_0120901 3300048088 Bacteria 2107
269 Ga0495614_0057035 3300048089 Bacteria 1677
270 Ga0496100_0010789 3300048903 Bacteria 5183
271 Ga0496100_0046055 3300048903 Bacteria 2802
272 Ga0496101_0018951 3300048904 Bacteria 4688
273 Ga0496101_0486586 3300048904 Bacteria 974
274 Ga0496102_0049386 3300048905 Bacteria 3828
275 Ga0496102_0103740 3300048905 Bacteria 2644
276 Ga0496102_0174043 3300048905 Bacteria 2026
277 Ga0496102_0281171 3300048905 Bacteria 1568
278 Ga0496103_0034064 3300048906 Bacteria 3113
279 Ga0496103_0173619 3300048906 Bacteria 1384
280 Ga0496104_0072484 3300048907 Bacteria 3275
281 Ga0496104_0566484 3300048907 Bacteria 1046
282 Ga0496104_0741306 3300048907 Bacteria 889
283 Ga0496104_0895795 3300048907 Bacteria 792
284 Ga0496105_0087064 3300048908 Bacteria 2581
285 Ga0496105_0108169 3300048908 Bacteria 2295
286 Ga0496105_0145959 3300048908 Bacteria 1946
287 Ga0496105_0385608 3300048908 Bacteria 1114
288 Ga0496106_0010963 3300048909 Bacteria 6702
289 Ga0496106_0022446 3300048909 Bacteria 4688
290 Ga0496106_0284491 3300048909 Bacteria 1325
291 Ga0496106_0942411 3300048909 Bacteria 680
292 Ga0496107_0003431 3300048910 Bacteria 10597
293 Ga0496107_0019248 3300048910 Bacteria 4816
294 Ga0496107_0360612 3300048910 Bacteria 1081
295 Ga0496107_0558493 3300048910 Bacteria 847
296 Ga0496108_0038307 3300048911 Bacteria 3993
297 Ga0496108_0133352 3300048911 Bacteria 2135
298 Ga0496109_0299332 3300048912 Bacteria 1516
299 Ga0496109_0391236 3300048912 Bacteria 1313
300 Ga0496109_0398271 3300048912 Bacteria 1301
301 Ga0496109_1482478 3300048912 Bacteria 613
302 Ga0496110_0172520 3300048913 Bacteria 1962
303 Ga0496110_0207965 3300048913 Bacteria 1778
304 Ga0496110_0793828 3300048913 Bacteria 851
305 Ga0496111_0113784 3300048914 Bacteria 1994
306 Ga0496111_0567172 3300048914 Bacteria 832
307 Ga0496112_0077478 3300048915 Bacteria 3287
308 Ga0496112_0271424 3300048915 Bacteria 1644
309 Ga0496112_0366382 3300048915 Bacteria 1382
310 Ga0496112_0387726 3300048915 Bacteria 1337
311 Ga0496113_0039401 3300048916 Bacteria 3478
312 Ga0496113_0075107 3300048916 Bacteria 2579
313 Ga0496113_0102034 3300048916 Bacteria 2224
314 Ga0496114_0014702 3300048917 Bacteria 6289
315 Ga0496114_0051097 3300048917 Bacteria 3441
316 Ga0496114_0230768 3300048917 Bacteria 1626
317 Ga0496115_0009006 3300048918 Bacteria 7404
318 Ga0496115_0023427 3300048918 Bacteria 4792
319 Ga0496115_0030186 3300048918 Bacteria 4263
320 Ga0496115_0032828 3300048918 Bacteria 4097
321 Ga0496115_0311279 3300048918 Bacteria 1289
322 Ga0496115_0642531 3300048918 Bacteria 839
323 Ga0496126_0620335 3300048929 Bacteria 850
324 Ga0501034_0190281 3300049571 Bacteria 2015
325 Ga0501038_0503975 3300049574 Bacteria 925
326 Ga0501071_0022376 3300049587 Bacteria 4407
327 Ga0501072_0082663 3300049588 Bacteria 2546
328 Ga0501075_0366928 3300049591 Bacteria 1097
329 Ga0501080_0329571 3300049742 Bacteria 1381
330 Ga0501045_0437160 3300049824 Bacteria 973
331 nmdc:mga03683_282461_c1 3300050489 Bacteria 776
332 nmdc:mga03n38_26044_c1 3300050490 Bacteria 2411
333 nmdc:mga0yw44_1125989_c1 3300050492 Bacteria 530
334 nmdc:mga0yw44_20089_c1 3300050492 Bacteria 3700
335 nmdc:mga0k408_326489_c1 3300050493 Bacteria 915
336 nmdc:mga06z11_109337_c1 3300050494 Bacteria 1529
337 nmdc:mga06z11_260556_c1 3300050494 Bacteria 1023
338 nmdc:mga06z11_631035_c1 3300050494 Bacteria 652
339 nmdc:mga06z11_641570_c1 3300050494 Bacteria 646
340 nmdc:mga07m45_39595_c1 3300050496 Bacteria 2635
341 nmdc:mga07m45_399371_c1 3300050496 Bacteria 798
342 nmdc:mga05p37_588124_c1 3300050507 Bacteria 1259
343 nmdc:mga08y16_109349_c1 3300050511 Bacteria 2878
344 nmdc:mga0n895_14300_c1 3300050512 Bacteria 7202
345 nmdc:mga0n895_93467_c1 3300050512 Bacteria 3011
346 nmdc:mga0rr50_254225_c1 3300050513 Bacteria 1460
347 nmdc:mga0rr50_776579_c1 3300050513 Bacteria 818
348 nmdc:mga08x19_145226_c1 3300050514 Bacteria 1604
349 nmdc:mga08x19_629890_c1 3300050514 Bacteria 760
350 nmdc:mga0a205_162822_c1 3300050515 Bacteria 2127
351 nmdc:mga0a205_236276_c1 3300050515 Bacteria 1709
352 Ga0495601_0000001 3300053077 Bacteria 549454
353 Ga0495601_0004017 3300053077 Bacteria 8472
354 Ga0495601_0004614 3300053077 Bacteria 7972
355 Ga0495612_0000017 3300053078 Bacteria 152112
356 Ga0495612_0003891 3300053078 Bacteria 6191
357 Ga0495595_0000010 3300053084 Bacteria 178819
358 Ga0495595_0001565 3300053084 Bacteria 8930
359 Ga0495619_0000004 3300053085 Bacteria 500068
360 Ga0495619_0000945 3300053085 Bacteria 19013
361 Ga0500658_0000022 3300053134 Bacteria 129341
362 Ga0500616_0000408 3300053153 Bacteria 58453
363 Ga0501082_0255263 3300060353 Bacteria 1525
364 Ga0501082_1319088 3300060353 Bacteria 630
365 Ga0496104_0116898
366 JGI25406J46586_10023712
367 Ga0070670_100563936
368 Ga0070682_100046473
369 Ga0068868_100072094
370 Ga0070687_100143966
371 Ga0070661_100208919
372 Ga0070671_100481437
373 Ga0070674_100100727
374 Ga0070688_100051564
375 Ga0070709_10147615
376 Ga0070714_101002715
377 Ga0070713_100000923
378 Ga0070710_10027268
379 Ga0070711_100011070
380 Ga0070711_100315587
381 Ga0070663_100039645
382 Ga0070678_100065354
383 Ga0070662_100646252
384 Ga0070681_10230479
385 Ga0070706_100725626
386 Ga0070698_101466736
387 Ga0070699_100220461
388 Ga0070679_100435825
389 Ga0070679_100454019
390 Ga0070684_100096208
391 Ga0070684_100516838
392 Ga0070693_100053361
393 Ga0070693_100495940
394 Ga0070665_100064056
395 Ga0070665_100779400
396 Ga0070664_100155230
397 Ga0070702_100003770
398 Ga0068859_101653921
399 Ga0068864_100492282
400 Ga0068858_100054706
401 Ga0068862_100644728
402 Ga0081539_10001543
403 Ga0070717_10141074
404 Ga0075363_100626137
405 Ga0075364_10014489
406 Ga0075364_10039104
407 Ga0070715_10002518
408 Ga0070716_100004152
409 Ga0070712_100013258
410 Ga0070712_100100241
411 Ga0070712_100198200
412 Ga0075362_10080107
413 Ga0075362_10197510
414 Ga0075367_10263525
415 Ga0075369_10013588
416 Ga0075366_10182903
417 Ga0097621_100006628
418 Ga0068871_100006454
419 Ga0068871_100174634
420 Ga0075433_10126702
421 Ga0075433_10318637
422 Ga0075434_100096529
423 Ga0075434_100141659
424 Ga0075434_100423457
425 Ga0068865_100092177
426 Ga0097620_100812177
427 Ga0097620_101653643
428 Ga0075435_100037053
429 Ga0075435_100111482
430 Ga0099795_10086650
431 Ga0105251_10084715
432 Ga0111539_10226284
433 Ga0111539_10396615
434 Ga0105245_10075199
435 Ga0114129_10275155
436 Ga0105243_10989341
437 Ga0105242_10182118
438 Ga0105242_10354469
439 Ga0105238_10154592
440 Ga0105239_10273385
441 Ga0105246_10019389
442 Ga0157339_1005452
443 Ga0157378_10019818
444 Ga0157378_10447329
445 Ga0163162_10019721
446 Ga0157375_10166503
447 Ga0157375_10190306
448 Ga0163163_10014823
449 Ga0163163_10129576
450 Ga0163163_10181214
451 Ga0182008_10135533
452 Ga0157379_10156614
453 Ga0157379_10833430
454 Ga0157376_10027383
455 Ga0163161_10057061
456 Ga0163161_10309418
457 Ga0207713_1107827
458 Ga0207692_10001856
459 Ga0207642_10108251
460 Ga0207710_10032194
461 Ga0207685_10000848
462 Ga0207699_10557200
463 Ga0207684_10547817
464 Ga0207693_10012093
465 Ga0207693_10022117
466 Ga0207693_10234792
467 Ga0207693_10323919
468 Ga0207693_11228906
469 Ga0207663_10178809
470 Ga0207652_10790225
471 Ga0207694_10212943
472 Ga0207700_10002289
473 Ga0207644_10023350
474 Ga0207706_10357250
475 Ga0207686_10400070
476 Ga0207704_10018360
477 Ga0207665_10000223
478 Ga0207689_10081901
479 Ga0207679_10162348
480 Ga0207679_10182287
481 Ga0207677_10061693
482 Ga0207677_10091784
483 Ga0207678_10019073
484 Ga0207678_10077002
485 Ga0207641_10013191
486 Ga0207648_10983841
487 Ga0207676_10054332
488 Ga0207683_10015344
489 Ga0207428_10231313
490 Ga0268266_10008517
491 Ga0268266_10208949
492 Ga0268266_10277595
493 Ga0268266_10328257
494 Ga0265338_10021348
495 Ga0265770_1084427
496 Ga0265760_10046186
497 Ga0265330_10131665
498 Ga0265313_10193944
499 Ga0373950_0004250
500 Ga0373959_0023550
501 Ga0373938_0002329
502 Ga0373926_0102356
503 Ga0373928_0014544
504 Ga0373929_0030212
505 Ga0373944_0041979
506 Ga0373949_0018257
507 Ga0373923_0000023
508 Ga0373936_0000171
509 Ga0373939_0014941
510 Ga0373945_0433694
511 Ga0373953_0000572
512 Ga0373954_0002827
513 Ga0373954_0174421
514 Ga0373956_0028006
515 Ga0373956_0082300
516 Ga0373957_0100511
517 Ga0373960_0033193
518 Ga0373943_0003257
519 Ga0373946_0000384
520 Ga0373955_0000031
521 Ga0373955_0254945
522 Ga0373955_0297224
523 Ga0373961_0098842
524 Ga0373962_0011279
525 Ga0373924_0003376
526 Ga0373931_0020608
527 Ga0373935_0000461
528 Ga0373935_0082873
529 Ga0373935_1283538
530 Ga0373927_0020575
531 Ga0373927_0024019
532 Ga0373927_0123584
533 Ga0373927_0350388
534 Ga0373933_0000638
535 Ga0373933_0044607
536 Ga0373947_0000244
537 Ga0373947_0022220
538 Ga0373947_0187474
539 Ga0373947_0224131
540 Ga0373937_0000098
541 Ga0373937_0013615
542 Ga0373937_0306840
543 Ga0373925_0000198
544 Ga0373925_0042420
545 Ga0436365_1830451
546 Ga0436360_0347635
547 Ga0436360_1257918
548 Ga0436363_0489187
549 Ga0466959_0156996
550 Ga0466967_0696762
551 Ga0495592_0000119
552 Ga0495603_0021037
553 Ga0495590_0148920
554 Ga0495629_0003106
555 Ga0495629_0011277
556 Ga0495641_0025903
557 Ga0495641_0255549
558 Ga0495651_0001083
559 Ga0495651_0018225
560 Ga0495653_0000030
561 Ga0495653_0499371
562 Ga0495580_0319279
563 Ga0495582_0002101
564 Ga0495582_0061592
565 Ga0495605_0356589
566 Ga0495662_0001102
567 Ga0495662_0364642
568 Ga0495664_0000003
569 Ga0495584_0043815
570 Ga0495607_0235685
571 Ga0495608_0000011
572 Ga0495618_0000025
573 Ga0495618_0073039
574 Ga0495628_0000001
575 Ga0495628_0292027
576 Ga0495630_0000551
577 Ga0495630_0245717
578 Ga0495652_0000002
579 Ga0495652_0792547
580 Ga0495665_0182652
581 Ga0495665_0235589
582 Ga0495665_0421321
583 Ga0495665_0442215
584 Ga0495640_0000002
585 Ga0495640_0188492
586 Ga0495640_0257846
587 Ga0495586_0641590
588 Ga0495587_0000001
589 Ga0495645_0000002
590 Ga0495645_0064928
591 Ga0495667_0000004
592 Ga0495667_0038825
593 Ga0495634_0000010
594 Ga0495634_0038303
595 Ga0495634_0080856
596 Ga0495635_0000001
597 Ga0495635_0217653
598 Ga0495635_0308480
599 Ga0495657_0000369
600 Ga0495657_0058862
601 Ga0495657_0453511
602 Ga0495599_0000013
603 Ga0495623_0000024
604 Ga0495646_0000009
605 Ga0495647_0097454
606 Ga0495658_0002761
607 Ga0495658_0015270
608 Ga0495658_0073899
609 Ga0495658_0925093
610 Ga0495613_0048627
611 Ga0495624_0011364
612 Ga0495600_0000071
613 Ga0495600_0007217
614 Ga0495581_0105810
615 Ga0495604_0000129
616 Ga0495604_0128021
617 Ga0495604_0596046
618 Ga0495674_0000002
619 Ga0495674_0007187
620 Ga0495674_0829762
621 Ga0495676_0085976
622 Ga0495680_0000853
623 Ga0495680_0057647
624 Ga0495680_0075530
625 Ga0495675_0000274
626 Ga0495677_0062076
627 Ga0495684_0000083
628 Ga0495684_0092572
629 Ga0495684_0196475
630 Ga0495593_0005774
631 Ga0495602_0000024
632 Ga0495602_0120901
633 Ga0495614_0057035
634 Ga0496100_0010789
635 Ga0496100_0046055
636 Ga0496101_0018951
637 Ga0496101_0486586
638 Ga0496102_0049386
639 Ga0496102_0103740
640 Ga0496102_0174043
641 Ga0496102_0281171
642 Ga0496103_0034064
643 Ga0496103_0173619
644 Ga0496104_0072484
645 Ga0496104_0566484
646 Ga0496104_0741306
647 Ga0496104_0895795
648 Ga0496105_0087064
649 Ga0496105_0108169
650 Ga0496105_0145959
651 Ga0496105_0385608
652 Ga0496106_0010963
653 Ga0496106_0022446
654 Ga0496106_0284491
655 Ga0496106_0942411
656 Ga0496107_0003431
657 Ga0496107_0019248
658 Ga0496107_0360612
659 Ga0496107_0558493
660 Ga0496108_0038307
661 Ga0496108_0133352
662 Ga0496109_0299332
663 Ga0496109_0391236
664 Ga0496109_0398271
665 Ga0496109_1482478
666 Ga0496110_0172520
667 Ga0496110_0207965
668 Ga0496110_0793828
669 Ga0496111_0113784
670 Ga0496111_0567172
671 Ga0496112_0077478
672 Ga0496112_0271424
673 Ga0496112_0366382
674 Ga0496112_0387726
675 Ga0496113_0039401
676 Ga0496113_0075107
677 Ga0496113_0102034
678 Ga0496114_0014702
679 Ga0496114_0051097
680 Ga0496114_0230768
681 Ga0496115_0009006
682 Ga0496115_0023427
683 Ga0496115_0030186
684 Ga0496115_0032828
685 Ga0496115_0311279
686 Ga0496115_0642531
687 Ga0496126_0620335
688 Ga0501034_0190281
689 Ga0501038_0503975
690 Ga0501071_0022376
691 Ga0501072_0082663
692 Ga0501075_0366928
693 Ga0501080_0329571
694 Ga0501045_0437160
695 nmdc:mga03683_282461_c1
696 nmdc:mga03n38_26044_c1
697 nmdc:mga0yw44_1125989_c1
698 nmdc:mga0yw44_20089_c1
699 nmdc:mga0k408_326489_c1
700 nmdc:mga06z11_109337_c1
701 nmdc:mga06z11_260556_c1
702 nmdc:mga06z11_631035_c1
703 nmdc:mga06z11_641570_c1
704 nmdc:mga07m45_39595_c1
705 nmdc:mga07m45_399371_c1
706 nmdc:mga05p37_588124_c1
707 nmdc:mga08y16_109349_c1
708 nmdc:mga0n895_14300_c1
709 nmdc:mga0n895_93467_c1
710 nmdc:mga0rr50_254225_c1
711 nmdc:mga0rr50_776579_c1
712 nmdc:mga08x19_145226_c1
713 nmdc:mga08x19_629890_c1
714 nmdc:mga0a205_162822_c1
715 nmdc:mga0a205_236276_c1
716 Ga0495601_0000001
717 Ga0495601_0004017
718 Ga0495601_0004614
719 Ga0495612_0000017
720 Ga0495612_0003891
721 Ga0495595_0000010
722 Ga0495595_0001565
723 Ga0495619_0000004
724 Ga0495619_0000945
725 Ga0500658_0000022
726 Ga0500616_0000408
727 Ga0501082_0255263
728 Ga0501082_1319088

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01451

LMWPc

Low molecular weight phosphotyrosine protein phosphatase

18

151

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p6m-assembly1.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus 0.9626 5 142
8p6m-assembly1.cif.gz_A arsenate reductase (arsc2) from deinococcus indicus 0.9549 5 141
8p6m-assembly1.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus 0.9484 5 142
8p6m-assembly1.cif.gz_A arsenate reductase (arsc2) from deinococcus indicus 0.9264 5 141
8p5n-assembly2.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus, co-crystallized with arsenate 0.9261 5 142
ID Description Score Start End Superfamily
1jl3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.901 6 140 3.40.50.2300
1jl3C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8868 7 140 3.40.50.2300
2myuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8798 7 141 3.40.50.2300
1jl3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8642 6 140 3.40.50.2300
1y1lA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8626 8 142 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2V9GUH8-F1-model_v4 Protein-tyrosine-phosphatase 0.9875 5 161 GO:0046685
AF-A0A2D6BEZ2-F1-model_v4 deleted 0.9872 17 160
AF-A0A2G2G4D1-F1-model_v4 ArsR family transcriptional regulator 0.9869 2 159 GO:0003700
GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-K9GRJ3-F1-model_v4 Arsenate reductase 0.9811 1 162 GO:0003700
GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A3D3BC67-F1-model_v4 ArsR family transcriptional regulator 0.9811 19 161 GO:0004726
GO:0030946
GO:0046685
GO:0140793

Map