F423473

General Info

Members Datasets Scaffolds Average Seq Length
364 229 353 163

Family's Representative Sequence

Representative Sequence 3300049587|Ga0501071_0703526|Ga0501071_0703526_161_718
Length 185
Sequence MLTVLPHSRCASAAERQKEKTAVLQFTMSSLAGEDIDLARYQGQVLLIVNVASACGYTPQYKGLQALHAKYAAQGFAVLGFPCNQFGQQEPGSAAQIATFCEQRYGVTFPMFAKEDVNGPRQCALYQHLTAQPTQPAPAGPIQWNFEKFLLARDGTVVARFRSHVAPESAQLVESIERELAKPAP

Samples

Sample ID Description Type Environment
1 2547132424 Nocardia nova SH22a Isolate Unclassified
2 2643221692 Nocardia sp. Root136 Isolate Unclassified
3 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
4 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
5 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
6 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
7 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
8 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
9 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
10 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
11 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
128 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
133 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
134 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
135 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
136 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
137 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
138 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
139 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
140 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
141 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
142 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
143 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
144 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
145 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
146 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
147 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
148 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
149 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
155 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
156 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
157 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
158 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
159 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
160 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
161 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
162 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
163 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
164 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
165 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
166 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
167 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
168 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
169 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
186 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
187 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
188 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
189 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
190 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
191 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
192 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
193 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
194 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
206 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
207 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
208 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
209 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
210 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
211 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
215 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
216 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
217 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
218 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
219 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
222 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
223 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
224 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
225 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
226 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
227 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
228 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
229 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.7
Metatranscriptomes 0.27
Isolates 3.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.79
Nodule 0.27
Rhizoplane 12.36
Rhizosphere 70.05
Stem 0
Stem Tuber 0
Unclassified 8.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10010461 3300002459 Bacteria 1912
2 Ga0070683_100304928 3300005329 Bacteria 1515
3 Ga0070683_100815073 3300005329 Bacteria 895
4 Ga0068868_100220663 3300005338 Bacteria 1587
5 Ga0068868_100769322 3300005338 Bacteria 866
6 Ga0070660_100215156 3300005339 Bacteria 1561
7 Ga0070689_100884286 3300005340 Bacteria 790
8 Ga0070687_100485360 3300005343 Bacteria 829
9 Ga0070668_100210071 3300005347 Bacteria 1601
10 Ga0070669_100005981 3300005353 Bacteria 8779
11 Ga0070671_100000923 3300005355 Bacteria 21454
12 Ga0070674_100339681 3300005356 Bacteria 1209
13 Ga0070688_100091829 3300005365 Bacteria 1985
14 Ga0070659_101373602 3300005366 Bacteria 627
15 Ga0070667_100000535 3300005367 Bacteria 37853
16 Ga0070667_100034855 3300005367 Bacteria 4213
17 Ga0070667_100117804 3300005367 Bacteria 2307
18 Ga0070667_100765597 3300005367 Bacteria 895
19 Ga0070667_101681222 3300005367 Bacteria 597
20 Ga0070703_10266479 3300005406 Bacteria 701
21 Ga0070709_10044945 3300005434 Bacteria 2738
22 Ga0070709_10680476 3300005434 Bacteria 799
23 Ga0070710_10330354 3300005437 Bacteria 1004
24 Ga0070711_100051705 3300005439 Bacteria 2823
25 Ga0070663_100021756 3300005455 Bacteria 4272
26 Ga0070678_101151589 3300005456 Bacteria 718
27 Ga0070662_100163919 3300005457 Bacteria 1740
28 Ga0070684_100260416 3300005535 Bacteria 1587
29 Ga0068853_100191254 3300005539 Bacteria 1859
30 Ga0070686_100096902 3300005544 Bacteria 1985
31 Ga0070696_100009364 3300005546 Bacteria 6557
32 Ga0070693_100021074 3300005547 Bacteria 3448
33 Ga0070665_100039556 3300005548 Bacteria 4741
34 Ga0070665_100107369 3300005548 Bacteria 2794
35 Ga0070665_100716216 3300005548 Bacteria 1014
36 Ga0070665_100723877 3300005548 Bacteria 1008
37 Ga0070704_100562767 3300005549 Bacteria 997
38 Ga0070664_100188835 3300005564 Bacteria 1835
39 Ga0070702_100068518 3300005615 Bacteria 2088
40 Ga0068852_100133736 3300005616 Bacteria 2287
41 Ga0068852_100934184 3300005616 Bacteria 885
42 Ga0068859_100001716 3300005617 Bacteria 22359
43 Ga0068859_100174277 3300005617 Bacteria 2233
44 Ga0068859_100229941 3300005617 Bacteria 1942
45 Ga0068864_100414935 3300005618 Bacteria 1282
46 Ga0068866_10066913 3300005718 Bacteria 1884
47 Ga0068861_100429531 3300005719 Bacteria 1179
48 Ga0068870_10042804 3300005840 Bacteria 2359
49 Ga0068863_100000143 3300005841 Bacteria 75127
50 Ga0068863_100046189 3300005841 Bacteria 4133
51 Ga0068858_100004006 3300005842 Bacteria 14538
52 Ga0068858_100208351 3300005842 Bacteria 1850
53 Ga0068858_100278901 3300005842 Bacteria 1591
54 Ga0068858_101232097 3300005842 Bacteria 736
55 Ga0068860_100000079 3300005843 Bacteria 170752
56 Ga0068862_100000093 3300005844 Bacteria 106838
57 Ga0081455_10091834 3300005937 Bacteria 2458
58 Ga0075365_10055957 3300006038 Bacteria 2621
59 Ga0075363_100008264 3300006048 Bacteria 4838
60 Ga0075363_100022236 3300006048 Bacteria 3205
61 Ga0075363_100040567 3300006048 Bacteria 2454
62 Ga0075363_100063201 3300006048 Bacteria 1997
63 Ga0075363_100549997 3300006048 Bacteria 689
64 Ga0075364_10005466 3300006051 Bacteria 7386
65 Ga0075432_10118603 3300006058 Bacteria 992
66 Ga0075432_10195088 3300006058 Bacteria 799
67 Ga0070715_10033821 3300006163 Bacteria 2092
68 Ga0070716_100006495 3300006173 Bacteria 5714
69 Ga0070712_100010036 3300006175 Bacteria 5969
70 Ga0075362_10019583 3300006177 Bacteria 2817
71 Ga0075369_10000029 3300006186 Bacteria 39213
72 Ga0075369_10015259 3300006186 Bacteria 3081
73 Ga0075369_10080151 3300006186 Bacteria 1447
74 Ga0075370_10015782 3300006353 Bacteria 4052
75 Ga0075370_10040986 3300006353 Bacteria 2613
76 Ga0075370_10612589 3300006353 Bacteria 660
77 Ga0075430_100089275 3300006846 Bacteria 2579
78 Ga0097620_100001716 3300006931 Bacteria 22359
79 Ga0097620_100174281 3300006931 Bacteria 2233
80 Ga0097620_100229951 3300006931 Bacteria 1942
81 Ga0105251_10364058 3300009011 Bacteria 661
82 Ga0105240_11180242 3300009093 Bacteria 811
83 Ga0105245_10482957 3300009098 Bacteria 1253
84 Ga0105247_10001633 3300009101 Bacteria 15845
85 Ga0105247_10500241 3300009101 Bacteria 885
86 Ga0105243_10559854 3300009148 Bacteria 1094
87 Ga0105241_10170691 3300009174 Bacteria 1796
88 Ga0105242_10810787 3300009176 Bacteria 927
89 Ga0105248_10000641 3300009177 Bacteria 39742
90 Ga0105248_10223925 3300009177 Bacteria 2117
91 Ga0105248_10429705 3300009177 Bacteria 1487
92 Ga0105248_10729095 3300009177 Bacteria 1118
93 Ga0105249_10000049 3300009553 Bacteria 169899
94 Ga0099796_10078789 3300010159 Bacteria 1204
95 Ga0105239_12058203 3300010375 Bacteria 663
96 Ga0157369_10368288 3300013105 Bacteria 1492
97 Ga0157378_10021567 3300013297 Bacteria 5665
98 Ga0163162_10218931 3300013306 Bacteria 2034
99 Ga0163162_10464404 3300013306 Bacteria 1397
100 Ga0163162_10560677 3300013306 Bacteria 1270
101 Ga0157375_11493747 3300013308 Bacteria 797
102 Ga0157375_12129734 3300013308 Bacteria 668
103 Ga0163163_10119943 3300014325 Bacteria 2663
104 Ga0163163_10146429 3300014325 Bacteria 2406
105 Ga0163163_10192510 3300014325 Bacteria 2088
106 Ga0163163_10452348 3300014325 Bacteria 1344
107 Ga0163163_12505770 3300014325 Bacteria 574
108 Ga0157380_10355191 3300014326 Bacteria 1373
109 Ga0157377_10348226 3300014745 Bacteria 993
110 Ga0157379_10003299 3300014968 Bacteria 13654
111 Ga0157379_10130568 3300014968 Bacteria 2261
112 Ga0157376_11071454 3300014969 Bacteria 831
113 Ga0163161_11659045 3300017792 Bacteria 565
114 Ga0206352_11315392 3300020078 Bacteria 525
115 Ga0213876_10015330 3300021384 Bacteria 4058
116 Ga0209673_1042076 3300025273 Bacteria 1288
117 Ga0207642_10039317 3300025899 Bacteria 2054
118 Ga0207710_10000908 3300025900 Bacteria 15831
119 Ga0207699_10018712 3300025906 Bacteria 3677
120 Ga0207643_10033643 3300025908 Bacteria 2869
121 Ga0207643_10744927 3300025908 Bacteria 634
122 Ga0207671_10191419 3300025914 Bacteria 1595
123 Ga0207693_10000771 3300025915 Bacteria 28766
124 Ga0207663_10453632 3300025916 Bacteria 989
125 Ga0207662_10210476 3300025918 Bacteria 1262
126 Ga0207681_10020521 3300025923 Bacteria 4189
127 Ga0207687_10323224 3300025927 Bacteria 1250
128 Ga0207664_10430719 3300025929 Bacteria 1176
129 Ga0207644_10043133 3300025931 Bacteria 3200
130 Ga0207690_11166502 3300025932 Bacteria 643
131 Ga0207706_10054084 3300025933 Bacteria 3543
132 Ga0207686_10210790 3300025934 Bacteria 1397
133 Ga0207670_10433342 3300025936 Bacteria 1057
134 Ga0207669_11161948 3300025937 Bacteria 653
135 Ga0207704_10358848 3300025938 Bacteria 1137
136 Ga0207665_10002506 3300025939 Bacteria 12363
137 Ga0207711_10002851 3300025941 Bacteria 15167
138 Ga0207711_10274485 3300025941 Bacteria 1552
139 Ga0207661_10815114 3300025944 Bacteria 859
140 Ga0207679_10175489 3300025945 Bacteria 1768
141 Ga0207651_10437842 3300025960 Bacteria 1119
142 Ga0207712_10000038 3300025961 Bacteria 192762
143 Ga0207712_10380013 3300025961 Bacteria 1182
144 Ga0207668_10034076 3300025972 Bacteria 3379
145 Ga0207668_10172380 3300025972 Bacteria 1698
146 Ga0207668_10427754 3300025972 Bacteria 1125
147 Ga0207658_10002028 3300025986 Bacteria 15117
148 Ga0207658_10071799 3300025986 Bacteria 2622
149 Ga0207658_10258780 3300025986 Bacteria 1482
150 Ga0207677_10154907 3300026023 Bacteria 1773
151 Ga0207703_10047588 3300026035 Bacteria 3458
152 Ga0207703_10089322 3300026035 Bacteria 2588
153 Ga0207703_10703885 3300026035 Bacteria 961
154 Ga0207703_11104183 3300026035 Bacteria 762
155 Ga0207678_10013351 3300026067 Bacteria 7209
156 Ga0207708_10061648 3300026075 Bacteria 2864
157 Ga0207641_10000232 3300026088 Bacteria 71885
158 Ga0207641_10192423 3300026088 Bacteria 1875
159 Ga0207641_10997840 3300026088 Bacteria 834
160 Ga0207676_10259657 3300026095 Bacteria 1568
161 Ga0207698_10026087 3300026142 Bacteria 4129
162 Ga0207698_10249878 3300026142 Bacteria 1622
163 Ga0209179_1058808 3300027512 Bacteria 832
164 Ga0268266_10006941 3300028379 Bacteria 10300
165 Ga0268266_10022186 3300028379 Bacteria 5411
166 Ga0268265_10000053 3300028380 Bacteria 170215
167 Ga0268264_10000017 3300028381 Bacteria 498037
168 Ga0268264_11427480 3300028381 Bacteria 703
169 Ga0307413_10118465 3300031824 Bacteria 1788
170 Ga0307410_10537214 3300031852 Bacteria 967
171 Ga0307406_10247243 3300031901 Bacteria 1341
172 Ga0373961_0073017 3300035241 Bacteria 1065
173 Ga0316584_0084040 3300036712 Bacteria 2384
174 Ga0395905_0632697 3300037471 Bacteria 972
175 Ga0436364_1385689 3300037853 Bacteria 7516
176 Ga0436365_1317629 3300039437 Bacteria 6173
177 Ga0439461_0007220 3300041410 Bacteria 1960
178 Ga0439466_0020617 3300041411 Bacteria 2347
179 Ga0439465_0001890 3300041413 Bacteria 6858
180 Ga0451795_0183277 3300041456 Bacteria 1070
181 Ga0451835_0338568 3300041492 Bacteria 742
182 Ga0451851_0035895 3300041507 Bacteria 791
183 Ga0451843_1458389 3300041509 Bacteria 1062
184 Ga0439431_0000474 3300041997 Bacteria 8514
185 Ga0439434_0034004 3300042435 Bacteria 1556
186 Ga0439435_0067652 3300042436 Bacteria 1052
187 Ga0466972_0029543 3300044658 Bacteria 2699
188 Ga0466972_0087140 3300044658 Bacteria 1483
189 Ga0466972_0108762 3300044658 Bacteria 1310
190 Ga0466972_0220986 3300044658 Bacteria 886
191 Ga0466972_0277321 3300044658 Bacteria 783
192 Ga0466965_0126208 3300044683 Bacteria 1324
193 Ga0466965_0316972 3300044683 Bacteria 849
194 Ga0466966_0065050 3300044684 Bacteria 2294
195 Ga0466966_0080325 3300044684 Bacteria 2031
196 Ga0466961_0016299 3300044693 Bacteria 4772
197 Ga0466963_0037283 3300044694 Bacteria 3173
198 Ga0466963_0149204 3300044694 Bacteria 1623
199 Ga0466963_0190795 3300044694 Bacteria 1431
200 Ga0466968_0015206 3300044735 Bacteria 3047
201 Ga0466968_0026654 3300044735 Bacteria 2374
202 Ga0466968_0089099 3300044735 Bacteria 1365
203 Ga0466968_0453057 3300044735 Bacteria 635
204 Ga0466957_0180546 3300044842 Bacteria 1378
205 Ga0466960_0051492 3300044901 Bacteria 1989
206 Ga0466960_0229993 3300044901 Bacteria 1023
207 Ga0466959_0194763 3300045049 Bacteria 1413
208 Ga0466958_0013110 3300045836 Bacteria 4712
209 Ga0466958_0082456 3300045836 Bacteria 1981
210 Ga0466967_0008716 3300045976 Bacteria 7468
211 Ga0466967_0322606 3300045976 Bacteria 1490
212 Ga0466967_0506615 3300045976 Bacteria 1185
213 Ga0466967_0519456 3300045976 Bacteria 1170
214 Ga0466967_1666654 3300045976 Bacteria 635
215 Ga0495629_0040272 3300046459 Bacteria 3287
216 Ga0495638_0008416 3300046460 Bacteria 7317
217 Ga0495641_0027228 3300046461 Bacteria 2782
218 Ga0495582_0120795 3300046473 Bacteria 1476
219 Ga0495662_0075464 3300046476 Bacteria 1636
220 Ga0495594_0059010 3300046499 Bacteria 2121
221 Ga0495630_0273459 3300046517 Bacteria 1291
222 Ga0495666_0114731 3300046526 Bacteria 1264
223 Ga0495665_0071847 3300046531 Bacteria 1822
224 Ga0495640_0021572 3300046533 Bacteria 4726
225 Ga0495668_0668130 3300046616 Bacteria 574
226 Ga0495647_0121384 3300046681 Bacteria 1099
227 Ga0495671_0430681 3300046692 Bacteria 631
228 Ga0495649_0175013 3300046694 Bacteria 1122
229 Ga0495649_0401146 3300046694 Bacteria 688
230 Ga0495581_0039376 3300047315 Bacteria 2736
231 Ga0495676_0509807 3300047321 Bacteria 789
232 Ga0495593_0006211 3300047673 Bacteria 7024
233 Ga0496100_0037765 3300048903 Bacteria 3056
234 Ga0496100_0053285 3300048903 Bacteria 2634
235 Ga0496100_0242678 3300048903 Bacteria 1330
236 Ga0496101_0057413 3300048904 Bacteria 2815
237 Ga0496101_0080032 3300048904 Bacteria 2413
238 Ga0496102_0000559 3300048905 Bacteria 39807
239 Ga0496102_0002030 3300048905 Bacteria 17497
240 Ga0496102_0109017 3300048905 Bacteria 2579
241 Ga0496102_0126813 3300048905 Bacteria 2386
242 Ga0496102_0178709 3300048905 Bacteria 1999
243 Ga0496102_0195549 3300048905 Bacteria 1906
244 Ga0496103_0000556 3300048906 Bacteria 29725
245 Ga0496103_0128564 3300048906 Bacteria 1617
246 Ga0496103_0522935 3300048906 Bacteria 758
247 Ga0496104_0015016 3300048907 Bacteria 7006
248 Ga0496104_0128056 3300048907 Bacteria 2438
249 Ga0496104_0368541 3300048907 Bacteria 1349
250 Ga0496105_0060505 3300048908 Bacteria 3125
251 Ga0496105_0068811 3300048908 Bacteria 2925
252 Ga0496106_0029597 3300048909 Bacteria 4082
253 Ga0496106_0221819 3300048909 Bacteria 1508
254 Ga0496106_0810996 3300048909 Bacteria 742
255 Ga0496107_0015782 3300048910 Bacteria 5298
256 Ga0496107_0473571 3300048910 Bacteria 930
257 Ga0496107_0496674 3300048910 Bacteria 905
258 Ga0496108_0108755 3300048911 Bacteria 2368
259 Ga0496108_0193960 3300048911 Bacteria 1761
260 Ga0496109_0316934 3300048912 Bacteria 1471
261 Ga0496109_0412840 3300048912 Bacteria 1275
262 Ga0496110_0136439 3300048913 Bacteria 2217
263 Ga0496110_0586094 3300048913 Bacteria 1012
264 Ga0496111_0024563 3300048914 Bacteria 4245
265 Ga0496111_0118958 3300048914 Bacteria 1951
266 Ga0496112_0018109 3300048915 Bacteria 6628
267 Ga0496112_0027671 3300048915 Bacteria 5468
268 Ga0496112_0043063 3300048915 Bacteria 4419
269 Ga0496112_0067639 3300048915 Bacteria 3526
270 Ga0496112_0104996 3300048915 Bacteria 2795
271 Ga0496113_0004760 3300048916 Bacteria 8381
272 Ga0496113_0064720 3300048916 Bacteria 2765
273 Ga0496114_0044517 3300048917 Bacteria 3682
274 Ga0496114_0151301 3300048917 Bacteria 2013
275 Ga0496114_0155258 3300048917 Bacteria 1987
276 Ga0496114_0595744 3300048917 Bacteria 975
277 Ga0496117_0005020 3300048920 Bacteria 14189
278 Ga0496117_0051211 3300048920 Bacteria 2921
279 Ga0496118_0000358 3300048921 Bacteria 77310
280 Ga0496118_0004348 3300048921 Bacteria 16865
281 Ga0496119_0014096 3300048922 Bacteria 6290
282 Ga0496119_0126781 3300048922 Bacteria 1396
283 Ga0496120_0013454 3300048923 Bacteria 5506
284 Ga0496122_0126287 3300048925 Bacteria 1636
285 Ga0496123_0028948 3300048926 Bacteria 4089
286 Ga0496124_0100782 3300048927 Bacteria 2340
287 Ga0496124_0526828 3300048927 Bacteria 786
288 Ga0496125_0107958 3300048928 Bacteria 2026
289 Ga0496125_0153501 3300048928 Bacteria 1577
290 Ga0496126_0010778 3300048929 Bacteria 9544
291 Ga0496126_0019389 3300048929 Bacteria 6699
292 Ga0496126_0071532 3300048929 Bacteria 3087
293 Ga0501032_0012850 3300049569 Bacteria 5968
294 Ga0501032_0109948 3300049569 Bacteria 1824
295 Ga0501033_0060871 3300049570 Bacteria 2784
296 Ga0501034_0008577 3300049571 Bacteria 10786
297 Ga0501034_0018580 3300049571 Bacteria 7126
298 Ga0501034_0104716 3300049571 Bacteria 2822
299 Ga0501034_0821498 3300049571 Bacteria 821
300 Ga0501036_0001872 3300049572 Bacteria 16318
301 Ga0501036_0195475 3300049572 Bacteria 1702
302 Ga0501036_1016928 3300049572 Bacteria 678
303 Ga0501037_0000401 3300049573 Bacteria 36095
304 Ga0501037_0103972 3300049573 Bacteria 2048
305 Ga0501038_0007683 3300049574 Bacteria 9941
306 Ga0501038_0346664 3300049574 Bacteria 1157
307 Ga0501039_0003187 3300049575 Bacteria 12267
308 Ga0501043_0001795 3300049579 Bacteria 18430
309 Ga0501043_0154593 3300049579 Bacteria 1794
310 Ga0501046_0024756 3300049580 Bacteria 4919
311 Ga0501046_0034456 3300049580 Bacteria 4085
312 Ga0501047_0030000 3300049581 Bacteria 5243
313 Ga0501047_0298382 3300049581 Bacteria 1454
314 Ga0501048_0018568 3300049582 Bacteria 5112
315 Ga0501048_0254885 3300049582 Bacteria 1246
316 Ga0501068_0092201 3300049584 Bacteria 1870
317 Ga0501068_0319297 3300049584 Bacteria 995
318 Ga0501069_0250982 3300049585 Bacteria 1032
319 Ga0501069_0448725 3300049585 Bacteria 766
320 Ga0501070_0012220 3300049586 Bacteria 7244
321 Ga0501070_0033974 3300049586 Bacteria 4266
322 Ga0501071_0703526 3300049587 Bacteria 778
323 Ga0501071_0933669 3300049587 Bacteria 670
324 Ga0501073_0470629 3300049589 Bacteria 869
325 Ga0501074_0488361 3300049590 Bacteria 873
326 Ga0501076_0667913 3300049592 Unclassified 858
327 Ga0501076_0770255 3300049592 Bacteria 794
328 Ga0501080_0103035 3300049742 Bacteria 2647
329 Ga0501080_0469927 3300049742 Bacteria 1126
330 Ga0501035_0051098 3300049822 Bacteria 3702
331 Ga0501044_0005938 3300049823 Bacteria 13523
332 Ga0501044_0043957 3300049823 Bacteria 4639
333 Ga0501044_0141554 3300049823 Bacteria 2394
334 Ga0501044_0239293 3300049823 Bacteria 1759
335 nmdc:mga03683_1900_c1 3300050489 Bacteria 5668
336 nmdc:mga03n38_296917_c1 3300050490 Bacteria 867
337 nmdc:mga03n38_57560_c1 3300050490 Bacteria 1758
338 nmdc:mga00v17_258426_c1 3300050491 Bacteria 1130
339 nmdc:mga00v17_709_c1 3300050491 Bacteria 18242
340 nmdc:mga0yw44_115335_c1 3300050492 Bacteria 1725
341 nmdc:mga0yw44_133605_c1 3300050492 Bacteria 1608
342 nmdc:mga0yw44_8098_c1 3300050492 Bacteria 5218
343 nmdc:mga07m45_511871_c1 3300050496 Bacteria 695
344 nmdc:mga0qj67_72636_c1 3300050509 Bacteria 2747
345 nmdc:mga0sz30_338_c1 3300050516 Bacteria 17911
346 Ga0495601_0407408 3300053077 Bacteria 881
347 Ga0500635_0002395 3300053080 Bacteria 4641
348 Ga0500643_003262 3300053087 Bacteria 7902
349 Ga0500641_0047764 3300053096 Bacteria 1752
350 Ga0500652_000371 3300053131 Bacteria 16112
351 Ga0500616_0001132 3300053153 Bacteria 27437
352 Ga0500645_000056 3300053730 Bacteria 92126
353 Ga0500645_060051 3300053730 Bacteria 1100

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2643221692 2644514797 149
2 3300044683 Ga0466965_0126208 Ga0466965_0126208_394_885 150
3 3300044684 Ga0466966_0080325 Ga0466966_0080325_227_718 150
4 3300046460 Ga0495638_0008416 Ga0495638_0008416_3525_4013 150
5 3300036712 Ga0316584_0084040 Ga0316584_0084040_25_513 151
6 3300044693 Ga0466961_0016299 Ga0466961_0016299_1297_1788 151
7 3300044694 Ga0466963_0190795 Ga0466963_0190795_27_518 151
8 3300044735 Ga0466968_0015206 Ga0466968_0015206_257_748 151
9 3300044842 Ga0466957_0180546 Ga0466957_0180546_738_1229 151
10 3300045836 Ga0466958_0013110 Ga0466958_0013110_2228_2719 151
11 3300048927 Ga0496124_0526828 Ga0496124_0526828_159_647 151
12 3300048928 Ga0496125_0153501 Ga0496125_0153501_657_1145 151
13 3300053730 Ga0500645_000056 Ga0500645_000056_41208_41696 151
14 3300053730 Ga0500645_060051 Ga0500645_060051_170_658 153
15 3300050492 nmdc:mga0yw44_8098_c1 nmdc:mga0yw44_8098_c1_3153_3641 154
16 3300053087 Ga0500643_003262 Ga0500643_003262_2985_3473 154
17 3300053096 Ga0500641_0047764 Ga0500641_0047764_86_574 154
18 3300045976 Ga0466967_0322606 Ga0466967_0322606_20_490 155
19 3300049572 Ga0501036_0195475 Ga0501036_0195475_12_488 155
20 iso_pu_bacteria 8057568493 8057572503 155
21 iso_pu_bacteria 2547132424 2548692598 157
22 iso_pu_bacteria 2738543028 2739328843 158
23 iso_pu_bacteria 2861520306 2861524033 158
24 iso_pu_bacteria 2902799365 2902804133 158
25 iso_pu_bacteria 2902810491 2902814508 158
26 iso_pu_bacteria 2902837492 2902839223 158
27 3300009101 Ga0105247_10500241 Ga0105247_105002412 159
28 3300049571 Ga0501034_0821498 Ga0501034_0821498_72_557 159
29 iso_pu_bacteria 3006321560 3006327822 159
30 3300005329 Ga0070683_100815073 Ga0070683_1008150731 160
31 3300005338 Ga0068868_100220663 Ga0068868_1002206632 160
32 3300005343 Ga0070687_100485360 Ga0070687_1004853602 160
33 3300005367 Ga0070667_101681222 Ga0070667_1016812221 160
34 3300005535 Ga0070684_100260416 Ga0070684_1002604163 160
35 3300005616 Ga0068852_100934184 Ga0068852_1009341842 160
36 3300009098 Ga0105245_10482957 Ga0105245_104829572 160
37 3300009176 Ga0105242_10810787 Ga0105242_108107872 160
38 3300009177 Ga0105248_10429705 Ga0105248_104297053 160
39 3300013306 Ga0163162_10560677 Ga0163162_105606772 160
40 3300013308 Ga0157375_12129734 Ga0157375_121297342 160
41 3300014325 Ga0163163_10192510 Ga0163163_101925102 160
42 3300014745 Ga0157377_10348226 Ga0157377_103482262 160
43 3300017792 Ga0163161_11659045 Ga0163161_116590451 160
44 3300020078 Ga0206352_11315392 Ga0206352_113153921 160
45 3300025918 Ga0207662_10210476 Ga0207662_102104761 160
46 3300025927 Ga0207687_10323224 Ga0207687_103232242 160
47 3300026023 Ga0207677_10154907 Ga0207677_101549073 160
48 3300026142 Ga0207698_10249878 Ga0207698_102498784 160
49 3300048905 Ga0496102_0178709 Ga0496102_0178709_1383_1865 160
50 3300048907 Ga0496104_0128056 Ga0496104_0128056_359_841 160
51 3300048908 Ga0496105_0060505 Ga0496105_0060505_1082_1564 160
52 3300048911 Ga0496108_0108755 Ga0496108_0108755_1179_1661 160
53 3300048912 Ga0496109_0316934 Ga0496109_0316934_108_590 160
54 3300048914 Ga0496111_0024563 Ga0496111_0024563_361_843 160
55 3300048915 Ga0496112_0043063 Ga0496112_0043063_1628_2110 160
56 3300048917 Ga0496114_0044517 Ga0496114_0044517_2769_3251 160
57 3300049823 Ga0501044_0141554 Ga0501044_0141554_1312_1794 160
58 3300013306 Ga0163162_10464404 Ga0163162_104644042 161
59 3300041410 Ga0439461_0007220 Ga0439461_0007220_252_737 161
60 3300041411 Ga0439466_0020617 Ga0439466_0020617_1147_1632 161
61 3300041997 Ga0439431_0000474 Ga0439431_0000474_7604_8089 161
62 3300045976 Ga0466967_1666654 Ga0466967_1666654_63_548 161
63 3300048904 Ga0496101_0057413 Ga0496101_0057413_23_508 161
64 3300048915 Ga0496112_0018109 Ga0496112_0018109_459_944 161
65 3300048916 Ga0496113_0004760 Ga0496113_0004760_1558_2043 161
66 3300048922 Ga0496119_0126781 Ga0496119_0126781_303_788 161
67 3300048925 Ga0496122_0126287 Ga0496122_0126287_80_565 161
68 3300048926 Ga0496123_0028948 Ga0496123_0028948_1545_2030 161
69 3300048929 Ga0496126_0019389 Ga0496126_0019389_1522_2007 161
70 iso_pu_bacteria 2842134933 2842139494 161
71 iso_pu_bacteria 2929212328 2929217910 161
72 3300005329 Ga0070683_100304928 Ga0070683_1003049282 162
73 3300005353 Ga0070669_100005981 Ga0070669_1000059817 162
74 3300005367 Ga0070667_100000535 Ga0070667_10000053513 162
75 3300005548 Ga0070665_100039556 Ga0070665_1000395566 162
76 3300005617 Ga0068859_100001716 Ga0068859_10000171613 162
77 3300005841 Ga0068863_100000143 Ga0068863_10000014371 162
78 3300005842 Ga0068858_100004006 Ga0068858_10000400612 162
79 3300005843 Ga0068860_100000079 Ga0068860_100000079137 162
80 3300005844 Ga0068862_100000093 Ga0068862_10000009313 162
81 3300006058 Ga0075432_10195088 Ga0075432_101950882 162
82 3300006353 Ga0075370_10040986 Ga0075370_100409861 162
83 3300006931 Ga0097620_100001716 Ga0097620_10000171613 162
84 3300009011 Ga0105251_10364058 Ga0105251_103640582 162
85 3300009101 Ga0105247_10001633 Ga0105247_1000163312 162
86 3300009177 Ga0105248_10000641 Ga0105248_1000064114 162
87 3300009553 Ga0105249_10000049 Ga0105249_10000049134 162
88 3300013306 Ga0163162_10218931 Ga0163162_102189313 162
89 3300014325 Ga0163163_10452348 Ga0163163_104523481 162
90 3300014968 Ga0157379_10003299 Ga0157379_1000329910 162
91 3300014968 Ga0157379_10130568 Ga0157379_101305683 162
92 3300021384 Ga0213876_10015330 Ga0213876_100153303 162
93 3300025900 Ga0207710_10000908 Ga0207710_1000090812 162
94 3300025923 Ga0207681_10020521 Ga0207681_100205213 162
95 3300025929 Ga0207664_10430719 Ga0207664_104307192 162
96 3300025941 Ga0207711_10002851 Ga0207711_1000285114 162
97 3300025944 Ga0207661_10815114 Ga0207661_108151141 162
98 3300025961 Ga0207712_10000038 Ga0207712_10000038148 162
99 3300025986 Ga0207658_10002028 Ga0207658_1000202810 162
100 3300026035 Ga0207703_10047588 Ga0207703_100475884 162
101 3300026088 Ga0207641_10000232 Ga0207641_1000023212 162
102 3300028379 Ga0268266_10006941 Ga0268266_100069413 162
103 3300028380 Ga0268265_10000053 Ga0268265_1000005313 162
104 3300028381 Ga0268264_10000017 Ga0268264_10000017135 162
105 3300031824 Ga0307413_10118465 Ga0307413_101184652 162
106 3300031852 Ga0307410_10537214 Ga0307410_105372142 162
107 3300031901 Ga0307406_10247243 Ga0307406_102472432 162
108 3300037853 Ga0436364_1385689 Ga0436364_1385689_2442_2939 162
109 3300039437 Ga0436365_1317629 Ga0436365_1317629_5585_6073 162
110 3300041456 Ga0451795_0183277 Ga0451795_0183277_243_731 162
111 3300041492 Ga0451835_0338568 Ga0451835_0338568_142_630 162
112 3300044658 Ga0466972_0277321 Ga0466972_0277321_23_511 162
113 3300044683 Ga0466965_0316972 Ga0466965_0316972_31_528 162
114 3300044684 Ga0466966_0065050 Ga0466966_0065050_562_1050 162
115 3300044694 Ga0466963_0037283 Ga0466963_0037283_100_588 162
116 3300044694 Ga0466963_0149204 Ga0466963_0149204_907_1395 162
117 3300045836 Ga0466958_0082456 Ga0466958_0082456_1368_1856 162
118 3300046517 Ga0495630_0273459 Ga0495630_0273459_197_691 162
119 3300046681 Ga0495647_0121384 Ga0495647_0121384_503_997 162
120 3300047321 Ga0495676_0509807 Ga0495676_0509807_119_613 162
121 3300048903 Ga0496100_0053285 Ga0496100_0053285_1280_1768 162
122 3300048905 Ga0496102_0000559 Ga0496102_0000559_9881_10369 162
123 3300048905 Ga0496102_0109017 Ga0496102_0109017_2032_2520 162
124 3300048906 Ga0496103_0000556 Ga0496103_0000556_6220_6708 162
125 3300048906 Ga0496103_0522935 Ga0496103_0522935_162_650 162
126 3300048910 Ga0496107_0015782 Ga0496107_0015782_2994_3482 162
127 3300048917 Ga0496114_0155258 Ga0496114_0155258_1174_1662 162
128 3300048920 Ga0496117_0005020 Ga0496117_0005020_3276_3764 162
129 3300048920 Ga0496117_0051211 Ga0496117_0051211_1213_1701 162
130 3300048921 Ga0496118_0000358 Ga0496118_0000358_71145_71633 162
131 3300048921 Ga0496118_0004348 Ga0496118_0004348_10060_10548 162
132 3300048922 Ga0496119_0014096 Ga0496119_0014096_5638_6126 162
133 3300048923 Ga0496120_0013454 Ga0496120_0013454_4484_4972 162
134 3300048927 Ga0496124_0100782 Ga0496124_0100782_1837_2325 162
135 3300048928 Ga0496125_0107958 Ga0496125_0107958_803_1291 162
136 3300048929 Ga0496126_0010778 Ga0496126_0010778_5789_6277 162
137 3300048929 Ga0496126_0071532 Ga0496126_0071532_147_635 162
138 3300049569 Ga0501032_0012850 Ga0501032_0012850_4337_4825 162
139 3300049569 Ga0501032_0109948 Ga0501032_0109948_1215_1709 162
140 3300049570 Ga0501033_0060871 Ga0501033_0060871_2008_2496 162
141 3300049571 Ga0501034_0008577 Ga0501034_0008577_4193_4681 162
142 3300049571 Ga0501034_0018580 Ga0501034_0018580_1238_1732 162
143 3300049572 Ga0501036_0001872 Ga0501036_0001872_15420_15908 162
144 3300049572 Ga0501036_1016928 Ga0501036_1016928_97_591 162
145 3300049573 Ga0501037_0000401 Ga0501037_0000401_5127_5615 162
146 3300049573 Ga0501037_0103972 Ga0501037_0103972_1035_1529 162
147 3300049574 Ga0501038_0007683 Ga0501038_0007683_5444_5932 162
148 3300049574 Ga0501038_0346664 Ga0501038_0346664_558_1052 162
149 3300049575 Ga0501039_0003187 Ga0501039_0003187_7605_8093 162
150 3300049579 Ga0501043_0001795 Ga0501043_0001795_10417_10905 162
151 3300049579 Ga0501043_0154593 Ga0501043_0154593_188_682 162
152 3300049580 Ga0501046_0024756 Ga0501046_0024756_3951_4445 162
153 3300049580 Ga0501046_0034456 Ga0501046_0034456_369_860 162
154 3300049581 Ga0501047_0030000 Ga0501047_0030000_1594_2082 162
155 3300049581 Ga0501047_0298382 Ga0501047_0298382_403_894 162
156 3300049582 Ga0501048_0018568 Ga0501048_0018568_1012_1506 162
157 3300049582 Ga0501048_0254885 Ga0501048_0254885_465_956 162
158 3300049584 Ga0501068_0092201 Ga0501068_0092201_484_972 162
159 3300049584 Ga0501068_0319297 Ga0501068_0319297_140_634 162
160 3300049585 Ga0501069_0250982 Ga0501069_0250982_20_508 162
161 3300049585 Ga0501069_0448725 Ga0501069_0448725_216_710 162
162 3300049586 Ga0501070_0012220 Ga0501070_0012220_4530_5018 162
163 3300049586 Ga0501070_0033974 Ga0501070_0033974_3426_3920 162
164 3300049587 Ga0501071_0933669 Ga0501071_0933669_34_522 162
165 3300049590 Ga0501074_0488361 Ga0501074_0488361_92_586 162
166 3300049742 Ga0501080_0103035 Ga0501080_0103035_1680_2174 162
167 3300049822 Ga0501035_0051098 Ga0501035_0051098_3129_3623 162
168 3300049823 Ga0501044_0005938 Ga0501044_0005938_7835_8323 162
169 3300049823 Ga0501044_0043957 Ga0501044_0043957_4066_4560 162
170 3300049823 Ga0501044_0239293 Ga0501044_0239293_836_1327 162
171 3300053080 Ga0500635_0002395 Ga0500635_0002395_3486_3974 162
172 3300053131 Ga0500652_000371 Ga0500652_000371_9786_10274 162
173 3300053153 Ga0500616_0001132 Ga0500616_0001132_13642_14130 162
174 3300002459 JGI24751J29686_10010461 JGI24751J29686_100104612 163
175 3300005338 Ga0068868_100769322 Ga0068868_1007693221 163
176 3300005339 Ga0070660_100215156 Ga0070660_1002151562 163
177 3300005340 Ga0070689_100884286 Ga0070689_1008842861 163
178 3300005347 Ga0070668_100210071 Ga0070668_1002100712 163
179 3300005355 Ga0070671_100000923 Ga0070671_1000009238 163
180 3300005356 Ga0070674_100339681 Ga0070674_1003396812 163
181 3300005365 Ga0070688_100091829 Ga0070688_1000918291 163
182 3300005366 Ga0070659_101373602 Ga0070659_1013736021 163
183 3300005367 Ga0070667_100034855 Ga0070667_1000348555 163
184 3300005367 Ga0070667_100117804 Ga0070667_1001178043 163
185 3300005367 Ga0070667_100765597 Ga0070667_1007655971 163
186 3300005406 Ga0070703_10266479 Ga0070703_102664792 163
187 3300005434 Ga0070709_10044945 Ga0070709_100449452 163
188 3300005434 Ga0070709_10680476 Ga0070709_106804762 163
189 3300005437 Ga0070710_10330354 Ga0070710_103303542 163
190 3300005439 Ga0070711_100051705 Ga0070711_1000517054 163
191 3300005455 Ga0070663_100021756 Ga0070663_1000217562 163
192 3300005456 Ga0070678_101151589 Ga0070678_1011515891 163
193 3300005457 Ga0070662_100163919 Ga0070662_1001639191 163
194 3300005539 Ga0068853_100191254 Ga0068853_1001912543 163
195 3300005544 Ga0070686_100096902 Ga0070686_1000969022 163
196 3300005546 Ga0070696_100009364 Ga0070696_1000093644 163
197 3300005547 Ga0070693_100021074 Ga0070693_1000210742 163
198 3300005548 Ga0070665_100107369 Ga0070665_1001073692 163
199 3300005548 Ga0070665_100716216 Ga0070665_1007162162 163
200 3300005548 Ga0070665_100723877 Ga0070665_1007238773 163
201 3300005549 Ga0070704_100562767 Ga0070704_1005627672 163
202 3300005564 Ga0070664_100188835 Ga0070664_1001888352 163
203 3300005615 Ga0070702_100068518 Ga0070702_1000685181 163
204 3300005616 Ga0068852_100133736 Ga0068852_1001337364 163
205 3300005617 Ga0068859_100174277 Ga0068859_1001742772 163
206 3300005617 Ga0068859_100229941 Ga0068859_1002299413 163
207 3300005618 Ga0068864_100414935 Ga0068864_1004149351 163
208 3300005718 Ga0068866_10066913 Ga0068866_100669133 163
209 3300005719 Ga0068861_100429531 Ga0068861_1004295312 163
210 3300005840 Ga0068870_10042804 Ga0068870_100428041 163
211 3300005841 Ga0068863_100046189 Ga0068863_1000461894 163
212 3300005842 Ga0068858_100208351 Ga0068858_1002083511 163
213 3300005842 Ga0068858_100278901 Ga0068858_1002789011 163
214 3300005842 Ga0068858_101232097 Ga0068858_1012320971 163
215 3300005937 Ga0081455_10091834 Ga0081455_100918342 163
216 3300006038 Ga0075365_10055957 Ga0075365_100559574 163
217 3300006048 Ga0075363_100008264 Ga0075363_1000082643 163
218 3300006048 Ga0075363_100022236 Ga0075363_1000222363 163
219 3300006048 Ga0075363_100040567 Ga0075363_1000405673 163
220 3300006048 Ga0075363_100063201 Ga0075363_1000632013 163
221 3300006048 Ga0075363_100549997 Ga0075363_1005499971 163
222 3300006051 Ga0075364_10005466 Ga0075364_100054664 163
223 3300006058 Ga0075432_10118603 Ga0075432_101186032 163
224 3300006163 Ga0070715_10033821 Ga0070715_100338212 163
225 3300006173 Ga0070716_100006495 Ga0070716_1000064954 163
226 3300006175 Ga0070712_100010036 Ga0070712_1000100363 163
227 3300006177 Ga0075362_10019583 Ga0075362_100195834 163
228 3300006186 Ga0075369_10000029 Ga0075369_1000002934 163
229 3300006186 Ga0075369_10015259 Ga0075369_100152592 163
230 3300006186 Ga0075369_10080151 Ga0075369_100801512 163
231 3300006353 Ga0075370_10015782 Ga0075370_100157824 163
232 3300006353 Ga0075370_10612589 Ga0075370_106125891 163
233 3300006846 Ga0075430_100089275 Ga0075430_1000892753 163
234 3300006931 Ga0097620_100174281 Ga0097620_1001742813 163
235 3300006931 Ga0097620_100229951 Ga0097620_1002299512 163
236 3300009093 Ga0105240_11180242 Ga0105240_111802421 163
237 3300009148 Ga0105243_10559854 Ga0105243_105598542 163
238 3300009174 Ga0105241_10170691 Ga0105241_101706912 163
239 3300009177 Ga0105248_10223925 Ga0105248_102239253 163
240 3300009177 Ga0105248_10729095 Ga0105248_107290952 163
241 3300010159 Ga0099796_10078789 Ga0099796_100787891 163
242 3300010375 Ga0105239_12058203 Ga0105239_120582031 163
243 3300013105 Ga0157369_10368288 Ga0157369_103682882 163
244 3300013297 Ga0157378_10021567 Ga0157378_100215674 163
245 3300013308 Ga0157375_11493747 Ga0157375_114937472 163
246 3300014325 Ga0163163_10119943 Ga0163163_101199432 163
247 3300014325 Ga0163163_10146429 Ga0163163_101464292 163
248 3300014325 Ga0163163_12505770 Ga0163163_125057701 163
249 3300014326 Ga0157380_10355191 Ga0157380_103551913 163
250 3300014969 Ga0157376_11071454 Ga0157376_110714541 163
251 3300025273 Ga0209673_1042076 Ga0209673_10420762 163
252 3300025899 Ga0207642_10039317 Ga0207642_100393172 163
253 3300025906 Ga0207699_10018712 Ga0207699_100187122 163
254 3300025908 Ga0207643_10033643 Ga0207643_100336433 163
255 3300025908 Ga0207643_10744927 Ga0207643_107449271 163
256 3300025914 Ga0207671_10191419 Ga0207671_101914193 163
257 3300025915 Ga0207693_10000771 Ga0207693_1000077120 163
258 3300025916 Ga0207663_10453632 Ga0207663_104536322 163
259 3300025931 Ga0207644_10043133 Ga0207644_100431334 163
260 3300025932 Ga0207690_11166502 Ga0207690_111665021 163
261 3300025933 Ga0207706_10054084 Ga0207706_100540843 163
262 3300025934 Ga0207686_10210790 Ga0207686_102107902 163
263 3300025936 Ga0207670_10433342 Ga0207670_104333422 163
264 3300025937 Ga0207669_11161948 Ga0207669_111619481 163
265 3300025938 Ga0207704_10358848 Ga0207704_103588482 163
266 3300025939 Ga0207665_10002506 Ga0207665_100025064 163
267 3300025941 Ga0207711_10274485 Ga0207711_102744853 163
268 3300025945 Ga0207679_10175489 Ga0207679_101754892 163
269 3300025960 Ga0207651_10437842 Ga0207651_104378422 163
270 3300025961 Ga0207712_10380013 Ga0207712_103800132 163
271 3300025972 Ga0207668_10034076 Ga0207668_100340762 163
272 3300025972 Ga0207668_10172380 Ga0207668_101723803 163
273 3300025972 Ga0207668_10427754 Ga0207668_104277542 163
274 3300025986 Ga0207658_10071799 Ga0207658_100717992 163
275 3300025986 Ga0207658_10258780 Ga0207658_102587802 163
276 3300026035 Ga0207703_10089322 Ga0207703_100893224 163
277 3300026035 Ga0207703_10703885 Ga0207703_107038852 163
278 3300026035 Ga0207703_11104183 Ga0207703_111041832 163
279 3300026067 Ga0207678_10013351 Ga0207678_100133518 163
280 3300026075 Ga0207708_10061648 Ga0207708_100616483 163
281 3300026088 Ga0207641_10192423 Ga0207641_101924234 163
282 3300026088 Ga0207641_10997840 Ga0207641_109978401 163
283 3300026095 Ga0207676_10259657 Ga0207676_102596572 163
284 3300026142 Ga0207698_10026087 Ga0207698_100260873 163
285 3300027512 Ga0209179_1058808 Ga0209179_10588081 163
286 3300028379 Ga0268266_10022186 Ga0268266_100221865 163
287 3300028381 Ga0268264_11427480 Ga0268264_114274802 163
288 3300035241 Ga0373961_0073017 Ga0373961_0073017_299_796 163
289 3300037471 Ga0395905_0632697 Ga0395905_0632697_424_915 163
290 3300041413 Ga0439465_0001890 Ga0439465_0001890_2090_2587 163
291 3300041507 Ga0451851_0035895 Ga0451851_0035895_53_550 163
292 3300041509 Ga0451843_1458389 Ga0451843_1458389_204_713 163
293 3300042435 Ga0439434_0034004 Ga0439434_0034004_460_957 163
294 3300042436 Ga0439435_0067652 Ga0439435_0067652_245_742 163
295 3300044658 Ga0466972_0029543 Ga0466972_0029543_2081_2572 163
296 3300044658 Ga0466972_0087140 Ga0466972_0087140_886_1377 163
297 3300044658 Ga0466972_0108762 Ga0466972_0108762_206_697 163
298 3300044658 Ga0466972_0220986 Ga0466972_0220986_228_719 163
299 3300044735 Ga0466968_0026654 Ga0466968_0026654_550_1041 163
300 3300044735 Ga0466968_0089099 Ga0466968_0089099_106_597 163
301 3300044735 Ga0466968_0453057 Ga0466968_0453057_14_529 163
302 3300044901 Ga0466960_0051492 Ga0466960_0051492_533_1024 163
303 3300044901 Ga0466960_0229993 Ga0466960_0229993_250_741 163
304 3300045049 Ga0466959_0194763 Ga0466959_0194763_648_1139 163
305 3300045976 Ga0466967_0008716 Ga0466967_0008716_5214_5711 163
306 3300045976 Ga0466967_0506615 Ga0466967_0506615_343_840 163
307 3300045976 Ga0466967_0519456 Ga0466967_0519456_212_703 163
308 3300046459 Ga0495629_0040272 Ga0495629_0040272_671_1168 163
309 3300046461 Ga0495641_0027228 Ga0495641_0027228_1667_2164 163
310 3300046473 Ga0495582_0120795 Ga0495582_0120795_198_695 163
311 3300046476 Ga0495662_0075464 Ga0495662_0075464_552_1049 163
312 3300046499 Ga0495594_0059010 Ga0495594_0059010_459_956 163
313 3300046526 Ga0495666_0114731 Ga0495666_0114731_320_817 163
314 3300046531 Ga0495665_0071847 Ga0495665_0071847_29_526 163
315 3300046533 Ga0495640_0021572 Ga0495640_0021572_3454_3951 163
316 3300046616 Ga0495668_0668130 Ga0495668_0668130_20_517 163
317 3300046692 Ga0495671_0430681 Ga0495671_0430681_20_517 163
318 3300046694 Ga0495649_0175013 Ga0495649_0175013_264_761 163
319 3300046694 Ga0495649_0401146 Ga0495649_0401146_111_602 163
320 3300047315 Ga0495581_0039376 Ga0495581_0039376_1676_2173 163
321 3300047673 Ga0495593_0006211 Ga0495593_0006211_4597_5094 163
322 3300048903 Ga0496100_0037765 Ga0496100_0037765_2280_2777 163
323 3300048903 Ga0496100_0242678 Ga0496100_0242678_809_1300 163
324 3300048904 Ga0496101_0080032 Ga0496101_0080032_1783_2274 163
325 3300048905 Ga0496102_0002030 Ga0496102_0002030_15664_16155 163
326 3300048905 Ga0496102_0126813 Ga0496102_0126813_1581_2078 163
327 3300048905 Ga0496102_0195549 Ga0496102_0195549_142_633 163
328 3300048906 Ga0496103_0128564 Ga0496103_0128564_602_1093 163
329 3300048907 Ga0496104_0015016 Ga0496104_0015016_1273_1764 163
330 3300048907 Ga0496104_0368541 Ga0496104_0368541_636_1145 163
331 3300048908 Ga0496105_0068811 Ga0496105_0068811_273_764 163
332 3300048909 Ga0496106_0029597 Ga0496106_0029597_442_939 163
333 3300048909 Ga0496106_0221819 Ga0496106_0221819_238_735 163
334 3300048909 Ga0496106_0810996 Ga0496106_0810996_16_507 163
335 3300048910 Ga0496107_0473571 Ga0496107_0473571_97_606 163
336 3300048910 Ga0496107_0496674 Ga0496107_0496674_139_636 163
337 3300048911 Ga0496108_0193960 Ga0496108_0193960_522_1031 163
338 3300048912 Ga0496109_0412840 Ga0496109_0412840_542_1051 163
339 3300048913 Ga0496110_0136439 Ga0496110_0136439_1110_1601 163
340 3300048913 Ga0496110_0586094 Ga0496110_0586094_419_928 163
341 3300048914 Ga0496111_0118958 Ga0496111_0118958_874_1365 163
342 3300048915 Ga0496112_0027671 Ga0496112_0027671_2154_2645 163
343 3300048915 Ga0496112_0067639 Ga0496112_0067639_623_1132 163
344 3300048915 Ga0496112_0104996 Ga0496112_0104996_2248_2745 163
345 3300048916 Ga0496113_0064720 Ga0496113_0064720_413_922 163
346 3300048917 Ga0496114_0151301 Ga0496114_0151301_43_540 163
347 3300048917 Ga0496114_0595744 Ga0496114_0595744_264_761 163
348 3300049571 Ga0501034_0104716 Ga0501034_0104716_2032_2523 163
349 3300049587 Ga0501071_0703526 Ga0501071_0703526_161_718 163
350 3300049589 Ga0501073_0470629 Ga0501073_0470629_264_761 163
351 3300049592 Ga0501076_0667913 Ga0501076_0667913_100_657 163
352 3300049592 Ga0501076_0770255 Ga0501076_0770255_44_619 163
353 3300049742 Ga0501080_0469927 Ga0501080_0469927_560_1057 163
354 3300050489 nmdc:mga03683_1900_c1 nmdc:mga03683_1900_c1_5018_5515 163
355 3300050490 nmdc:mga03n38_296917_c1 nmdc:mga03n38_296917_c1_196_687 163
356 3300050490 nmdc:mga03n38_57560_c1 nmdc:mga03n38_57560_c1_12_521 163
357 3300050491 nmdc:mga00v17_258426_c1 nmdc:mga00v17_258426_c1_425_916 163
358 3300050491 nmdc:mga00v17_709_c1 nmdc:mga00v17_709_c1_11687_12184 163
359 3300050492 nmdc:mga0yw44_115335_c1 nmdc:mga0yw44_115335_c1_1023_1520 163
360 3300050492 nmdc:mga0yw44_133605_c1 nmdc:mga0yw44_133605_c1_305_796 163
361 3300050496 nmdc:mga07m45_511871_c1 nmdc:mga07m45_511871_c1_15_506 163
362 3300050509 nmdc:mga0qj67_72636_c1 nmdc:mga0qj67_72636_c1_851_1348 163
363 3300050516 nmdc:mga0sz30_338_c1 nmdc:mga0sz30_338_c1_4000_4497 163
364 3300053077 Ga0495601_0407408 Ga0495601_0407408_192_689 163

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00255

GSHPx

Glutathione peroxidase

23

130

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cmi-assembly1.cif.gz_A crystal structure of glutathione-dependent phospholipid peroxidase hyr1 from the yeast saccharomyces cerevisiae 0.9214 4 160
2v1m-assembly1.cif.gz_A crystal structure of schistosoma mansoni glutathione peroxidase 0.9169 1 163
2p5q-assembly2.cif.gz_D crystal structure of the poplar glutathione peroxidase 5 in the reduced form 0.9074 3 160
5l71-assembly1.cif.gz_A crystal structure of mouse phospholipid hydroperoxide glutathione peroxidase 4 (gpx4) 0.902 1 161
2wgr-assembly1.cif.gz_A combining crystallography and molecular dynamics: the case of schistosoma mansoni phospholipid glutathione peroxidase 0.8997 1 160
ID Description Score Start End Superfamily
af_Q2FUZ6_1_164_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9276 2 160 3.40.30.10
af_Q4CY93_66_221_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9271 3 160 3.40.30.10
af_O59858_1_158_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9245 1 161 3.40.30.10
af_P06610_1_183_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.922 3 160 3.40.30.10
af_O59858_1_158_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9189 1 161 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A839QE42-F1-model_v4 Glutathione peroxidase 0.9788 1 163 GO:0004601
GO:0034599
AF-A0A4Y9MQB4-F1-model_v4 Glutathione peroxidase 0.9779 2 163 GO:0004601
GO:0034599
AF-A0A1A3ID35-F1-model_v4 Glutathione peroxidase 0.9763 2 163 GO:0004601
GO:0034599
AF-A0A7I9YSB1-F1-model_v4 Glutathione peroxidase 0.9749 2 163 GO:0004601
GO:0034599
AF-A0A429BCQ9-F1-model_v4 Glutathione peroxidase 0.9749 2 161 GO:0004601
GO:0034599

Feature Viewer

pLDDT pTM Quality
90.56 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map