F423478

General Info

Members Datasets Scaffolds Average Seq Length
364 178 728 306

Family's Representative Sequence

Representative Sequence 3300049686|Ga0501257_022868|Ga0501257_022868_376_1389
Length 337
Sequence VYLPISSGQPESNIAHYSSFNQKFVINSIRVQAPATVANLVCGFDVLGLCLHEPYDIMEVRLLDEPVIKVQSADGYPLPTDPQRNTAGAPLVEMVKELDNAVGFEVLIYKHIKPGSGIGSSAASAAGAVVAANMLLGDKFSKEDLVRFSMFGEKVASGVKHADNTAPCIYGGITLIRSIFPLDIVTIPAPDLYVTVVHPQIEVKTADARQILRKEVLLKDAIKQWGNIAGLVAGFMKNDYDLIGRSLEDVIIEPVRSILIPGFDEVKRKSKEAGALGGGISGSGPSIFMLSKEKSTAQAVAQLMNEIYDRIGLARHTYVTKINQQGVSLAPTLTPSP

Samples

Sample ID Description Type Environment
1 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
118 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
119 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
120 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
124 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
125 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
126 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
127 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
128 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
129 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
130 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
133 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
134 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
135 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
136 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
137 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
138 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
139 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
140 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
141 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
142 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
143 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
144 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
156 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
157 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
158 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
159 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
160 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
161 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
162 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
163 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
164 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
165 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
166 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
167 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
168 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
169 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
173 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
174 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
175 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
176 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
177 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
178 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.37
Nodule 0
Rhizoplane 1.65
Rhizosphere 95.05
Stem 0
Stem Tuber 0
Unclassified 7.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501257_022868 3300049686 Unclassified 1481
2 MRS1b_contig_9223337 2162886011 Bacteria 2542
3 rootH2_10023511 3300003320 Bacteria 4967
4 rootH2_10044355 3300003320 Bacteria 16852
5 rootH1_10002604 3300003323 Bacteria 1816
6 rootH1_10175403 3300003323 Bacteria 1958
7 Ga0065712_10013955 3300005290 Bacteria 1972
8 Ga0070658_10011093 3300005327 Bacteria 7225
9 Ga0070658_10306842 3300005327 Bacteria 1354
10 Ga0070676_10000482 3300005328 Bacteria 19052
11 Ga0070670_100006973 3300005331 Bacteria 9577
12 Ga0070670_100017080 3300005331 Bacteria 6227
13 Ga0070670_100021315 3300005331 Bacteria 5575
14 Ga0068869_100034213 3300005334 Bacteria 3593
15 Ga0070666_10000255 3300005335 Bacteria 35413
16 Ga0070666_10000303 3300005335 Bacteria 31938
17 Ga0070666_10180217 3300005335 Unclassified 1481
18 Ga0070680_100000212 3300005336 Bacteria 38186
19 Ga0070682_100000651 3300005337 Bacteria 21124
20 Ga0068868_100000177 3300005338 Bacteria 42348
21 Ga0068868_100024303 3300005338 Bacteria 4596
22 Ga0070660_100026994 3300005339 Bacteria 4281
23 Ga0070660_100267640 3300005339 Bacteria 1396
24 Ga0070691_10000353 3300005341 Bacteria 16446
25 Ga0070691_10016200 3300005341 Bacteria 3424
26 Ga0070668_100000022 3300005347 Bacteria 96336
27 Ga0070675_100129413 3300005354 Bacteria 2150
28 Ga0070671_100005813 3300005355 Bacteria 9824
29 Ga0070671_100154621 3300005355 Bacteria 1938
30 Ga0070671_100389764 3300005355 Bacteria 1191
31 Ga0070673_100005305 3300005364 Bacteria 8234
32 Ga0070673_100096211 3300005364 Bacteria 2430
33 Ga0070673_100310038 3300005364 Unclassified 1392
34 Ga0070667_100000584 3300005367 Bacteria 36027
35 Ga0070667_100048606 3300005367 Bacteria 3571
36 Ga0070663_100295299 3300005455 Bacteria 1295
37 Ga0070678_100048936 3300005456 Bacteria 3048
38 Ga0070678_100200074 3300005456 Bacteria 1648
39 Ga0070662_100053730 3300005457 Bacteria 2917
40 Ga0070681_10001590 3300005458 Bacteria 20192
41 Ga0068867_100001330 3300005459 Bacteria 17113
42 Ga0068867_100545559 3300005459 Unclassified 1003
43 Ga0070706_100297391 3300005467 Unclassified 1506
44 Ga0070679_100000449 3300005530 Bacteria 34845
45 Ga0070684_100110722 3300005535 Unclassified 2462
46 Ga0068853_100002341 3300005539 Bacteria 14167
47 Ga0068853_100010878 3300005539 Bacteria 7370
48 Ga0068853_100163507 3300005539 Unclassified 2010
49 Ga0070672_100011820 3300005543 Bacteria 6098
50 Ga0070672_100062930 3300005543 Bacteria 2930
51 Ga0070672_100234530 3300005543 Bacteria 1542
52 Ga0070672_100268042 3300005543 Bacteria 1441
53 Ga0070665_100000001 3300005548 Bacteria 1083363
54 Ga0070665_100001573 3300005548 Bacteria 26325
55 Ga0070665_100096881 3300005548 Bacteria 2955
56 Ga0070665_100262447 3300005548 Bacteria 1728
57 Ga0068855_100001266 3300005563 Bacteria 31334
58 Ga0068855_100005257 3300005563 Bacteria 15802
59 Ga0068855_100019457 3300005563 Bacteria 8157
60 Ga0068855_100029392 3300005563 Bacteria 6572
61 Ga0068855_100103199 3300005563 Bacteria 3281
62 Ga0068857_100010483 3300005577 Bacteria 8055
63 Ga0068854_100009641 3300005578 Bacteria 6236
64 Ga0068856_100082210 3300005614 Bacteria 3196
65 Ga0068856_100215791 3300005614 Bacteria 1934
66 Ga0068856_100235048 3300005614 Bacteria 1848
67 Ga0068852_100004990 3300005616 Bacteria 9438
68 Ga0068852_100089828 3300005616 Bacteria 2746
69 Ga0068852_100143660 3300005616 Bacteria 2211
70 Ga0068859_100000247 3300005617 Bacteria 53389
71 Ga0068859_100014659 3300005617 Bacteria 7877
72 Ga0068859_100019731 3300005617 Bacteria 6769
73 Ga0068864_100003769 3300005618 Bacteria 12510
74 Ga0068864_100018634 3300005618 Bacteria 5801
75 Ga0068864_100085411 3300005618 Bacteria 2775
76 Ga0068864_100260383 3300005618 Unclassified 1613
77 Ga0068851_10000712 3300005834 Bacteria 14185
78 Ga0068851_10013478 3300005834 Bacteria 3869
79 Ga0068851_10021229 3300005834 Bacteria 3153
80 Ga0068851_10244301 3300005834 Bacteria 1016
81 Ga0068863_100000814 3300005841 Bacteria 31294
82 Ga0068863_100053995 3300005841 Bacteria 3808
83 Ga0068863_100082630 3300005841 Bacteria 3044
84 Ga0068858_100000833 3300005842 Bacteria 32109
85 Ga0068858_100005778 3300005842 Bacteria 12085
86 Ga0068860_100000241 3300005843 Bacteria 83429
87 Ga0068860_100001094 3300005843 Bacteria 29839
88 Ga0068860_100003044 3300005843 Bacteria 17315
89 Ga0068860_100004313 3300005843 Bacteria 14544
90 Ga0068860_100004599 3300005843 Bacteria 14090
91 Ga0068860_100005767 3300005843 Bacteria 12483
92 Ga0068860_100039620 3300005843 Bacteria 4507
93 Ga0097621_100000027 3300006237 Bacteria 71873
94 Ga0097621_100000334 3300006237 Bacteria 32025
95 Ga0097621_100019469 3300006237 Bacteria 5209
96 Ga0068871_100000107 3300006358 Bacteria 50575
97 Ga0068871_100003628 3300006358 Bacteria 10607
98 Ga0068871_100029630 3300006358 Bacteria 4300
99 Ga0075431_100000860 3300006847 Bacteria 26641
100 Ga0075429_100027974 3300006880 Bacteria 4894
101 Ga0068865_100000903 3300006881 Bacteria 16851
102 Ga0068865_100149259 3300006881 Bacteria 1772
103 Ga0068865_100183021 3300006881 Bacteria 1615
104 Ga0097620_100000247 3300006931 Bacteria 53389
105 Ga0097620_100014659 3300006931 Bacteria 7877
106 Ga0097620_100019731 3300006931 Bacteria 6769
107 Ga0105240_10000205 3300009093 Bacteria 120767
108 Ga0105240_10001870 3300009093 Bacteria 35026
109 Ga0105240_10002165 3300009093 Bacteria 32084
110 Ga0105240_10012089 3300009093 Bacteria 11963
111 Ga0105240_10017549 3300009093 Bacteria 9642
112 Ga0105240_10052214 3300009093 Bacteria 5140
113 Ga0105240_10432076 3300009093 Bacteria 1477
114 Ga0111539_10075944 3300009094 Bacteria 3957
115 Ga0105247_10017620 3300009101 Bacteria 4284
116 Ga0105247_10380129 3300009101 Unclassified 1001
117 Ga0114129_10063929 3300009147 Bacteria 5135
118 Ga0105241_10000105 3300009174 Bacteria 60020
119 Ga0105241_10012079 3300009174 Bacteria 6344
120 Ga0105241_10015035 3300009174 Bacteria 5670
121 Ga0105242_10046972 3300009176 Bacteria 3504
122 Ga0105248_10028207 3300009177 Bacteria 6252
123 Ga0105237_10002388 3300009545 Bacteria 23306
124 Ga0105237_10004596 3300009545 Bacteria 15930
125 Ga0105237_10008055 3300009545 Bacteria 11458
126 Ga0105237_10008669 3300009545 Bacteria 10987
127 Ga0105237_10063703 3300009545 Bacteria 3685
128 Ga0105237_10065320 3300009545 Bacteria 3635
129 Ga0105238_10028973 3300009551 Bacteria 5640
130 Ga0105238_10103259 3300009551 Unclassified 2832
131 Ga0105249_10001921 3300009553 Bacteria 18039
132 Ga0105249_10005977 3300009553 Bacteria 10546
133 Ga0105249_10149918 3300009553 Bacteria 2244
134 Ga0105249_10319296 3300009553 Unclassified 1564
135 Ga0105239_10000169 3300010375 Bacteria 93659
136 Ga0105239_10003411 3300010375 Bacteria 19482
137 Ga0105239_10091247 3300010375 Bacteria 3361
138 Ga0105239_10094944 3300010375 Bacteria 3294
139 Ga0105239_10126880 3300010375 Bacteria 2836
140 Ga0105239_10285637 3300010375 Unclassified 1858
141 Ga0105239_10412033 3300010375 Unclassified 1530
142 Ga0157373_10022579 3300013100 Bacteria 4563
143 Ga0157373_10027902 3300013100 Bacteria 4073
144 Ga0157371_10001641 3300013102 Bacteria 22885
145 Ga0157371_10004856 3300013102 Bacteria 11558
146 Ga0157371_10006479 3300013102 Bacteria 9650
147 Ga0157371_10027217 3300013102 Bacteria 4149
148 Ga0157370_10000702 3300013104 Bacteria 41838
149 Ga0157370_10000703 3300013104 Bacteria 41837
150 Ga0157370_10026243 3300013104 Bacteria 5755
151 Ga0157370_10050150 3300013104 Bacteria 3991
152 Ga0157369_10152075 3300013105 Bacteria 2446
153 Ga0157369_10305308 3300013105 Bacteria 1655
154 Ga0157374_10000001 3300013296 Bacteria 1077351
155 Ga0157374_10000467 3300013296 Bacteria 36724
156 Ga0157374_10078107 3300013296 Bacteria 3134
157 Ga0157374_10260353 3300013296 Bacteria 1708
158 Ga0157378_10002717 3300013297 Bacteria 15754
159 Ga0157378_10022907 3300013297 Bacteria 5498
160 Ga0157378_10024286 3300013297 Bacteria 5331
161 Ga0157378_10025029 3300013297 Bacteria 5258
162 Ga0157378_10070200 3300013297 Bacteria 3144
163 Ga0157378_10564741 3300013297 Bacteria 1145
164 Ga0163162_10000340 3300013306 Bacteria 42478
165 Ga0163162_10000437 3300013306 Bacteria 38437
166 Ga0163162_10001521 3300013306 Bacteria 21604
167 Ga0163162_10001753 3300013306 Bacteria 20336
168 Ga0163162_10008132 3300013306 Bacteria 10235
169 Ga0163162_10063114 3300013306 Bacteria 3746
170 Ga0157372_10000644 3300013307 Bacteria 38351
171 Ga0157372_10003379 3300013307 Bacteria 17218
172 Ga0157372_10031485 3300013307 Bacteria 5808
173 Ga0157372_10034675 3300013307 Bacteria 5551
174 Ga0157372_10056404 3300013307 Bacteria 4389
175 Ga0157372_10062984 3300013307 Bacteria 4157
176 Ga0157372_10110167 3300013307 Unclassified 3153
177 Ga0157372_10189061 3300013307 Bacteria 2385
178 Ga0157372_10259804 3300013307 Bacteria 2017
179 Ga0157372_10468593 3300013307 Unclassified 1468
180 Ga0157372_10547285 3300013307 Bacteria 1349
181 Ga0157372_10661048 3300013307 Bacteria 1217
182 Ga0157375_10000336 3300013308 Bacteria 42479
183 Ga0157375_10002556 3300013308 Bacteria 15797
184 Ga0157375_10002777 3300013308 Bacteria 15151
185 Ga0157375_10119400 3300013308 Bacteria 2744
186 Ga0163163_10000193 3300014325 Bacteria 62699
187 Ga0163163_10000349 3300014325 Bacteria 44503
188 Ga0163163_10008831 3300014325 Bacteria 8972
189 Ga0163163_10089599 3300014325 Bacteria 3089
190 Ga0157377_10037358 3300014745 Unclassified 2675
191 Ga0157379_10000068 3300014968 Bacteria 65388
192 Ga0157379_10023396 3300014968 Bacteria 5483
193 Ga0157379_10202453 3300014968 Unclassified 1795
194 Ga0157379_10229665 3300014968 Unclassified 1682
195 Ga0157376_10000409 3300014969 Bacteria 27934
196 Ga0157376_10000459 3300014969 Bacteria 26332
197 Ga0157376_10000885 3300014969 Bacteria 19631
198 Ga0157376_10076547 3300014969 Bacteria 2859
199 Ga0163161_10003586 3300017792 Bacteria 10876
200 Ga0163161_10028518 3300017792 Bacteria 3965
201 Ga0207656_10001833 3300025321 Bacteria 7052
202 Ga0207656_10030340 3300025321 Bacteria 2233
203 Ga0207656_10032820 3300025321 Bacteria 2158
204 Ga0207680_10000085 3300025903 Bacteria 42718
205 Ga0207680_10000358 3300025903 Bacteria 21841
206 Ga0207680_10123575 3300025903 Unclassified 1696
207 Ga0207645_10003059 3300025907 Bacteria 12845
208 Ga0207705_10026376 3300025909 Bacteria 4144
209 Ga0207654_10000515 3300025911 Bacteria 22188
210 Ga0207654_10007235 3300025911 Bacteria 5592
211 Ga0207654_10011995 3300025911 Bacteria 4432
212 Ga0207707_10000508 3300025912 Bacteria 39968
213 Ga0207695_10000232 3300025913 Bacteria 147559
214 Ga0207695_10000962 3300025913 Bacteria 51331
215 Ga0207695_10001292 3300025913 Bacteria 42510
216 Ga0207695_10003781 3300025913 Bacteria 21001
217 Ga0207695_10016987 3300025913 Bacteria 8490
218 Ga0207695_10099924 3300025913 Bacteria 2898
219 Ga0207695_10171505 3300025913 Bacteria 2095
220 Ga0207671_10000638 3300025914 Bacteria 45890
221 Ga0207671_10026880 3300025914 Bacteria 4305
222 Ga0207671_10039379 3300025914 Bacteria 3500
223 Ga0207671_10157777 3300025914 Bacteria 1756
224 Ga0207660_10000325 3300025917 Bacteria 30850
225 Ga0207657_10134250 3300025919 Bacteria 2026
226 Ga0207657_10234797 3300025919 Bacteria 1466
227 Ga0207649_10068188 3300025920 Bacteria 2261
228 Ga0207652_10000186 3300025921 Bacteria 65493
229 Ga0207681_10363244 3300025923 Bacteria 1162
230 Ga0207694_10082043 3300025924 Bacteria 2534
231 Ga0207694_10098284 3300025924 Bacteria 2317
232 Ga0207650_10006263 3300025925 Bacteria 8110
233 Ga0207650_10230407 3300025925 Bacteria 1494
234 Ga0207659_10017495 3300025926 Unclassified 4684
235 Ga0207659_10166022 3300025926 Bacteria 1737
236 Ga0207644_10003727 3300025931 Bacteria 9880
237 Ga0207690_10046791 3300025932 Bacteria 2867
238 Ga0207690_10204170 3300025932 Bacteria 1503
239 Ga0207690_10311340 3300025932 Bacteria 1235
240 Ga0207706_10021840 3300025933 Bacteria 5744
241 Ga0207686_10121491 3300025934 Bacteria 1779
242 Ga0207686_10198296 3300025934 Unclassified 1436
243 Ga0207704_10011901 3300025938 Bacteria 4302
244 Ga0207691_10000113 3300025940 Bacteria 72765
245 Ga0207691_10108244 3300025940 Bacteria 2474
246 Ga0207691_10392906 3300025940 Bacteria 1183
247 Ga0207689_10000776 3300025942 Bacteria 30612
248 Ga0207661_10011033 3300025944 Bacteria 6531
249 Ga0207661_10143605 3300025944 Unclassified 2056
250 Ga0207667_10000111 3300025949 Bacteria 131758
251 Ga0207667_10018400 3300025949 Bacteria 7835
252 Ga0207667_10115800 3300025949 Bacteria 2763
253 Ga0207651_10019558 3300025960 Bacteria 4061
254 Ga0207712_10328035 3300025961 Bacteria 1265
255 Ga0207668_10003018 3300025972 Bacteria 9866
256 Ga0207640_10005000 3300025981 Bacteria 7207
257 Ga0207658_10000759 3300025986 Bacteria 27690
258 Ga0207658_10297964 3300025986 Unclassified 1388
259 Ga0207677_10002156 3300026023 Bacteria 10341
260 Ga0207703_10000316 3300026035 Bacteria 52401
261 Ga0207703_10022909 3300026035 Bacteria 4905
262 Ga0207639_10006342 3300026041 Bacteria 8031
263 Ga0207639_10065311 3300026041 Bacteria 2824
264 Ga0207702_10124029 3300026078 Bacteria 2316
265 Ga0207641_10000044 3300026088 Bacteria 183824
266 Ga0207641_10003955 3300026088 Bacteria 12949
267 Ga0207648_10002305 3300026089 Bacteria 20617
268 Ga0207648_10021658 3300026089 Bacteria 5775
269 Ga0207648_10267767 3300026089 Bacteria 1526
270 Ga0207648_10540837 3300026089 Unclassified 1069
271 Ga0207676_10002046 3300026095 Bacteria 14629
272 Ga0207676_10013328 3300026095 Bacteria 5905
273 Ga0207676_10047178 3300026095 Bacteria 3337
274 Ga0207674_10006948 3300026116 Bacteria 13256
275 Ga0207675_100056317 3300026118 Bacteria 3667
276 Ga0207698_10147606 3300026142 Bacteria 2036
277 Ga0207428_10192666 3300027907 Bacteria 1536
278 Ga0268266_10000102 3300028379 Bacteria 179754
279 Ga0268266_10001351 3300028379 Bacteria 29632
280 Ga0268266_10220633 3300028379 Bacteria 1743
281 Ga0268266_10223682 3300028379 Bacteria 1731
282 Ga0268264_10000011 3300028381 Bacteria 580884
283 Ga0268264_10002199 3300028381 Bacteria 17321
284 Ga0268264_10010083 3300028381 Bacteria 7821
285 Ga0268264_10011615 3300028381 Bacteria 7264
286 Ga0268264_10038944 3300028381 Bacteria 3926
287 Ga0268264_10047319 3300028381 Bacteria 3576
288 Ga0268264_10067927 3300028381 Bacteria 3010
289 Ga0268264_10240513 3300028381 Bacteria 1676
290 Ga0307515_10043192 3300028794 Bacteria 7018
291 Ga0307511_10000673 3300030521 Bacteria 36415
292 Ga0265327_10015202 3300031251 Bacteria 4985
293 Ga0265327_10066587 3300031251 Bacteria 1817
294 Ga0307510_10000119 3300033180 Bacteria 62835
295 Ga0395900_0017583 3300037418 Bacteria 7295
296 Ga0395900_0093960 3300037418 Bacteria 3080
297 Ga0395905_0003880 3300037471 Bacteria 15776
298 Ga0395905_0275557 3300037471 Bacteria 1568
299 Ga0439433_0003047 3300041999 Bacteria 3587
300 Ga0439449_0001158 3300042007 Bacteria 10342
301 Ga0451577_0295605 3300042876 Unclassified 1468
302 Ga0466972_0002248 3300044658 Bacteria 9484
303 Ga0453683_0021430 3300044673 Bacteria 4127
304 Ga0466961_0019008 3300044693 Bacteria 4421
305 Ga0453684_0041468 3300044712 Bacteria 6225
306 Ga0466970_0001780 3300044765 Bacteria 10384
307 Ga0466959_0001234 3300045049 Bacteria 15445
308 Ga0466959_0310093 3300045049 Bacteria 1080
309 Ga0495629_0131426 3300046459 Bacteria 1744
310 Ga0495638_0026545 3300046460 Bacteria 3753
311 Ga0495580_0050727 3300046472 Unclassified 2934
312 Ga0495606_0034164 3300046507 Bacteria 3494
313 Ga0495648_0011458 3300046524 Bacteria 6676
314 Ga0495621_0017846 3300046539 Unclassified 2299
315 Ga0495668_0000459 3300046616 Bacteria 52226
316 Ga0495611_0001221 3300046648 Bacteria 13277
317 Ga0495687_000001 3300047443 Bacteria 1215582
318 Ga0495684_0080147 3300047471 Bacteria 2479
319 Ga0495686_0000004 3300047472 Bacteria 869019
320 Ga0495602_0194814 3300048088 Bacteria 1551
321 Ga0496101_0017853 3300048904 Bacteria 4816
322 Ga0496104_0194274 3300048907 Bacteria 1942
323 Ga0496109_0149435 3300048912 Bacteria 2187
324 Ga0496109_0166542 3300048912 Bacteria 2067
325 Ga0496115_0167731 3300048918 Unclassified 1816
326 Ga0496115_0168023 3300048918 Bacteria 1814
327 Ga0501032_0002459 3300049569 Bacteria 14470
328 Ga0501034_0023567 3300049571 Bacteria 6271
329 Ga0501036_0134632 3300049572 Bacteria 2086
330 Ga0501036_0338559 3300049572 Bacteria 1256
331 Ga0501037_0194740 3300049573 Bacteria 1434
332 Ga0501037_0373725 3300049573 Bacteria 981
333 Ga0501039_0053545 3300049575 Bacteria 3123
334 Ga0501043_0037711 3300049579 Bacteria 3801
335 Ga0501043_0096620 3300049579 Bacteria 2322
336 Ga0501047_0007018 3300049581 Bacteria 10574
337 Ga0501070_0154377 3300049586 Bacteria 1893
338 Ga0501074_0108542 3300049590 Bacteria 1986
339 Ga0501201_003142 3300049651 Bacteria 1517
340 Ga0501202_012548 3300049652 Bacteria 1601
341 Ga0501217_003301 3300049661 Bacteria 3251
342 Ga0501223_006912 3300049663 Bacteria 2330
343 Ga0501233_006729 3300049668 Bacteria 2168
344 Ga0501243_000019 3300049675 Bacteria 14232
345 Ga0501252_002800 3300049682 Bacteria 1760
346 Ga0501221_010522 3300049704 Bacteria 1644
347 Ga0501245_002804 3300049708 Bacteria 2342
348 Ga0501080_0131485 3300049742 Bacteria 2317
349 Ga0501083_0037936 3300049744 Bacteria 3277
350 Ga0501268_023023 3300049765 Bacteria 1079
351 Ga0501035_0028117 3300049822 Bacteria 5135
352 Ga0501044_0039783 3300049823 Bacteria 4903
353 Ga0501044_0046021 3300049823 Bacteria 4519
354 Ga0501044_0075203 3300049823 Bacteria 3429
355 Ga0501044_0181878 3300049823 Bacteria 2069
356 nmdc:mga05p37_470209_c1 3300050507 Bacteria 1451
357 nmdc:mga06r32_10647_c1 3300050510 Bacteria 8296
358 Ga0500641_0033501 3300053096 Bacteria 2039
359 Ga0500568_0000580 3300053139 Bacteria 26583
360 Ga0500568_0040440 3300053139 Bacteria 1877
361 Ga0500588_0141539 3300053146 Unclassified 864
362 Ga0500622_0000782 3300053156 Bacteria 27616
363 Ga0501084_0107769 3300054114 Bacteria 2340
364 Ga0501082_0113199 3300060353 Bacteria 2349
365 Ga0501257_022868
366 MRS1b_contig_9223337
367 rootH2_10023511
368 rootH2_10044355
369 rootH1_10002604
370 rootH1_10175403
371 Ga0065712_10013955
372 Ga0070658_10011093
373 Ga0070658_10306842
374 Ga0070676_10000482
375 Ga0070670_100006973
376 Ga0070670_100017080
377 Ga0070670_100021315
378 Ga0068869_100034213
379 Ga0070666_10000255
380 Ga0070666_10000303
381 Ga0070666_10180217
382 Ga0070680_100000212
383 Ga0070682_100000651
384 Ga0068868_100000177
385 Ga0068868_100024303
386 Ga0070660_100026994
387 Ga0070660_100267640
388 Ga0070691_10000353
389 Ga0070691_10016200
390 Ga0070668_100000022
391 Ga0070675_100129413
392 Ga0070671_100005813
393 Ga0070671_100154621
394 Ga0070671_100389764
395 Ga0070673_100005305
396 Ga0070673_100096211
397 Ga0070673_100310038
398 Ga0070667_100000584
399 Ga0070667_100048606
400 Ga0070663_100295299
401 Ga0070678_100048936
402 Ga0070678_100200074
403 Ga0070662_100053730
404 Ga0070681_10001590
405 Ga0068867_100001330
406 Ga0068867_100545559
407 Ga0070706_100297391
408 Ga0070679_100000449
409 Ga0070684_100110722
410 Ga0068853_100002341
411 Ga0068853_100010878
412 Ga0068853_100163507
413 Ga0070672_100011820
414 Ga0070672_100062930
415 Ga0070672_100234530
416 Ga0070672_100268042
417 Ga0070665_100000001
418 Ga0070665_100001573
419 Ga0070665_100096881
420 Ga0070665_100262447
421 Ga0068855_100001266
422 Ga0068855_100005257
423 Ga0068855_100019457
424 Ga0068855_100029392
425 Ga0068855_100103199
426 Ga0068857_100010483
427 Ga0068854_100009641
428 Ga0068856_100082210
429 Ga0068856_100215791
430 Ga0068856_100235048
431 Ga0068852_100004990
432 Ga0068852_100089828
433 Ga0068852_100143660
434 Ga0068859_100000247
435 Ga0068859_100014659
436 Ga0068859_100019731
437 Ga0068864_100003769
438 Ga0068864_100018634
439 Ga0068864_100085411
440 Ga0068864_100260383
441 Ga0068851_10000712
442 Ga0068851_10013478
443 Ga0068851_10021229
444 Ga0068851_10244301
445 Ga0068863_100000814
446 Ga0068863_100053995
447 Ga0068863_100082630
448 Ga0068858_100000833
449 Ga0068858_100005778
450 Ga0068860_100000241
451 Ga0068860_100001094
452 Ga0068860_100003044
453 Ga0068860_100004313
454 Ga0068860_100004599
455 Ga0068860_100005767
456 Ga0068860_100039620
457 Ga0097621_100000027
458 Ga0097621_100000334
459 Ga0097621_100019469
460 Ga0068871_100000107
461 Ga0068871_100003628
462 Ga0068871_100029630
463 Ga0075431_100000860
464 Ga0075429_100027974
465 Ga0068865_100000903
466 Ga0068865_100149259
467 Ga0068865_100183021
468 Ga0097620_100000247
469 Ga0097620_100014659
470 Ga0097620_100019731
471 Ga0105240_10000205
472 Ga0105240_10001870
473 Ga0105240_10002165
474 Ga0105240_10012089
475 Ga0105240_10017549
476 Ga0105240_10052214
477 Ga0105240_10432076
478 Ga0111539_10075944
479 Ga0105247_10017620
480 Ga0105247_10380129
481 Ga0114129_10063929
482 Ga0105241_10000105
483 Ga0105241_10012079
484 Ga0105241_10015035
485 Ga0105242_10046972
486 Ga0105248_10028207
487 Ga0105237_10002388
488 Ga0105237_10004596
489 Ga0105237_10008055
490 Ga0105237_10008669
491 Ga0105237_10063703
492 Ga0105237_10065320
493 Ga0105238_10028973
494 Ga0105238_10103259
495 Ga0105249_10001921
496 Ga0105249_10005977
497 Ga0105249_10149918
498 Ga0105249_10319296
499 Ga0105239_10000169
500 Ga0105239_10003411
501 Ga0105239_10091247
502 Ga0105239_10094944
503 Ga0105239_10126880
504 Ga0105239_10285637
505 Ga0105239_10412033
506 Ga0157373_10022579
507 Ga0157373_10027902
508 Ga0157371_10001641
509 Ga0157371_10004856
510 Ga0157371_10006479
511 Ga0157371_10027217
512 Ga0157370_10000702
513 Ga0157370_10000703
514 Ga0157370_10026243
515 Ga0157370_10050150
516 Ga0157369_10152075
517 Ga0157369_10305308
518 Ga0157374_10000001
519 Ga0157374_10000467
520 Ga0157374_10078107
521 Ga0157374_10260353
522 Ga0157378_10002717
523 Ga0157378_10022907
524 Ga0157378_10024286
525 Ga0157378_10025029
526 Ga0157378_10070200
527 Ga0157378_10564741
528 Ga0163162_10000340
529 Ga0163162_10000437
530 Ga0163162_10001521
531 Ga0163162_10001753
532 Ga0163162_10008132
533 Ga0163162_10063114
534 Ga0157372_10000644
535 Ga0157372_10003379
536 Ga0157372_10031485
537 Ga0157372_10034675
538 Ga0157372_10056404
539 Ga0157372_10062984
540 Ga0157372_10110167
541 Ga0157372_10189061
542 Ga0157372_10259804
543 Ga0157372_10468593
544 Ga0157372_10547285
545 Ga0157372_10661048
546 Ga0157375_10000336
547 Ga0157375_10002556
548 Ga0157375_10002777
549 Ga0157375_10119400
550 Ga0163163_10000193
551 Ga0163163_10000349
552 Ga0163163_10008831
553 Ga0163163_10089599
554 Ga0157377_10037358
555 Ga0157379_10000068
556 Ga0157379_10023396
557 Ga0157379_10202453
558 Ga0157379_10229665
559 Ga0157376_10000409
560 Ga0157376_10000459
561 Ga0157376_10000885
562 Ga0157376_10076547
563 Ga0163161_10003586
564 Ga0163161_10028518
565 Ga0207656_10001833
566 Ga0207656_10030340
567 Ga0207656_10032820
568 Ga0207680_10000085
569 Ga0207680_10000358
570 Ga0207680_10123575
571 Ga0207645_10003059
572 Ga0207705_10026376
573 Ga0207654_10000515
574 Ga0207654_10007235
575 Ga0207654_10011995
576 Ga0207707_10000508
577 Ga0207695_10000232
578 Ga0207695_10000962
579 Ga0207695_10001292
580 Ga0207695_10003781
581 Ga0207695_10016987
582 Ga0207695_10099924
583 Ga0207695_10171505
584 Ga0207671_10000638
585 Ga0207671_10026880
586 Ga0207671_10039379
587 Ga0207671_10157777
588 Ga0207660_10000325
589 Ga0207657_10134250
590 Ga0207657_10234797
591 Ga0207649_10068188
592 Ga0207652_10000186
593 Ga0207681_10363244
594 Ga0207694_10082043
595 Ga0207694_10098284
596 Ga0207650_10006263
597 Ga0207650_10230407
598 Ga0207659_10017495
599 Ga0207659_10166022
600 Ga0207644_10003727
601 Ga0207690_10046791
602 Ga0207690_10204170
603 Ga0207690_10311340
604 Ga0207706_10021840
605 Ga0207686_10121491
606 Ga0207686_10198296
607 Ga0207704_10011901
608 Ga0207691_10000113
609 Ga0207691_10108244
610 Ga0207691_10392906
611 Ga0207689_10000776
612 Ga0207661_10011033
613 Ga0207661_10143605
614 Ga0207667_10000111
615 Ga0207667_10018400
616 Ga0207667_10115800
617 Ga0207651_10019558
618 Ga0207712_10328035
619 Ga0207668_10003018
620 Ga0207640_10005000
621 Ga0207658_10000759
622 Ga0207658_10297964
623 Ga0207677_10002156
624 Ga0207703_10000316
625 Ga0207703_10022909
626 Ga0207639_10006342
627 Ga0207639_10065311
628 Ga0207702_10124029
629 Ga0207641_10000044
630 Ga0207641_10003955
631 Ga0207648_10002305
632 Ga0207648_10021658
633 Ga0207648_10267767
634 Ga0207648_10540837
635 Ga0207676_10002046
636 Ga0207676_10013328
637 Ga0207676_10047178
638 Ga0207674_10006948
639 Ga0207675_100056317
640 Ga0207698_10147606
641 Ga0207428_10192666
642 Ga0268266_10000102
643 Ga0268266_10001351
644 Ga0268266_10220633
645 Ga0268266_10223682
646 Ga0268264_10000011
647 Ga0268264_10002199
648 Ga0268264_10010083
649 Ga0268264_10011615
650 Ga0268264_10038944
651 Ga0268264_10047319
652 Ga0268264_10067927
653 Ga0268264_10240513
654 Ga0307515_10043192
655 Ga0307511_10000673
656 Ga0265327_10015202
657 Ga0265327_10066587
658 Ga0307510_10000119
659 Ga0395900_0017583
660 Ga0395900_0093960
661 Ga0395905_0003880
662 Ga0395905_0275557
663 Ga0439433_0003047
664 Ga0439449_0001158
665 Ga0451577_0295605
666 Ga0466972_0002248
667 Ga0453683_0021430
668 Ga0466961_0019008
669 Ga0453684_0041468
670 Ga0466970_0001780
671 Ga0466959_0001234
672 Ga0466959_0310093
673 Ga0495629_0131426
674 Ga0495638_0026545
675 Ga0495580_0050727
676 Ga0495606_0034164
677 Ga0495648_0011458
678 Ga0495621_0017846
679 Ga0495668_0000459
680 Ga0495611_0001221
681 Ga0495687_000001
682 Ga0495684_0080147
683 Ga0495686_0000004
684 Ga0495602_0194814
685 Ga0496101_0017853
686 Ga0496104_0194274
687 Ga0496109_0149435
688 Ga0496109_0166542
689 Ga0496115_0167731
690 Ga0496115_0168023
691 Ga0501032_0002459
692 Ga0501034_0023567
693 Ga0501036_0134632
694 Ga0501036_0338559
695 Ga0501037_0194740
696 Ga0501037_0373725
697 Ga0501039_0053545
698 Ga0501043_0037711
699 Ga0501043_0096620
700 Ga0501047_0007018
701 Ga0501070_0154377
702 Ga0501074_0108542
703 Ga0501201_003142
704 Ga0501202_012548
705 Ga0501217_003301
706 Ga0501223_006912
707 Ga0501233_006729
708 Ga0501243_000019
709 Ga0501252_002800
710 Ga0501221_010522
711 Ga0501245_002804
712 Ga0501080_0131485
713 Ga0501083_0037936
714 Ga0501268_023023
715 Ga0501035_0028117
716 Ga0501044_0039783
717 Ga0501044_0046021
718 Ga0501044_0075203
719 Ga0501044_0181878
720 nmdc:mga05p37_470209_c1
721 nmdc:mga06r32_10647_c1
722 Ga0500641_0033501
723 Ga0500568_0000580
724 Ga0500568_0040440
725 Ga0500588_0141539
726 Ga0500622_0000782
727 Ga0501084_0107769
728 Ga0501082_0113199

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08544

GHMP_kinases_C

GHMP kinases C terminal

231

310

0.93

PF00288

GHMP_kinases_N

GHMP kinases N terminal domain

87

172

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4p52-assembly1.cif.gz_A crystal structure of homoserine kinase from cytophaga hutchinsonii atcc 33406, nysgrc target 032717. 0.9176 4 290
1fwk-assembly1.cif.gz_A crystal structure of homoserine kinase complexed with adp 0.8894 4 290
4rpf-assembly1.cif.gz_A crystal structure of homoserine kinase from yersinia pestis nepal516, nysgrc target 032715 0.8885 4 292
4p52-assembly1.cif.gz_A crystal structure of homoserine kinase from cytophaga hutchinsonii atcc 33406, nysgrc target 032717. 0.8854 4 290
4rpf-assembly1.cif.gz_A crystal structure of homoserine kinase from yersinia pestis nepal516, nysgrc target 032715 0.8632 4 292
ID Description Score Start End Superfamily
4p52A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;GHMP kinase, C-terminal domain 0.9399 150 281 3.30.70.890
af_B4FKF4_230_364_3.30.70.890 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;GHMP kinase, C-terminal domain 0.9253 153 281 3.30.70.890
4p52A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;GHMP kinase, C-terminal domain 0.9196 150 281 3.30.70.890
af_P00547_167_298_3.30.70.890 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;GHMP kinase, C-terminal domain 0.8956 153 280 3.30.70.890
1fwlD02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;GHMP kinase, C-terminal domain 0.8931 151 283 3.30.70.890
ID Description Score Start End GO Terms
AF-A0A2M7IVU5-F1-model_v4 Homoserine kinase 0.9665 122 292 GO:0016301
AF-A0A270NYZ9-F1-model_v4 deleted 0.9661 128 292
AF-A0A2H0DD57-F1-model_v4 Homoserine kinase 0.9639 122 287 GO:0016301
AF-A0A7Y3H6I1-F1-model_v4 Homoserine kinase 0.96 126 287 GO:0016301
AF-A0A2E1HQB9-F1-model_v4 Homoserine kinase 0.9588 142 290 GO:0016301

Map