F423554

General Info

Members Datasets Scaffolds Average Seq Length
365 219 730 218

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100095773|Ga0070670_1000957732
Length 236
Sequence MRNDAQAEAKREKRDIVSGEICDEAGLIRFVPGPDGTVTPDLARKLPGRGLWVAADRVSVETAARRNLFARAAKAKLSAPAGLADQVESLLKARLLSGLGLARRAGELAAGFEKVGQAIGAGRAAWLIEASDGADDGRRKVLALARRQPRPPRLFGVFSAEELGLALGLENVIHTAFLAGRASERWTSDVQRLSGFRPLLPESWREDLPAADGTDLVPGAGIILTDDGAGRTPAAM

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
66 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
67 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
112 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
113 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
114 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
117 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
118 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
119 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
120 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
121 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
123 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
124 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
125 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
135 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
136 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
137 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
138 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
139 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
140 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
141 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
142 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
143 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
144 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
145 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
146 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
147 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
148 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
149 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
150 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
151 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
152 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
153 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
154 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
155 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
156 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
157 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
158 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
159 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
160 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
161 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
162 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
163 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
166 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
171 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
172 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
173 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
174 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
175 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
176 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
177 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
178 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
179 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
189 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
190 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
191 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
192 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
193 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
194 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
195 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
196 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
197 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
198 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
199 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
200 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
201 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
202 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
203 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
204 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
205 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
206 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
207 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
208 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
209 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
210 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
211 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
212 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
213 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
214 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
215 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
216 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
217 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
218 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
219 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.9
Metatranscriptomes 0
Isolates 1.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.52
Nodule 0
Rhizoplane 3.29
Rhizosphere 75.89
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100095773 3300005331 Bacteria 2553
2 JGI25153J46596_10022021 3300003215 Bacteria 2362
3 Ga0055530_10000586 3300003791 Bacteria 31506
4 Ga0055531_10000968 3300003794 Bacteria 22999
5 Ga0055543_1007041 3300004625 Bacteria 2645
6 Ga0065165_1013914 3300005262 Bacteria 3158
7 Ga0070658_10361343 3300005327 Bacteria 1243
8 Ga0070670_100000007 3300005331 Bacteria 318672
9 Ga0070670_100137976 3300005331 Bacteria 2108
10 Ga0070670_100491540 3300005331 Bacteria 1090
11 Ga0068869_100078046 3300005334 Bacteria 2465
12 Ga0068869_100558238 3300005334 Bacteria 963
13 Ga0070666_10034211 3300005335 Bacteria 3368
14 Ga0070666_10407050 3300005335 Bacteria 979
15 Ga0070680_100029908 3300005336 Bacteria 4373
16 Ga0070680_100162410 3300005336 Bacteria 1877
17 Ga0070661_100193182 3300005344 Bacteria 1553
18 Ga0070668_100001382 3300005347 Bacteria 17415
19 Ga0070668_100001424 3300005347 Bacteria 17257
20 Ga0070668_100002079 3300005347 Bacteria 14642
21 Ga0070668_100032574 3300005347 Bacteria 3966
22 Ga0070668_100074078 3300005347 Bacteria 2655
23 Ga0070669_100008765 3300005353 Bacteria 7216
24 Ga0070669_100098633 3300005353 Bacteria 2201
25 Ga0070669_100263652 3300005353 Bacteria 1375
26 Ga0070671_100003609 3300005355 Bacteria 12108
27 Ga0070673_100112654 3300005364 Bacteria 2258
28 Ga0070659_100033688 3300005366 Bacteria 3981
29 Ga0070659_100608358 3300005366 Bacteria 940
30 Ga0070667_100000293 3300005367 Bacteria 56352
31 Ga0070667_100106002 3300005367 Bacteria 2433
32 Ga0070667_100220742 3300005367 Bacteria 1687
33 Ga0070713_100464488 3300005436 Bacteria 1190
34 Ga0070662_100201166 3300005457 Bacteria 1581
35 Ga0070681_10009817 3300005458 Bacteria 9427
36 Ga0070681_10077621 3300005458 Bacteria 3278
37 Ga0070679_100021958 3300005530 Bacteria 6234
38 Ga0070679_100137583 3300005530 Bacteria 2423
39 Ga0068853_100110854 3300005539 Bacteria 2437
40 Ga0068853_100137556 3300005539 Bacteria 2191
41 Ga0070665_100000187 3300005548 Bacteria 110095
42 Ga0070665_100001912 3300005548 Bacteria 23543
43 Ga0070665_100027620 3300005548 Bacteria 5715
44 Ga0070665_100435734 3300005548 Bacteria 1320
45 Ga0068855_100042621 3300005563 Bacteria 5377
46 Ga0068855_100228338 3300005563 Bacteria 2085
47 Ga0068855_100740801 3300005563 Bacteria 1049
48 Ga0070664_100009891 3300005564 Bacteria 7730
49 Ga0068856_100692086 3300005614 Bacteria 1040
50 Ga0068852_100030488 3300005616 Bacteria 4440
51 Ga0068859_100000811 3300005617 Bacteria 31785
52 Ga0068859_100003794 3300005617 Bacteria 15415
53 Ga0068864_100002694 3300005618 Bacteria 14634
54 Ga0068864_100045951 3300005618 Bacteria 3746
55 Ga0068864_100105737 3300005618 Bacteria 2502
56 Ga0068864_100151854 3300005618 Bacteria 2098
57 Ga0068864_100159402 3300005618 Bacteria 2050
58 Ga0068861_100031419 3300005719 Bacteria 3901
59 Ga0068863_100000663 3300005841 Bacteria 34691
60 Ga0068863_100001917 3300005841 Bacteria 20674
61 Ga0068863_100003609 3300005841 Bacteria 15280
62 Ga0068863_100076975 3300005841 Bacteria 3156
63 Ga0068858_100001006 3300005842 Bacteria 29047
64 Ga0068858_100008697 3300005842 Bacteria 9747
65 Ga0068858_100035263 3300005842 Bacteria 4641
66 Ga0068858_100183372 3300005842 Bacteria 1977
67 Ga0068860_100000047 3300005843 Bacteria 213287
68 Ga0068860_100001005 3300005843 Bacteria 31230
69 Ga0068860_100015258 3300005843 Bacteria 7502
70 Ga0068860_100018144 3300005843 Bacteria 6849
71 Ga0068862_100000396 3300005844 Bacteria 47054
72 Ga0068862_100031519 3300005844 Bacteria 4476
73 Ga0068862_100079277 3300005844 Bacteria 2846
74 Ga0068862_100080434 3300005844 Bacteria 2826
75 Ga0068862_100094355 3300005844 Bacteria 2610
76 Ga0070717_10041433 3300006028 Bacteria 3754
77 Ga0075368_10017223 3300006042 Bacteria 2702
78 Ga0075368_10099650 3300006042 Bacteria 1192
79 Ga0075363_100040292 3300006048 Bacteria 2462
80 Ga0075364_10014234 3300006051 Bacteria 4911
81 Ga0075362_10135164 3300006177 Bacteria 1175
82 Ga0075367_10002614 3300006178 Bacteria 8272
83 Ga0075366_10073552 3300006195 Bacteria 2037
84 Ga0097621_100376400 3300006237 Bacteria 1267
85 Ga0068871_100443259 3300006358 Bacteria 1163
86 Ga0068865_100000389 3300006881 Bacteria 24391
87 Ga0097620_100000811 3300006931 Bacteria 31785
88 Ga0097620_100003793 3300006931 Bacteria 15415
89 Ga0105250_10010049 3300009092 Bacteria 3959
90 Ga0105240_10024353 3300009093 Bacteria 7980
91 Ga0105240_10081921 3300009093 Bacteria 3964
92 Ga0105240_10305191 3300009093 Bacteria 1820
93 Ga0105240_10594325 3300009093 Bacteria 1219
94 Ga0105242_10355558 3300009176 Bacteria 1354
95 Ga0105248_10118644 3300009177 Bacteria 2984
96 Ga0105248_10123579 3300009177 Bacteria 2919
97 Ga0105248_10243702 3300009177 Bacteria 2023
98 Ga0105248_10545556 3300009177 Bacteria 1308
99 Ga0105248_10930175 3300009177 Bacteria 982
100 Ga0105237_10468399 3300009545 Bacteria 1266
101 Ga0105238_10071414 3300009551 Bacteria 3469
102 Ga0105238_10153327 3300009551 Bacteria 2279
103 Ga0105249_10001104 3300009553 Bacteria 23992
104 Ga0105249_10972357 3300009553 Bacteria 917
105 Ga0105239_10560221 3300010375 Bacteria 1302
106 Ga0105239_10605337 3300010375 Bacteria 1250
107 Ga0105239_10842150 3300010375 Bacteria 1052
108 Ga0157373_10056667 3300013100 Bacteria 2782
109 Ga0157373_10312540 3300013100 Bacteria 1117
110 Ga0157370_10240715 3300013104 Bacteria 1674
111 Ga0157370_10889894 3300013104 Bacteria 808
112 Ga0163162_10010062 3300013306 Bacteria 9196
113 Ga0163162_10102841 3300013306 Bacteria 2950
114 Ga0157372_10472259 3300013307 Bacteria 1462
115 Ga0157375_10147700 3300013308 Bacteria 2483
116 Ga0163163_10012776 3300014325 Bacteria 7662
117 Ga0163163_10117100 3300014325 Bacteria 2696
118 Ga0163163_10134760 3300014325 Bacteria 2510
119 Ga0163163_10233502 3300014325 Bacteria 1889
120 Ga0163163_10487952 3300014325 Bacteria 1293
121 Ga0157380_10192052 3300014326 Bacteria 1804
122 Ga0182008_10021629 3300014497 Bacteria 3303
123 Ga0157379_10028979 3300014968 Bacteria 4923
124 Ga0157379_10304206 3300014968 Bacteria 1454
125 Ga0182007_10053953 3300015262 Bacteria 1322
126 Ga0163161_10396926 3300017792 Bacteria 1105
127 Ga0213872_10064518 3300021361 Bacteria 1654
128 Ga0209758_1000852 3300025297 Bacteria 42442
129 Ga0209050_1000053 3300025298 Bacteria 349521
130 Ga0209257_1000289 3300025304 Bacteria 110882
131 Ga0209257_1010487 3300025304 Bacteria 4677
132 Ga0207680_10030302 3300025903 Bacteria 3050
133 Ga0207705_10016595 3300025909 Bacteria 5275
134 Ga0207654_10323552 3300025911 Bacteria 1055
135 Ga0207707_10049061 3300025912 Bacteria 3678
136 Ga0207695_10018076 3300025913 Bacteria 8160
137 Ga0207695_10053874 3300025913 Bacteria 4205
138 Ga0207695_10230168 3300025913 Bacteria 1758
139 Ga0207695_10248888 3300025913 Bacteria 1677
140 Ga0207660_10002946 3300025917 Bacteria 11127
141 Ga0207660_10206846 3300025917 Bacteria 1535
142 Ga0207657_10017541 3300025919 Bacteria 6859
143 Ga0207649_10101699 3300025920 Bacteria 1904
144 Ga0207649_10205746 3300025920 Bacteria 1393
145 Ga0207652_10007229 3300025921 Bacteria 8949
146 Ga0207652_10098829 3300025921 Bacteria 2574
147 Ga0207681_10063213 3300025923 Bacteria 2552
148 Ga0207694_10073302 3300025924 Bacteria 2678
149 Ga0207694_10080585 3300025924 Bacteria 2555
150 Ga0207694_10600664 3300025924 Bacteria 925
151 Ga0207650_10000033 3300025925 Bacteria 226809
152 Ga0207650_10075549 3300025925 Bacteria 2543
153 Ga0207687_10094433 3300025927 Bacteria 2189
154 Ga0207644_10009332 3300025931 Bacteria 6442
155 Ga0207644_10102286 3300025931 Bacteria 2154
156 Ga0207690_10039514 3300025932 Bacteria 3079
157 Ga0207706_10141602 3300025933 Bacteria 2116
158 Ga0207706_10220147 3300025933 Bacteria 1662
159 Ga0207704_10011550 3300025938 Bacteria 4351
160 Ga0207711_10000374 3300025941 Bacteria 47567
161 Ga0207711_10144017 3300025941 Bacteria 2146
162 Ga0207711_10582852 3300025941 Bacteria 1043
163 Ga0207689_10098331 3300025942 Bacteria 2404
164 Ga0207667_10048538 3300025949 Bacteria 4488
165 Ga0207667_10049989 3300025949 Bacteria 4412
166 Ga0207667_10146415 3300025949 Bacteria 2431
167 Ga0207667_10342295 3300025949 Bacteria 1526
168 Ga0207667_10551447 3300025949 Bacteria 1166
169 Ga0207651_10020183 3300025960 Bacteria 4016
170 Ga0207712_10001424 3300025961 Bacteria 16336
171 Ga0207712_10389492 3300025961 Bacteria 1168
172 Ga0207668_10000013 3300025972 Bacteria 167989
173 Ga0207668_10000197 3300025972 Bacteria 41484
174 Ga0207668_10002677 3300025972 Bacteria 10425
175 Ga0207668_10031993 3300025972 Bacteria 3471
176 Ga0207668_10051524 3300025972 Bacteria 2843
177 Ga0207640_10585275 3300025981 Bacteria 943
178 Ga0207658_10000318 3300025986 Bacteria 48562
179 Ga0207658_10005669 3300025986 Bacteria 8541
180 Ga0207658_10079082 3300025986 Bacteria 2514
181 Ga0207677_11039100 3300026023 Bacteria 744
182 Ga0207703_10000065 3300026035 Bacteria 126087
183 Ga0207703_10020593 3300026035 Bacteria 5160
184 Ga0207703_10545885 3300026035 Bacteria 1092
185 Ga0207639_10129562 3300026041 Bacteria 2086
186 Ga0207639_10186838 3300026041 Bacteria 1767
187 Ga0207639_10233089 3300026041 Bacteria 1597
188 Ga0207678_10204500 3300026067 Bacteria 1689
189 Ga0207702_10293240 3300026078 Bacteria 1542
190 Ga0207702_10661802 3300026078 Bacteria 1027
191 Ga0207641_10000011 3300026088 Bacteria 384362
192 Ga0207641_10000532 3300026088 Bacteria 42714
193 Ga0207641_10002973 3300026088 Bacteria 15339
194 Ga0207641_10079114 3300026088 Bacteria 2849
195 Ga0207641_10465533 3300026088 Bacteria 1223
196 Ga0207676_10000135 3300026095 Bacteria 64914
197 Ga0207676_10000450 3300026095 Bacteria 34793
198 Ga0207676_10030351 3300026095 Bacteria 4057
199 Ga0207676_10136218 3300026095 Bacteria 2095
200 Ga0207674_10065893 3300026116 Bacteria 3650
201 Ga0207675_100048271 3300026118 Bacteria 3974
202 Ga0207675_100223813 3300026118 Bacteria 1813
203 Ga0209967_1016970 3300027364 Bacteria 1048
204 Ga0209981_1001912 3300027378 Bacteria 2656
205 Ga0209999_1008443 3300027543 Bacteria 1857
206 Ga0209983_1002968 3300027665 Bacteria 3661
207 Ga0209813_10006533 3300027866 Bacteria 2885
208 Ga0268266_10000003 3300028379 Bacteria 1701703
209 Ga0268266_10317975 3300028379 Bacteria 1456
210 Ga0268266_10499204 3300028379 Bacteria 1162
211 Ga0268265_10003943 3300028380 Bacteria 10454
212 Ga0268265_10005283 3300028380 Bacteria 8843
213 Ga0268265_10045851 3300028380 Bacteria 3265
214 Ga0268265_11174095 3300028380 Bacteria 764
215 Ga0268264_10000014 3300028381 Bacteria 509962
216 Ga0268264_10000205 3300028381 Bacteria 120743
217 Ga0268264_10005830 3300028381 Bacteria 10434
218 Ga0265334_10112022 3300028573 Bacteria 980
219 Ga0307517_10003957 3300028786 Bacteria 22943
220 Ga0307517_10100909 3300028786 Bacteria 2276
221 Ga0307511_10047913 3300030521 Bacteria 3487
222 Ga0307513_10000100 3300031456 Bacteria 125183
223 Ga0307513_10003278 3300031456 Bacteria 22053
224 Ga0307513_10005039 3300031456 Bacteria 17496
225 Ga0307513_10005827 3300031456 Bacteria 16184
226 Ga0307408_100407758 3300031548 Bacteria 1169
227 Ga0307516_10000338 3300031730 Bacteria 61339
228 Ga0307405_10311928 3300031731 Bacteria 1198
229 Ga0307412_10262710 3300031911 Bacteria 1347
230 Ga0307510_10040324 3300033180 Bacteria 5127
231 Ga0373944_0048046 3300035089 Bacteria 1338
232 Ga0373923_0103892 3300035111 Bacteria 1256
233 Ga0373936_0027085 3300035113 Bacteria 2248
234 Ga0373943_0017235 3300035170 Bacteria 3304
235 Ga0373927_0001686 3300035695 Bacteria 16509
236 Ga0373947_0145449 3300035725 Bacteria 1524
237 Ga0373947_0167507 3300035725 Bacteria 1424
238 Ga0373937_0086579 3300036401 Bacteria 2899
239 Ga0373937_0545017 3300036401 Bacteria 1102
240 Ga0373925_0000199 3300037068 Bacteria 65400
241 Ga0395899_0000560 3300037312 Bacteria 39802
242 Ga0395899_0078095 3300037312 Bacteria 2413
243 Ga0395900_0000002 3300037418 Bacteria 671103
244 Ga0395898_0012555 3300037466 Bacteria 8760
245 Ga0395898_0048766 3300037466 Bacteria 4151
246 Ga0395898_0323593 3300037466 Bacteria 1471
247 Ga0395905_0037939 3300037471 Bacteria 4521
248 Ga0395905_0056115 3300037471 Bacteria 3686
249 Ga0395905_0879449 3300037471 Bacteria 799
250 Ga0395901_0000021 3300038443 Bacteria 307734
251 Ga0395901_0042696 3300038443 Bacteria 4702
252 Ga0395901_0260875 3300038443 Bacteria 1803
253 Ga0436365_0108317 3300039437 Bacteria 5195
254 Ga0436365_0608300 3300039437 Bacteria 1410
255 Ga0436360_0785619 3300039438 Bacteria 1360
256 Ga0436361_0767272 3300039447 Bacteria 33690
257 Ga0451853_3003002 3300041512 Bacteria 1027
258 Ga0439442_036253 3300042002 Bacteria 1032
259 Ga0439462_0070835 3300042015 Bacteria 947
260 Ga0453684_1496660 3300044712 Bacteria 696
261 Ga0466970_0079439 3300044765 Bacteria 1771
262 Ga0466960_0385972 3300044901 Bacteria 804
263 Ga0495629_0014004 3300046459 Bacteria 5780
264 Ga0495585_0088629 3300046492 Bacteria 1669
265 Ga0495583_0143718 3300046506 Bacteria 992
266 Ga0495610_0137831 3300046512 Bacteria 1053
267 Ga0495620_0029298 3300046515 Bacteria 2549
268 Ga0495628_0036533 3300046516 Bacteria 3941
269 Ga0495643_0014449 3300046522 Bacteria 4698
270 Ga0495642_0119430 3300046528 Bacteria 1130
271 Ga0495609_0021443 3300046538 Bacteria 2980
272 Ga0495645_0068249 3300046543 Bacteria 2567
273 Ga0495622_0002218 3300046557 Bacteria 9469
274 Ga0495668_0064073 3300046616 Bacteria 2024
275 Ga0495668_0118910 3300046616 Bacteria 1445
276 Ga0495668_0155730 3300046616 Bacteria 1251
277 Ga0495668_0288151 3300046616 Bacteria 900
278 Ga0495625_0127770 3300046660 Bacteria 1724
279 Ga0495588_0223276 3300046674 Bacteria 994
280 Ga0495669_0000007 3300046684 Bacteria 180797
281 Ga0495669_0002577 3300046684 Bacteria 7408
282 Ga0495674_0271694 3300047319 Bacteria 1391
283 Ga0495672_0034389 3300047320 Bacteria 3132
284 Ga0495677_0036697 3300047445 Bacteria 1790
285 Ga0495686_0044959 3300047472 Bacteria 2795
286 Ga0495602_0064555 3300048088 Bacteria 3165
287 Ga0495615_0059368 3300048090 Bacteria 1005
288 Ga0496101_0244917 3300048904 Bacteria 1396
289 Ga0496102_1089951 3300048905 Bacteria 718
290 Ga0496103_0109817 3300048906 Bacteria 1751
291 Ga0496107_0174189 3300048910 Bacteria 1597
292 Ga0496108_0106651 3300048911 Bacteria 2392
293 Ga0496112_0020562 3300048915 Bacteria 6258
294 Ga0496112_0076705 3300048915 Bacteria 3305
295 Ga0496113_0073049 3300048916 Bacteria 2612
296 Ga0496115_0006365 3300048918 Bacteria 8648
297 Ga0496115_0019718 3300048918 Bacteria 5192
298 Ga0496115_0139627 3300048918 Bacteria 1999
299 Ga0496115_0632816 3300048918 Bacteria 847
300 Ga0496116_0171454 3300048919 Bacteria 1175
301 Ga0496117_0023221 3300048920 Bacteria 4952
302 Ga0496118_0019812 3300048921 Bacteria 5999
303 Ga0496119_0004198 3300048922 Bacteria 14479
304 Ga0496120_0138547 3300048923 Bacteria 1238
305 Ga0496121_0000035 3300048924 Bacteria 374316
306 Ga0496125_0012238 3300048928 Bacteria 8533
307 Ga0495682_0036524 3300049460 Bacteria 1809
308 Ga0501032_0598304 3300049569 Bacteria 702
309 Ga0501033_0000913 3300049570 Bacteria 26962
310 Ga0501033_0049531 3300049570 Bacteria 3118
311 Ga0501034_0071398 3300049571 Bacteria 3481
312 Ga0501034_0319092 3300049571 Bacteria 1487
313 Ga0501034_0865717 3300049571 Bacteria 793
314 Ga0501037_0021815 3300049573 Bacteria 4739
315 Ga0501037_0057556 3300049573 Bacteria 2838
316 Ga0501038_0499799 3300049574 Bacteria 930
317 Ga0501047_0026978 3300049581 Bacteria 5532
318 Ga0501047_0027394 3300049581 Bacteria 5490
319 Ga0501047_0299866 3300049581 Bacteria 1450
320 Ga0501047_0843800 3300049581 Bacteria 730
321 Ga0501048_0086234 3300049582 Bacteria 2215
322 Ga0501035_0111988 3300049822 Bacteria 2391
323 Ga0501035_0714347 3300049822 Bacteria 807
324 Ga0501044_0004988 3300049823 Bacteria 14831
325 Ga0501044_0519324 3300049823 Bacteria 1091
326 nmdc:mga03n38_50158_c1 3300050490 Bacteria 1859
327 nmdc:mga0k408_380059_c1 3300050493 Bacteria 841
328 nmdc:mga07m45_21370_c1 3300050496 Bacteria 3524
329 nmdc:mga07m45_264556_c1 3300050496 Bacteria 1000
330 nmdc:mga07m45_79070_c1 3300050496 Bacteria 1877
331 nmdc:mga0sz30_131939_c1 3300050516 Bacteria 1101
332 Ga0500610_0152236 3300053079 Bacteria 1158
333 Ga0500635_0043898 3300053080 Bacteria 1505
334 Ga0500643_032654 3300053087 Bacteria 1579
335 Ga0500643_037581 3300053087 Bacteria 1441
336 Ga0500647_0020943 3300053091 Bacteria 3048
337 Ga0500647_0051955 3300053091 Bacteria 1972
338 Ga0500583_0283349 3300053092 Bacteria 813
339 Ga0500566_0039715 3300053094 Bacteria 2720
340 Ga0500566_0158706 3300053094 Bacteria 1181
341 Ga0500641_0239749 3300053096 Bacteria 763
342 Ga0500572_003690 3300053111 Bacteria 3477
343 Ga0500595_011065 3300053119 Bacteria 3551
344 Ga0500595_016592 3300053119 Bacteria 2739
345 Ga0500595_069430 3300053119 Bacteria 1048
346 Ga0500607_136652 3300053121 Bacteria 1160
347 Ga0500608_000264 3300053122 Bacteria 20418
348 Ga0500614_005874 3300053123 Bacteria 2576
349 Ga0500614_035027 3300053123 Bacteria 1249
350 Ga0500655_030858 3300053133 Bacteria 1032
351 Ga0500559_0024479 3300053136 Bacteria 2569
352 Ga0500590_071612 3300053148 Bacteria 1721
353 Ga0500603_117287 3300053150 Bacteria 804
354 Ga0500619_012714 3300053154 Bacteria 2210
355 Ga0500624_004577 3300053157 Bacteria 1825
356 Ga0500636_0155251 3300053177 Bacteria 1253
357 Ga0500637_0024170 3300053178 Bacteria 3328
358 Ga0500576_102583 3300053725 Bacteria 1164
359 Ga0500625_055600 3300053729 Bacteria 1814
360 Ga0500645_002789 3300053730 Bacteria 7538
361 Ga0500596_003603 3300053735 Bacteria 2917
362 2643999696 2643221598 Bacteria 4578346
363 2644087684 2643221614 Bacteria 4260023
364 2644344273 2643221661 Bacteria 4267604
365 2644367042 2643221666 Bacteria 4265935
366 Ga0070670_100095773
367 JGI25153J46596_10022021
368 Ga0055530_10000586
369 Ga0055531_10000968
370 Ga0055543_1007041
371 Ga0065165_1013914
372 Ga0070658_10361343
373 Ga0070670_100000007
374 Ga0070670_100137976
375 Ga0070670_100491540
376 Ga0068869_100078046
377 Ga0068869_100558238
378 Ga0070666_10034211
379 Ga0070666_10407050
380 Ga0070680_100029908
381 Ga0070680_100162410
382 Ga0070661_100193182
383 Ga0070668_100001382
384 Ga0070668_100001424
385 Ga0070668_100002079
386 Ga0070668_100032574
387 Ga0070668_100074078
388 Ga0070669_100008765
389 Ga0070669_100098633
390 Ga0070669_100263652
391 Ga0070671_100003609
392 Ga0070673_100112654
393 Ga0070659_100033688
394 Ga0070659_100608358
395 Ga0070667_100000293
396 Ga0070667_100106002
397 Ga0070667_100220742
398 Ga0070713_100464488
399 Ga0070662_100201166
400 Ga0070681_10009817
401 Ga0070681_10077621
402 Ga0070679_100021958
403 Ga0070679_100137583
404 Ga0068853_100110854
405 Ga0068853_100137556
406 Ga0070665_100000187
407 Ga0070665_100001912
408 Ga0070665_100027620
409 Ga0070665_100435734
410 Ga0068855_100042621
411 Ga0068855_100228338
412 Ga0068855_100740801
413 Ga0070664_100009891
414 Ga0068856_100692086
415 Ga0068852_100030488
416 Ga0068859_100000811
417 Ga0068859_100003794
418 Ga0068864_100002694
419 Ga0068864_100045951
420 Ga0068864_100105737
421 Ga0068864_100151854
422 Ga0068864_100159402
423 Ga0068861_100031419
424 Ga0068863_100000663
425 Ga0068863_100001917
426 Ga0068863_100003609
427 Ga0068863_100076975
428 Ga0068858_100001006
429 Ga0068858_100008697
430 Ga0068858_100035263
431 Ga0068858_100183372
432 Ga0068860_100000047
433 Ga0068860_100001005
434 Ga0068860_100015258
435 Ga0068860_100018144
436 Ga0068862_100000396
437 Ga0068862_100031519
438 Ga0068862_100079277
439 Ga0068862_100080434
440 Ga0068862_100094355
441 Ga0070717_10041433
442 Ga0075368_10017223
443 Ga0075368_10099650
444 Ga0075363_100040292
445 Ga0075364_10014234
446 Ga0075362_10135164
447 Ga0075367_10002614
448 Ga0075366_10073552
449 Ga0097621_100376400
450 Ga0068871_100443259
451 Ga0068865_100000389
452 Ga0097620_100000811
453 Ga0097620_100003793
454 Ga0105250_10010049
455 Ga0105240_10024353
456 Ga0105240_10081921
457 Ga0105240_10305191
458 Ga0105240_10594325
459 Ga0105242_10355558
460 Ga0105248_10118644
461 Ga0105248_10123579
462 Ga0105248_10243702
463 Ga0105248_10545556
464 Ga0105248_10930175
465 Ga0105237_10468399
466 Ga0105238_10071414
467 Ga0105238_10153327
468 Ga0105249_10001104
469 Ga0105249_10972357
470 Ga0105239_10560221
471 Ga0105239_10605337
472 Ga0105239_10842150
473 Ga0157373_10056667
474 Ga0157373_10312540
475 Ga0157370_10240715
476 Ga0157370_10889894
477 Ga0163162_10010062
478 Ga0163162_10102841
479 Ga0157372_10472259
480 Ga0157375_10147700
481 Ga0163163_10012776
482 Ga0163163_10117100
483 Ga0163163_10134760
484 Ga0163163_10233502
485 Ga0163163_10487952
486 Ga0157380_10192052
487 Ga0182008_10021629
488 Ga0157379_10028979
489 Ga0157379_10304206
490 Ga0182007_10053953
491 Ga0163161_10396926
492 Ga0213872_10064518
493 Ga0209758_1000852
494 Ga0209050_1000053
495 Ga0209257_1000289
496 Ga0209257_1010487
497 Ga0207680_10030302
498 Ga0207705_10016595
499 Ga0207654_10323552
500 Ga0207707_10049061
501 Ga0207695_10018076
502 Ga0207695_10053874
503 Ga0207695_10230168
504 Ga0207695_10248888
505 Ga0207660_10002946
506 Ga0207660_10206846
507 Ga0207657_10017541
508 Ga0207649_10101699
509 Ga0207649_10205746
510 Ga0207652_10007229
511 Ga0207652_10098829
512 Ga0207681_10063213
513 Ga0207694_10073302
514 Ga0207694_10080585
515 Ga0207694_10600664
516 Ga0207650_10000033
517 Ga0207650_10075549
518 Ga0207687_10094433
519 Ga0207644_10009332
520 Ga0207644_10102286
521 Ga0207690_10039514
522 Ga0207706_10141602
523 Ga0207706_10220147
524 Ga0207704_10011550
525 Ga0207711_10000374
526 Ga0207711_10144017
527 Ga0207711_10582852
528 Ga0207689_10098331
529 Ga0207667_10048538
530 Ga0207667_10049989
531 Ga0207667_10146415
532 Ga0207667_10342295
533 Ga0207667_10551447
534 Ga0207651_10020183
535 Ga0207712_10001424
536 Ga0207712_10389492
537 Ga0207668_10000013
538 Ga0207668_10000197
539 Ga0207668_10002677
540 Ga0207668_10031993
541 Ga0207668_10051524
542 Ga0207640_10585275
543 Ga0207658_10000318
544 Ga0207658_10005669
545 Ga0207658_10079082
546 Ga0207677_11039100
547 Ga0207703_10000065
548 Ga0207703_10020593
549 Ga0207703_10545885
550 Ga0207639_10129562
551 Ga0207639_10186838
552 Ga0207639_10233089
553 Ga0207678_10204500
554 Ga0207702_10293240
555 Ga0207702_10661802
556 Ga0207641_10000011
557 Ga0207641_10000532
558 Ga0207641_10002973
559 Ga0207641_10079114
560 Ga0207641_10465533
561 Ga0207676_10000135
562 Ga0207676_10000450
563 Ga0207676_10030351
564 Ga0207676_10136218
565 Ga0207674_10065893
566 Ga0207675_100048271
567 Ga0207675_100223813
568 Ga0209967_1016970
569 Ga0209981_1001912
570 Ga0209999_1008443
571 Ga0209983_1002968
572 Ga0209813_10006533
573 Ga0268266_10000003
574 Ga0268266_10317975
575 Ga0268266_10499204
576 Ga0268265_10003943
577 Ga0268265_10005283
578 Ga0268265_10045851
579 Ga0268265_11174095
580 Ga0268264_10000014
581 Ga0268264_10000205
582 Ga0268264_10005830
583 Ga0265334_10112022
584 Ga0307517_10003957
585 Ga0307517_10100909
586 Ga0307511_10047913
587 Ga0307513_10000100
588 Ga0307513_10003278
589 Ga0307513_10005039
590 Ga0307513_10005827
591 Ga0307408_100407758
592 Ga0307516_10000338
593 Ga0307405_10311928
594 Ga0307412_10262710
595 Ga0307510_10040324
596 Ga0373944_0048046
597 Ga0373923_0103892
598 Ga0373936_0027085
599 Ga0373943_0017235
600 Ga0373927_0001686
601 Ga0373947_0145449
602 Ga0373947_0167507
603 Ga0373937_0086579
604 Ga0373937_0545017
605 Ga0373925_0000199
606 Ga0395899_0000560
607 Ga0395899_0078095
608 Ga0395900_0000002
609 Ga0395898_0012555
610 Ga0395898_0048766
611 Ga0395898_0323593
612 Ga0395905_0037939
613 Ga0395905_0056115
614 Ga0395905_0879449
615 Ga0395901_0000021
616 Ga0395901_0042696
617 Ga0395901_0260875
618 Ga0436365_0108317
619 Ga0436365_0608300
620 Ga0436360_0785619
621 Ga0436361_0767272
622 Ga0451853_3003002
623 Ga0439442_036253
624 Ga0439462_0070835
625 Ga0453684_1496660
626 Ga0466970_0079439
627 Ga0466960_0385972
628 Ga0495629_0014004
629 Ga0495585_0088629
630 Ga0495583_0143718
631 Ga0495610_0137831
632 Ga0495620_0029298
633 Ga0495628_0036533
634 Ga0495643_0014449
635 Ga0495642_0119430
636 Ga0495609_0021443
637 Ga0495645_0068249
638 Ga0495622_0002218
639 Ga0495668_0064073
640 Ga0495668_0118910
641 Ga0495668_0155730
642 Ga0495668_0288151
643 Ga0495625_0127770
644 Ga0495588_0223276
645 Ga0495669_0000007
646 Ga0495669_0002577
647 Ga0495674_0271694
648 Ga0495672_0034389
649 Ga0495677_0036697
650 Ga0495686_0044959
651 Ga0495602_0064555
652 Ga0495615_0059368
653 Ga0496101_0244917
654 Ga0496102_1089951
655 Ga0496103_0109817
656 Ga0496107_0174189
657 Ga0496108_0106651
658 Ga0496112_0020562
659 Ga0496112_0076705
660 Ga0496113_0073049
661 Ga0496115_0006365
662 Ga0496115_0019718
663 Ga0496115_0139627
664 Ga0496115_0632816
665 Ga0496116_0171454
666 Ga0496117_0023221
667 Ga0496118_0019812
668 Ga0496119_0004198
669 Ga0496120_0138547
670 Ga0496121_0000035
671 Ga0496125_0012238
672 Ga0495682_0036524
673 Ga0501032_0598304
674 Ga0501033_0000913
675 Ga0501033_0049531
676 Ga0501034_0071398
677 Ga0501034_0319092
678 Ga0501034_0865717
679 Ga0501037_0021815
680 Ga0501037_0057556
681 Ga0501038_0499799
682 Ga0501047_0026978
683 Ga0501047_0027394
684 Ga0501047_0299866
685 Ga0501047_0843800
686 Ga0501048_0086234
687 Ga0501035_0111988
688 Ga0501035_0714347
689 Ga0501044_0004988
690 Ga0501044_0519324
691 nmdc:mga03n38_50158_c1
692 nmdc:mga0k408_380059_c1
693 nmdc:mga07m45_21370_c1
694 nmdc:mga07m45_264556_c1
695 nmdc:mga07m45_79070_c1
696 nmdc:mga0sz30_131939_c1
697 Ga0500610_0152236
698 Ga0500635_0043898
699 Ga0500643_032654
700 Ga0500643_037581
701 Ga0500647_0020943
702 Ga0500647_0051955
703 Ga0500583_0283349
704 Ga0500566_0039715
705 Ga0500566_0158706
706 Ga0500641_0239749
707 Ga0500572_003690
708 Ga0500595_011065
709 Ga0500595_016592
710 Ga0500595_069430
711 Ga0500607_136652
712 Ga0500608_000264
713 Ga0500614_005874
714 Ga0500614_035027
715 Ga0500655_030858
716 Ga0500559_0024479
717 Ga0500590_071612
718 Ga0500603_117287
719 Ga0500619_012714
720 Ga0500624_004577
721 Ga0500636_0155251
722 Ga0500637_0024170
723 Ga0500576_102583
724 Ga0500625_055600
725 Ga0500645_002789
726 Ga0500596_003603
727 2643999696
728 2644087684
729 2644344273
730 2644367042

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04296

YlxR

Protein of unknown function (DUF448)

13

89

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v7q-assembly3.cif.gz_C crystal structure of b. subtilis ylxq at 1.55 a resolution 0.9256 100 193
3on1-assembly1.cif.gz_A the structure of a protein with unknown function from bacillus halodurans c 0.9036 99 197
4lck-assembly1.cif.gz_A co-crystal structure of a t-box riboswitch stem i domain in complex with its cognate trna 0.8816 113 185
7qiz-assembly1.cif.gz_e specific features and methylation sites of a plant 80s ribosome 0.8794 101 184
3on1-assembly1.cif.gz_A the structure of a protein with unknown function from bacillus halodurans c 0.8785 99 197
ID Description Score Start End Superfamily
3v7qC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Ribosomal protein L30/S12 0.9256 100 193 3.30.1330.30
3on1A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Ribosomal protein L30/S12 0.8975 99 197 3.30.1330.30
af_P0A0G6_3_83_3.30.1330.30 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Ribosomal protein L30/S12 0.8818 114 185 3.30.1330.30
af_A0A0G2JZT7_3_157_3.30.1330.30 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Ribosomal protein L30/S12 0.8755 114 185 3.30.1330.30
3on1A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Ribosomal protein L30/S12 0.8725 99 197 3.30.1330.30
ID Description Score Start End GO Terms
AF-A0A0Q7QFV6-F1-model_v4 DNA-binding protein 0.9644 17 199 GO:0003677
AF-A0A840A158-F1-model_v4 YlxR domain-containing protein 0.9628 28 217
AF-Q0AK70-F1-model_v4 YlxR domain-containing protein 0.9607 17 206
AF-A0A7G8ZM56-F1-model_v4 RNA-binding protein 0.9594 17 209
AF-A0A436G1U3-F1-model_v4 RNA-binding protein 0.9594 18 174

Map