F423609

General Info

Members Datasets Scaffolds Average Seq Length
365 156 730 99

Family's Representative Sequence

Representative Sequence 3300005578|Ga0068854_101368794|Ga0068854_1013687942
Length 97
Sequence MRKSLWLGPMLLGACAVVPPQSNVHGTVPGRVCNATGTDGFIGQPGTSESGAAILKATKSAILRWAPPGAMMTMDYSASRVTVHLDDAGRITKISCG

Samples

Sample ID Description Type Environment
1 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
54 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
127 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
128 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
135 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
136 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
137 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
140 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
143 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
144 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
147 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
148 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
149 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
153 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
154 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
155 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
156 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.45
Metatranscriptomes 0.55
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.55
Nodule 0
Rhizoplane 0.82
Rhizosphere 98.36
Stem 0
Stem Tuber 0
Unclassified 3.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068854_101368794 3300005578 Bacteria 639
2 JGI24740J21852_10011600 3300001979 Bacteria 3350
3 JGI24737J22298_10001480 3300001990 Bacteria 8367
4 JGI24737J22298_10005858 3300001990 Bacteria 4230
5 JGI24735J21928_10049996 3300002067 Unclassified 1207
6 JGI24738J21930_10048745 3300002075 Bacteria 862
7 Ga0065715_10681301 3300005293 Bacteria 663
8 Ga0065715_10959560 3300005293 Bacteria 557
9 Ga0070658_10062265 3300005327 Bacteria 3040
10 Ga0070658_10074449 3300005327 Bacteria 2785
11 Ga0070658_10118723 3300005327 Bacteria 2196
12 Ga0070658_10208176 3300005327 Bacteria 1652
13 Ga0070658_10295873 3300005327 Bacteria 1380
14 Ga0070658_10508086 3300005327 Bacteria 1041
15 Ga0070658_11495521 3300005327 Bacteria 585
16 Ga0070676_10549540 3300005328 Bacteria 826
17 Ga0070676_11076022 3300005328 Bacteria 607
18 Ga0070683_100011024 3300005329 Bacteria 7791
19 Ga0070683_100018611 3300005329 Bacteria 6156
20 Ga0070690_101158890 3300005330 Bacteria 615
21 Ga0070670_100045551 3300005331 Bacteria 3771
22 Ga0070670_100129434 3300005331 Bacteria 2179
23 Ga0070666_10017491 3300005335 Bacteria 4596
24 Ga0070680_100072921 3300005336 Bacteria 2822
25 Ga0068868_100287853 3300005338 Bacteria 1392
26 Ga0068868_100313468 3300005338 Bacteria 1335
27 Ga0070660_100060237 3300005339 Bacteria 2945
28 Ga0070660_100114145 3300005339 Bacteria 2151
29 Ga0070660_100136989 3300005339 Bacteria 1962
30 Ga0070660_100322534 3300005339 Bacteria 1269
31 Ga0070660_100538382 3300005339 Bacteria 973
32 Ga0070660_100638350 3300005339 Bacteria 891
33 Ga0070660_100703916 3300005339 Bacteria 847
34 Ga0070660_101109957 3300005339 Bacteria 669
35 Ga0070661_100071214 3300005344 Bacteria 2558
36 Ga0070661_100339669 3300005344 Bacteria 1176
37 Ga0070692_10012343 3300005345 Bacteria 3951
38 Ga0070692_10035902 3300005345 Bacteria 2513
39 Ga0070668_100235380 3300005347 Bacteria 1515
40 Ga0070668_100294436 3300005347 Bacteria 1359
41 Ga0070668_100585537 3300005347 Bacteria 974
42 Ga0070669_100070901 3300005353 Bacteria 2577
43 Ga0070669_101340051 3300005353 Unclassified 620
44 Ga0070671_100041832 3300005355 Bacteria 3808
45 Ga0070671_100268886 3300005355 Bacteria 1449
46 Ga0070674_101088411 3300005356 Bacteria 705
47 Ga0070673_100191725 3300005364 Bacteria 1756
48 Ga0070659_100003001 3300005366 Bacteria 12010
49 Ga0070659_100003460 3300005366 Bacteria 11241
50 Ga0070659_100111790 3300005366 Bacteria 2206
51 Ga0070659_100186081 3300005366 Bacteria 1706
52 Ga0070659_100359587 3300005366 Unclassified 1223
53 Ga0070659_100941026 3300005366 Bacteria 756
54 Ga0070667_100006814 3300005367 Bacteria 9490
55 Ga0070667_100013612 3300005367 Bacteria 6721
56 Ga0070667_101650826 3300005367 Bacteria 603
57 Ga0070714_100567322 3300005435 Bacteria 1088
58 Ga0070694_100042375 3300005444 Bacteria 3040
59 Ga0070663_100019157 3300005455 Bacteria 4504
60 Ga0070663_100030479 3300005455 Bacteria 3697
61 Ga0070663_100043702 3300005455 Bacteria 3154
62 Ga0070663_100382489 3300005455 Bacteria 1147
63 Ga0070663_101039160 3300005455 Plasmid 714
64 Ga0070662_100005430 3300005457 Bacteria 8142
65 Ga0070662_100008516 3300005457 Bacteria 6692
66 Ga0070662_100088041 3300005457 Bacteria 2326
67 Ga0070662_100196557 3300005457 Bacteria 1598
68 Ga0070681_10146459 3300005458 Bacteria 2290
69 Ga0070679_100249904 3300005530 Bacteria 1730
70 Ga0070679_100652825 3300005530 Bacteria 995
71 Ga0070679_100782886 3300005530 Bacteria 897
72 Ga0070679_101383028 3300005530 Bacteria 650
73 Ga0070684_100059231 3300005535 Bacteria 3347
74 Ga0068853_100095417 3300005539 Bacteria 2622
75 Ga0068853_100299509 3300005539 Bacteria 1486
76 Ga0068853_101066218 3300005539 Bacteria 779
77 Ga0068853_101915186 3300005539 Unclassified 575
78 Ga0068853_102360735 3300005539 Bacteria 515
79 Ga0070672_100101833 3300005543 Bacteria 2330
80 Ga0070672_100110081 3300005543 Bacteria 2244
81 Ga0070665_100000705 3300005548 Bacteria 44568
82 Ga0070665_100018851 3300005548 Bacteria 6918
83 Ga0070665_100983358 3300005548 Bacteria 856
84 Ga0070704_100193685 3300005549 Bacteria 1636
85 Ga0068855_100022702 3300005563 Bacteria 7519
86 Ga0068855_100183599 3300005563 Bacteria 2364
87 Ga0068855_100465143 3300005563 Bacteria 1378
88 Ga0068855_101278791 3300005563 Bacteria 760
89 Ga0068855_101720218 3300005563 Unclassified 639
90 Ga0070664_100422771 3300005564 Bacteria 1221
91 Ga0068857_100003749 3300005577 Bacteria 12770
92 Ga0068857_100046950 3300005577 Bacteria 3833
93 Ga0068857_100254433 3300005577 Bacteria 1611
94 Ga0068857_100341523 3300005577 Bacteria 1385
95 Ga0068854_100074798 3300005578 Bacteria 2486
96 Ga0068854_100149153 3300005578 Bacteria 1802
97 Ga0068854_100154653 3300005578 Bacteria 1771
98 Ga0068854_100412182 3300005578 Bacteria 1120
99 Ga0068856_100119331 3300005614 Bacteria 2638
100 Ga0068852_100032092 3300005616 Bacteria 4344
101 Ga0068852_100154155 3300005616 Bacteria 2139
102 Ga0068859_100000068 3300005617 Bacteria 96701
103 Ga0068864_100000074 3300005618 Bacteria 109458
104 Ga0068866_10690587 3300005718 Bacteria 699
105 Ga0068861_101886569 3300005719 Bacteria 594
106 Ga0068851_10243213 3300005834 Bacteria 1018
107 Ga0068863_100002129 3300005841 Bacteria 19652
108 Ga0068863_100010043 3300005841 Bacteria 9214
109 Ga0068858_100000911 3300005842 Bacteria 30658
110 Ga0068858_100776847 3300005842 Bacteria 934
111 Ga0068860_100002718 3300005843 Bacteria 18401
112 Ga0068860_100307369 3300005843 Bacteria 1554
113 Ga0068860_100437645 3300005843 Bacteria 1298
114 Ga0068860_100715692 3300005843 Bacteria 1011
115 Ga0068862_100112723 3300005844 Bacteria 2389
116 Ga0068862_100117193 3300005844 Bacteria 2343
117 Ga0068862_100213934 3300005844 Bacteria 1742
118 Ga0068862_100400484 3300005844 Bacteria 1284
119 Ga0068862_101348745 3300005844 Bacteria 715
120 Ga0068871_101877927 3300006358 Bacteria 569
121 Ga0075434_101301491 3300006871 Bacteria 738
122 Ga0097620_100000068 3300006931 Bacteria 96701
123 Ga0105251_10114909 3300009011 Bacteria 1225
124 Ga0105250_10046154 3300009092 Bacteria 1747
125 Ga0105240_10155192 3300009093 Bacteria 2723
126 Ga0105245_12566803 3300009098 Unclassified 563
127 Ga0105247_10094052 3300009101 Bacteria 1906
128 Ga0105243_10334866 3300009148 Bacteria 1384
129 Ga0105248_10000071 3300009177 Bacteria 118281
130 Ga0105238_10511040 3300009551 Bacteria 1203
131 Ga0105249_10010369 3300009553 Bacteria 8189
132 Ga0105249_10085827 3300009553 Bacteria 2934
133 Ga0105249_10161118 3300009553 Bacteria 2168
134 Ga0105239_10069920 3300010375 Bacteria 3855
135 Ga0105246_10067835 3300011119 Bacteria 2500
136 Ga0105246_10501765 3300011119 Bacteria 1031
137 Ga0105246_11742363 3300011119 Unclassified 593
138 Ga0157373_10057743 3300013100 Bacteria 2752
139 Ga0157371_10051359 3300013102 Bacteria 2930
140 Ga0157371_10068125 3300013102 Bacteria 2519
141 Ga0157371_10101447 3300013102 Bacteria 2041
142 Ga0157371_10101904 3300013102 Bacteria 2037
143 Ga0157370_10118179 3300013104 Bacteria 2476
144 Ga0157370_10167427 3300013104 Bacteria 2043
145 Ga0157369_10017142 3300013105 Bacteria 8138
146 Ga0157369_10345928 3300013105 Bacteria 1544
147 Ga0157374_10166778 3300013296 Bacteria 2147
148 Ga0157374_10810609 3300013296 Bacteria 952
149 Ga0157374_12117745 3300013296 Unclassified 589
150 Ga0157374_12302064 3300013296 Bacteria 566
151 Ga0157378_11233621 3300013297 Bacteria 788
152 Ga0163162_10041651 3300013306 Bacteria 4596
153 Ga0163162_10145849 3300013306 Bacteria 2483
154 Ga0157372_10102137 3300013307 Bacteria 3275
155 Ga0157372_10469276 3300013307 Bacteria 1467
156 Ga0157372_10544651 3300013307 Bacteria 1353
157 Ga0157372_12357406 3300013307 Bacteria 611
158 Ga0157375_11156136 3300013308 Bacteria 907
159 Ga0163163_10000424 3300014325 Bacteria 39058
160 Ga0163163_10103350 3300014325 Bacteria 2874
161 Ga0157380_13218817 3300014326 Bacteria 521
162 Ga0157377_10062220 3300014745 Bacteria 2135
163 Ga0157379_10047445 3300014968 Bacteria 3832
164 Ga0206354_11666149 3300020081 Bacteria 1468
165 Ga0206353_10466056 3300020082 Bacteria 3576
166 Ga0207656_10034194 3300025321 Bacteria 2121
167 Ga0207713_1081815 3300025735 Bacteria 1159
168 Ga0207642_10544635 3300025899 Bacteria 716
169 Ga0207688_10043915 3300025901 Bacteria 2490
170 Ga0207647_10004486 3300025904 Bacteria 10341
171 Ga0207647_10011342 3300025904 Bacteria 6254
172 Ga0207647_10018345 3300025904 Bacteria 4736
173 Ga0207647_10134491 3300025904 Bacteria 1451
174 Ga0207647_10489309 3300025904 Unclassified 687
175 Ga0207645_10390705 3300025907 Bacteria 935
176 Ga0207645_10572367 3300025907 Bacteria 767
177 Ga0207645_10958851 3300025907 Bacteria 580
178 Ga0207705_10019447 3300025909 Bacteria 4857
179 Ga0207705_10020451 3300025909 Bacteria 4729
180 Ga0207705_10041500 3300025909 Bacteria 3301
181 Ga0207705_10151954 3300025909 Bacteria 1735
182 Ga0207705_10152803 3300025909 Bacteria 1730
183 Ga0207705_10367799 3300025909 Bacteria 1109
184 Ga0207705_10381865 3300025909 Bacteria 1088
185 Ga0207705_10764114 3300025909 Bacteria 751
186 Ga0207707_10088280 3300025912 Bacteria 2709
187 Ga0207695_10070645 3300025913 Bacteria 3568
188 Ga0207693_10831714 3300025915 Unclassified 711
189 Ga0207660_10041667 3300025917 Bacteria 3219
190 Ga0207657_10001484 3300025919 Bacteria 25105
191 Ga0207657_10009192 3300025919 Bacteria 9966
192 Ga0207657_10009585 3300025919 Bacteria 9721
193 Ga0207657_10062452 3300025919 Bacteria 3189
194 Ga0207657_10145795 3300025919 Bacteria 1931
195 Ga0207657_10198237 3300025919 Bacteria 1616
196 Ga0207652_10031608 3300025921 Bacteria 4447
197 Ga0207652_10841868 3300025921 Bacteria 813
198 Ga0207652_10981111 3300025921 Bacteria 743
199 Ga0207681_10022270 3300025923 Bacteria 4040
200 Ga0207681_10171337 3300025923 Bacteria 1645
201 Ga0207681_10591908 3300025923 Bacteria 916
202 Ga0207681_11048049 3300025923 Bacteria 685
203 Ga0207650_10094516 3300025925 Unclassified 2290
204 Ga0207650_10276030 3300025925 Bacteria 1367
205 Ga0207644_10024533 3300025931 Bacteria 4141
206 Ga0207644_10053487 3300025931 Bacteria 2905
207 Ga0207644_10767601 3300025931 Bacteria 806
208 Ga0207690_10006245 3300025932 Bacteria 7054
209 Ga0207690_10031042 3300025932 Bacteria 3415
210 Ga0207690_10113978 3300025932 Bacteria 1952
211 Ga0207690_10131908 3300025932 Bacteria 1830
212 Ga0207690_10734073 3300025932 Bacteria 813
213 Ga0207690_10861746 3300025932 Bacteria 750
214 Ga0207706_10003775 3300025933 Bacteria 14456
215 Ga0207706_10129674 3300025933 Bacteria 2218
216 Ga0207706_10289452 3300025933 Bacteria 1428
217 Ga0207706_10422541 3300025933 Bacteria 1155
218 Ga0207709_11417226 3300025935 Bacteria 575
219 Ga0207669_10188879 3300025937 Bacteria 1484
220 Ga0207669_11869193 3300025937 Bacteria 513
221 Ga0207691_10040048 3300025940 Bacteria 4332
222 Ga0207691_10084858 3300025940 Bacteria 2842
223 Ga0207711_10000046 3300025941 Bacteria 153238
224 Ga0207689_10206138 3300025942 Bacteria 1624
225 Ga0207661_10140345 3300025944 Bacteria 2079
226 Ga0207679_10736295 3300025945 Bacteria 896
227 Ga0207667_10075694 3300025949 Bacteria 3494
228 Ga0207667_10207147 3300025949 Bacteria 2010
229 Ga0207667_10691235 3300025949 Unclassified 1023
230 Ga0207651_10008771 3300025960 Bacteria 5486
231 Ga0207651_10015770 3300025960 Bacteria 4403
232 Ga0207712_10002018 3300025961 Bacteria 13320
233 Ga0207712_10002162 3300025961 Bacteria 12845
234 Ga0207712_10232335 3300025961 Bacteria 1481
235 Ga0207668_10975917 3300025972 Bacteria 756
236 Ga0207668_11841974 3300025972 Bacteria 546
237 Ga0207640_10037833 3300025981 Bacteria 3039
238 Ga0207640_10143266 3300025981 Bacteria 1745
239 Ga0207640_10356755 3300025981 Bacteria 1177
240 Ga0207640_10513284 3300025981 Bacteria 1000
241 Ga0207658_10002809 3300025986 Bacteria 12519
242 Ga0207677_10019883 3300026023 Bacteria 4065
243 Ga0207677_10079165 3300026023 Bacteria 2349
244 Ga0207677_11286963 3300026023 Bacteria 671
245 Ga0207703_10005976 3300026035 Bacteria 9753
246 Ga0207639_11830249 3300026041 Bacteria 568
247 Ga0207639_12196103 3300026041 Bacteria 513
248 Ga0207678_10000938 3300026067 Bacteria 26581
249 Ga0207678_10038028 3300026067 Bacteria 4184
250 Ga0207678_10041857 3300026067 Bacteria 3970
251 Ga0207702_10027882 3300026078 Bacteria 4692
252 Ga0207702_10661039 3300026078 Bacteria 1028
253 Ga0207641_10000188 3300026088 Bacteria 86532
254 Ga0207641_10022827 3300026088 Bacteria 5152
255 Ga0207676_10000438 3300026095 Bacteria 35161
256 Ga0207674_10000607 3300026116 Bacteria 46991
257 Ga0207674_10003633 3300026116 Bacteria 18804
258 Ga0207674_10056377 3300026116 Bacteria 3991
259 Ga0207675_101082574 3300026118 Bacteria 821
260 Ga0207675_101159113 3300026118 Bacteria 793
261 Ga0207683_10301570 3300026121 Bacteria 1466
262 Ga0207698_10208930 3300026142 Bacteria 1755
263 Ga0207698_10254737 3300026142 Bacteria 1608
264 Ga0207698_11969910 3300026142 Unclassified 599
265 Ga0207698_12074535 3300026142 Bacteria 582
266 Ga0268266_10000133 3300028379 Bacteria 143210
267 Ga0268266_10236991 3300028379 Bacteria 1682
268 Ga0268266_11210732 3300028379 Bacteria 730
269 Ga0268265_10038048 3300028380 Bacteria 3536
270 Ga0268265_10068675 3300028380 Bacteria 2749
271 Ga0268265_10090274 3300028380 Bacteria 2447
272 Ga0268265_10313961 3300028380 Bacteria 1416
273 Ga0268265_10389086 3300028380 Bacteria 1285
274 Ga0268264_10003474 3300028381 Bacteria 13589
275 Ga0268264_10008704 3300028381 Bacteria 8430
276 Ga0268264_10263287 3300028381 Bacteria 1607
277 Ga0268264_10853077 3300028381 Bacteria 912
278 Ga0268264_10979718 3300028381 Bacteria 851
279 Ga0307513_10355935 3300031456 Bacteria 1210
280 Ga0307406_11013290 3300031901 Bacteria 713
281 Ga0373951_0128579 3300035091 Bacteria 695
282 Ga0373939_0174547 3300035114 Bacteria 798
283 Ga0373931_0629488 3300035691 Bacteria 703
284 Ga0395899_0066274 3300037312 Bacteria 2652
285 Ga0395899_0092848 3300037312 Bacteria 2185
286 Ga0395899_0164213 3300037312 Bacteria 1567
287 Ga0395899_0217655 3300037312 Bacteria 1324
288 Ga0395900_0001365 3300037418 Bacteria 29397
289 Ga0395900_0025498 3300037418 Bacteria 6053
290 Ga0395900_0039946 3300037418 Bacteria 4836
291 Ga0395900_0042842 3300037418 Bacteria 4663
292 Ga0395900_0109536 3300037418 Bacteria 2837
293 Ga0395900_0218694 3300037418 Bacteria 1921
294 Ga0395900_0310698 3300037418 Bacteria 1559
295 Ga0395900_0442018 3300037418 Bacteria 1258
296 Ga0395900_0478960 3300037418 Bacteria 1197
297 Ga0395900_0694472 3300037418 Bacteria 951
298 Ga0395900_1018035 3300037418 Bacteria 748
299 Ga0395898_0004373 3300037466 Bacteria 15457
300 Ga0395898_0017607 3300037466 Bacteria 7293
301 Ga0395898_0043518 3300037466 Bacteria 4424
302 Ga0395898_0053393 3300037466 Bacteria 3947
303 Ga0395898_0344894 3300037466 Bacteria 1420
304 Ga0395898_0379931 3300037466 Bacteria 1347
305 Ga0395898_1330552 3300037466 Bacteria 647
306 Ga0395898_1386153 3300037466 Bacteria 631
307 Ga0395905_0001405 3300037471 Bacteria 29143
308 Ga0395905_0002442 3300037471 Bacteria 20597
309 Ga0395905_0002664 3300037471 Bacteria 19591
310 Ga0395905_0006674 3300037471 Bacteria 11564
311 Ga0395905_0009990 3300037471 Bacteria 9251
312 Ga0395905_0010084 3300037471 Bacteria 9208
313 Ga0395905_0023120 3300037471 Bacteria 5877
314 Ga0395905_0142166 3300037471 Bacteria 2257
315 Ga0395905_0168698 3300037471 Bacteria 2056
316 Ga0395905_0191262 3300037471 Bacteria 1920
317 Ga0395905_0407089 3300037471 Bacteria 1255
318 Ga0395905_1111569 3300037471 Bacteria 694
319 Ga0395905_1181766 3300037471 Bacteria 668
320 Ga0395905_1775330 3300037471 Unclassified 522
321 Ga0395905_1775775 3300037471 Plasmid 522
322 Ga0395901_0005264 3300038443 Bacteria 13064
323 Ga0395901_0012250 3300038443 Bacteria 8703
324 Ga0395901_0029181 3300038443 Bacteria 5677
325 Ga0395901_0033245 3300038443 Bacteria 5323
326 Ga0395901_0034269 3300038443 Bacteria 5243
327 Ga0395901_0060837 3300038443 Bacteria 3930
328 Ga0395901_0096908 3300038443 Bacteria 3091
329 Ga0395901_0098480 3300038443 Bacteria 3066
330 Ga0395901_0277514 3300038443 Bacteria 1742
331 Ga0395901_0690107 3300038443 Bacteria 1020
332 Ga0395901_0775275 3300038443 Bacteria 950
333 Ga0395901_2123459 3300038443 Bacteria 507
334 Ga0439455_0141462 3300042012 Bacteria 682
335 Ga0439458_0001899 3300042157 Bacteria 5172
336 Ga0439458_0004254 3300042157 Bacteria 3304
337 Ga0466969_0255490 3300044656 Bacteria 794
338 Ga0466972_0043729 3300044658 Bacteria 2174
339 Ga0466972_0161949 3300044658 Bacteria 1051
340 Ga0466972_0331501 3300044658 Bacteria 711
341 Ga0466963_0095662 3300044694 Bacteria 2028
342 Ga0466971_0020898 3300044719 Bacteria 2910
343 Ga0466970_0023763 3300044765 Bacteria 3204
344 Ga0466970_0151713 3300044765 Bacteria 1279
345 Ga0466970_0199380 3300044765 Bacteria 1113
346 Ga0466957_0048366 3300044842 Bacteria 2585
347 Ga0466957_0124029 3300044842 Bacteria 1649
348 Ga0466957_0262137 3300044842 Bacteria 1152
349 Ga0466960_0138599 3300044901 Bacteria 1290
350 Ga0466959_0063579 3300045049 Bacteria 2679
351 Ga0466958_0108496 3300045836 Bacteria 1732
352 Ga0466958_0823109 3300045836 Bacteria 605
353 Ga0466967_0561518 3300045976 Bacteria 1124
354 Ga0466967_1321999 3300045976 Bacteria 718
355 Ga0495668_0014796 3300046616 Bacteria 4567
356 Ga0495625_0532237 3300046660 Bacteria 714
357 Ga0495669_0190761 3300046684 Bacteria 978
358 Ga0496101_0137792 3300048904 Bacteria 1858
359 Ga0496112_0699598 3300048915 Bacteria 941
360 Ga0496115_0048046 3300048918 Bacteria 3413
361 nmdc:mga0k408_108826_c1 3300050493 Bacteria 1637
362 nmdc:mga0n895_953045_c1 3300050512 Bacteria 841
363 nmdc:mga0rr50_191958_c1 3300050513 Bacteria 1674
364 nmdc:mga0a205_62268_c1 3300050515 Bacteria 3605
365 Ga0500658_0000315 3300053134 Bacteria 21646
366 Ga0068854_101368794
367 JGI24740J21852_10011600
368 JGI24737J22298_10001480
369 JGI24737J22298_10005858
370 JGI24735J21928_10049996
371 JGI24738J21930_10048745
372 Ga0065715_10681301
373 Ga0065715_10959560
374 Ga0070658_10062265
375 Ga0070658_10074449
376 Ga0070658_10118723
377 Ga0070658_10208176
378 Ga0070658_10295873
379 Ga0070658_10508086
380 Ga0070658_11495521
381 Ga0070676_10549540
382 Ga0070676_11076022
383 Ga0070683_100011024
384 Ga0070683_100018611
385 Ga0070690_101158890
386 Ga0070670_100045551
387 Ga0070670_100129434
388 Ga0070666_10017491
389 Ga0070680_100072921
390 Ga0068868_100287853
391 Ga0068868_100313468
392 Ga0070660_100060237
393 Ga0070660_100114145
394 Ga0070660_100136989
395 Ga0070660_100322534
396 Ga0070660_100538382
397 Ga0070660_100638350
398 Ga0070660_100703916
399 Ga0070660_101109957
400 Ga0070661_100071214
401 Ga0070661_100339669
402 Ga0070692_10012343
403 Ga0070692_10035902
404 Ga0070668_100235380
405 Ga0070668_100294436
406 Ga0070668_100585537
407 Ga0070669_100070901
408 Ga0070669_101340051
409 Ga0070671_100041832
410 Ga0070671_100268886
411 Ga0070674_101088411
412 Ga0070673_100191725
413 Ga0070659_100003001
414 Ga0070659_100003460
415 Ga0070659_100111790
416 Ga0070659_100186081
417 Ga0070659_100359587
418 Ga0070659_100941026
419 Ga0070667_100006814
420 Ga0070667_100013612
421 Ga0070667_101650826
422 Ga0070714_100567322
423 Ga0070694_100042375
424 Ga0070663_100019157
425 Ga0070663_100030479
426 Ga0070663_100043702
427 Ga0070663_100382489
428 Ga0070663_101039160
429 Ga0070662_100005430
430 Ga0070662_100008516
431 Ga0070662_100088041
432 Ga0070662_100196557
433 Ga0070681_10146459
434 Ga0070679_100249904
435 Ga0070679_100652825
436 Ga0070679_100782886
437 Ga0070679_101383028
438 Ga0070684_100059231
439 Ga0068853_100095417
440 Ga0068853_100299509
441 Ga0068853_101066218
442 Ga0068853_101915186
443 Ga0068853_102360735
444 Ga0070672_100101833
445 Ga0070672_100110081
446 Ga0070665_100000705
447 Ga0070665_100018851
448 Ga0070665_100983358
449 Ga0070704_100193685
450 Ga0068855_100022702
451 Ga0068855_100183599
452 Ga0068855_100465143
453 Ga0068855_101278791
454 Ga0068855_101720218
455 Ga0070664_100422771
456 Ga0068857_100003749
457 Ga0068857_100046950
458 Ga0068857_100254433
459 Ga0068857_100341523
460 Ga0068854_100074798
461 Ga0068854_100149153
462 Ga0068854_100154653
463 Ga0068854_100412182
464 Ga0068856_100119331
465 Ga0068852_100032092
466 Ga0068852_100154155
467 Ga0068859_100000068
468 Ga0068864_100000074
469 Ga0068866_10690587
470 Ga0068861_101886569
471 Ga0068851_10243213
472 Ga0068863_100002129
473 Ga0068863_100010043
474 Ga0068858_100000911
475 Ga0068858_100776847
476 Ga0068860_100002718
477 Ga0068860_100307369
478 Ga0068860_100437645
479 Ga0068860_100715692
480 Ga0068862_100112723
481 Ga0068862_100117193
482 Ga0068862_100213934
483 Ga0068862_100400484
484 Ga0068862_101348745
485 Ga0068871_101877927
486 Ga0075434_101301491
487 Ga0097620_100000068
488 Ga0105251_10114909
489 Ga0105250_10046154
490 Ga0105240_10155192
491 Ga0105245_12566803
492 Ga0105247_10094052
493 Ga0105243_10334866
494 Ga0105248_10000071
495 Ga0105238_10511040
496 Ga0105249_10010369
497 Ga0105249_10085827
498 Ga0105249_10161118
499 Ga0105239_10069920
500 Ga0105246_10067835
501 Ga0105246_10501765
502 Ga0105246_11742363
503 Ga0157373_10057743
504 Ga0157371_10051359
505 Ga0157371_10068125
506 Ga0157371_10101447
507 Ga0157371_10101904
508 Ga0157370_10118179
509 Ga0157370_10167427
510 Ga0157369_10017142
511 Ga0157369_10345928
512 Ga0157374_10166778
513 Ga0157374_10810609
514 Ga0157374_12117745
515 Ga0157374_12302064
516 Ga0157378_11233621
517 Ga0163162_10041651
518 Ga0163162_10145849
519 Ga0157372_10102137
520 Ga0157372_10469276
521 Ga0157372_10544651
522 Ga0157372_12357406
523 Ga0157375_11156136
524 Ga0163163_10000424
525 Ga0163163_10103350
526 Ga0157380_13218817
527 Ga0157377_10062220
528 Ga0157379_10047445
529 Ga0206354_11666149
530 Ga0206353_10466056
531 Ga0207656_10034194
532 Ga0207713_1081815
533 Ga0207642_10544635
534 Ga0207688_10043915
535 Ga0207647_10004486
536 Ga0207647_10011342
537 Ga0207647_10018345
538 Ga0207647_10134491
539 Ga0207647_10489309
540 Ga0207645_10390705
541 Ga0207645_10572367
542 Ga0207645_10958851
543 Ga0207705_10019447
544 Ga0207705_10020451
545 Ga0207705_10041500
546 Ga0207705_10151954
547 Ga0207705_10152803
548 Ga0207705_10367799
549 Ga0207705_10381865
550 Ga0207705_10764114
551 Ga0207707_10088280
552 Ga0207695_10070645
553 Ga0207693_10831714
554 Ga0207660_10041667
555 Ga0207657_10001484
556 Ga0207657_10009192
557 Ga0207657_10009585
558 Ga0207657_10062452
559 Ga0207657_10145795
560 Ga0207657_10198237
561 Ga0207652_10031608
562 Ga0207652_10841868
563 Ga0207652_10981111
564 Ga0207681_10022270
565 Ga0207681_10171337
566 Ga0207681_10591908
567 Ga0207681_11048049
568 Ga0207650_10094516
569 Ga0207650_10276030
570 Ga0207644_10024533
571 Ga0207644_10053487
572 Ga0207644_10767601
573 Ga0207690_10006245
574 Ga0207690_10031042
575 Ga0207690_10113978
576 Ga0207690_10131908
577 Ga0207690_10734073
578 Ga0207690_10861746
579 Ga0207706_10003775
580 Ga0207706_10129674
581 Ga0207706_10289452
582 Ga0207706_10422541
583 Ga0207709_11417226
584 Ga0207669_10188879
585 Ga0207669_11869193
586 Ga0207691_10040048
587 Ga0207691_10084858
588 Ga0207711_10000046
589 Ga0207689_10206138
590 Ga0207661_10140345
591 Ga0207679_10736295
592 Ga0207667_10075694
593 Ga0207667_10207147
594 Ga0207667_10691235
595 Ga0207651_10008771
596 Ga0207651_10015770
597 Ga0207712_10002018
598 Ga0207712_10002162
599 Ga0207712_10232335
600 Ga0207668_10975917
601 Ga0207668_11841974
602 Ga0207640_10037833
603 Ga0207640_10143266
604 Ga0207640_10356755
605 Ga0207640_10513284
606 Ga0207658_10002809
607 Ga0207677_10019883
608 Ga0207677_10079165
609 Ga0207677_11286963
610 Ga0207703_10005976
611 Ga0207639_11830249
612 Ga0207639_12196103
613 Ga0207678_10000938
614 Ga0207678_10038028
615 Ga0207678_10041857
616 Ga0207702_10027882
617 Ga0207702_10661039
618 Ga0207641_10000188
619 Ga0207641_10022827
620 Ga0207676_10000438
621 Ga0207674_10000607
622 Ga0207674_10003633
623 Ga0207674_10056377
624 Ga0207675_101082574
625 Ga0207675_101159113
626 Ga0207683_10301570
627 Ga0207698_10208930
628 Ga0207698_10254737
629 Ga0207698_11969910
630 Ga0207698_12074535
631 Ga0268266_10000133
632 Ga0268266_10236991
633 Ga0268266_11210732
634 Ga0268265_10038048
635 Ga0268265_10068675
636 Ga0268265_10090274
637 Ga0268265_10313961
638 Ga0268265_10389086
639 Ga0268264_10003474
640 Ga0268264_10008704
641 Ga0268264_10263287
642 Ga0268264_10853077
643 Ga0268264_10979718
644 Ga0307513_10355935
645 Ga0307406_11013290
646 Ga0373951_0128579
647 Ga0373939_0174547
648 Ga0373931_0629488
649 Ga0395899_0066274
650 Ga0395899_0092848
651 Ga0395899_0164213
652 Ga0395899_0217655
653 Ga0395900_0001365
654 Ga0395900_0025498
655 Ga0395900_0039946
656 Ga0395900_0042842
657 Ga0395900_0109536
658 Ga0395900_0218694
659 Ga0395900_0310698
660 Ga0395900_0442018
661 Ga0395900_0478960
662 Ga0395900_0694472
663 Ga0395900_1018035
664 Ga0395898_0004373
665 Ga0395898_0017607
666 Ga0395898_0043518
667 Ga0395898_0053393
668 Ga0395898_0344894
669 Ga0395898_0379931
670 Ga0395898_1330552
671 Ga0395898_1386153
672 Ga0395905_0001405
673 Ga0395905_0002442
674 Ga0395905_0002664
675 Ga0395905_0006674
676 Ga0395905_0009990
677 Ga0395905_0010084
678 Ga0395905_0023120
679 Ga0395905_0142166
680 Ga0395905_0168698
681 Ga0395905_0191262
682 Ga0395905_0407089
683 Ga0395905_1111569
684 Ga0395905_1181766
685 Ga0395905_1775330
686 Ga0395905_1775775
687 Ga0395901_0005264
688 Ga0395901_0012250
689 Ga0395901_0029181
690 Ga0395901_0033245
691 Ga0395901_0034269
692 Ga0395901_0060837
693 Ga0395901_0096908
694 Ga0395901_0098480
695 Ga0395901_0277514
696 Ga0395901_0690107
697 Ga0395901_0775275
698 Ga0395901_2123459
699 Ga0439455_0141462
700 Ga0439458_0001899
701 Ga0439458_0004254
702 Ga0466969_0255490
703 Ga0466972_0043729
704 Ga0466972_0161949
705 Ga0466972_0331501
706 Ga0466963_0095662
707 Ga0466971_0020898
708 Ga0466970_0023763
709 Ga0466970_0151713
710 Ga0466970_0199380
711 Ga0466957_0048366
712 Ga0466957_0124029
713 Ga0466957_0262137
714 Ga0466960_0138599
715 Ga0466959_0063579
716 Ga0466958_0108496
717 Ga0466958_0823109
718 Ga0466967_0561518
719 Ga0466967_1321999
720 Ga0495668_0014796
721 Ga0495625_0532237
722 Ga0495669_0190761
723 Ga0496101_0137792
724 Ga0496112_0699598
725 Ga0496115_0048046
726 nmdc:mga0k408_108826_c1
727 nmdc:mga0n895_953045_c1
728 nmdc:mga0rr50_191958_c1
729 nmdc:mga0a205_62268_c1
730 Ga0500658_0000315

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11720

Inhibitor_I78

Peptidase inhibitor I78 family

33

97

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ulj-assembly3.cif.gz_C crystal structure of scheffersomyces stipitis rai1 in complex with (3'-nadp)+ and calcium ion 0.9078 78 93
8ezi-assembly1.cif.gz_B a tethered niacin-derived pincer complex with a nickel-carbon bond in lactate racemase r98a/r100a variant modeled with separated sulfite and npn 0.8658 78 92
6d6z-assembly1.cif.gz_A structure of the malate racemase apoprotein from thermoanaerobacterium thermosaccharolyticum 0.8266 78 92
7s91-assembly1.cif.gz_A structure of the malate racemase mar2 apoprotein from thermoanaerobacterium thermosaccharolyticum at 2.25 angstroms resolution 0.8101 78 92
1vbw-assembly1.cif.gz_A crystal structure of bitter gourd trypsin inhibitor 0.7836 38 95
ID Description Score Start End Superfamily
af_A0A0P0VE32_15_87_3.30.10.10 Alpha Beta;2-Layer Sandwich;Trypsin Inhibitor V; Chain A;Trypsin Inhibitor V, subunit A 0.8026 38 95 3.30.10.10
af_C6Y4A9_11_76_3.30.10.10 Alpha Beta;2-Layer Sandwich;Trypsin Inhibitor V; Chain A;Trypsin Inhibitor V, subunit A 0.797 58 93 3.30.10.10
af_Q53PR9_2_67_3.30.10.10 Alpha Beta;2-Layer Sandwich;Trypsin Inhibitor V; Chain A;Trypsin Inhibitor V, subunit A 0.7912 37 95 3.30.10.10
af_Q9STF8_18_85_3.30.10.10 Alpha Beta;2-Layer Sandwich;Trypsin Inhibitor V; Chain A;Trypsin Inhibitor V, subunit A 0.7888 38 95 3.30.10.10
af_A0A1P8B9R8_9_84_3.30.10.10 Alpha Beta;2-Layer Sandwich;Trypsin Inhibitor V; Chain A;Trypsin Inhibitor V, subunit A 0.7883 37 92 3.30.10.10
ID Description Score Start End GO Terms
AF-A0A350KXC5-F1-model_v4 deleted 0.9474 28 95
AF-W1L063-F1-model_v4 deleted 0.9458 28 95
AF-A0A5C6U955-F1-model_v4 Peptidase inhibitor I78 0.9386 22 95
AF-A0A291A7A7-F1-model_v4 deleted 0.9348 38 95
AF-A0A2N1Y521-F1-model_v4 Peptidase inhibitor I78 family protein 0.9342 30 95

Map