F423629

General Info

Members Datasets Scaffolds Average Seq Length
365 228 365 251

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100052930|Ga0075430_1000529303
Length 261
Sequence MRRALRSVLYVCVVVLFTAAGVTVTATDWRSSSREPARLAPDPALVREAVVQVYGARAMGAKGLFGVHTWIAVKGTDAPTWTVYEVIGWRLRWAESVVVVRNRQPDARWFGGAPELYADKRGDIDLLIERIDKAARAYPYAAEYTLWPGPNSNTFTAWIGRAVPELEIDLPATAIGKDYLGSSVFAAAPSGSGFQISLGGVLGVAASGVEGLELNILGLTFGVGPSGVKLPLVGRIGAWRPMPVLKDAQAAISAPTRTAAD

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
116 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
117 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
118 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
125 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
126 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
127 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
128 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
129 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
130 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
131 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
132 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
133 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
134 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
135 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
136 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
137 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
138 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
139 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
140 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
144 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
152 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
155 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
156 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
157 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
158 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
159 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
160 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
161 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
162 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
163 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
164 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
165 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
166 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
167 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
168 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
169 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
170 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
171 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
172 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
173 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
174 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
175 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
176 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
179 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
180 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
181 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
196 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
201 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
202 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
203 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
204 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
205 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
208 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
212 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
213 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
214 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
215 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
216 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
217 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
220 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
221 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
222 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
223 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
224 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
225 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
226 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
227 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
228 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.55
Nodule 0
Rhizoplane 0
Rhizosphere 99.45
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10195404 3300005328 Bacteria 1323
2 Ga0070690_100001783 3300005330 Bacteria 11384
3 Ga0070690_100056158 3300005330 Bacteria 2524
4 Ga0070670_100079715 3300005331 Bacteria 2814
5 Ga0070677_10005859 3300005333 Bacteria 4069
6 Ga0068869_100002060 3300005334 Bacteria 12087
7 Ga0070680_100003307 3300005336 Bacteria 12031
8 Ga0070682_100058635 3300005337 Bacteria 2428
9 Ga0068868_100003770 3300005338 Bacteria 10581
10 Ga0070689_100001092 3300005340 Bacteria 17023
11 Ga0070691_10002036 3300005341 Bacteria 8921
12 Ga0070687_100000798 3300005343 Bacteria 10475
13 Ga0070669_100494532 3300005353 Bacteria 1014
14 Ga0070675_100023299 3300005354 Bacteria 4949
15 Ga0070675_100070358 3300005354 Bacteria 2900
16 Ga0070675_100086276 3300005354 Bacteria 2623
17 Ga0070675_100621222 3300005354 Unclassified 981
18 Ga0070671_100177326 3300005355 Bacteria 1804
19 Ga0070671_100299601 3300005355 Unclassified 1369
20 Ga0070674_100028993 3300005356 Bacteria 3639
21 Ga0070674_100078216 3300005356 Bacteria 2356
22 Ga0070673_100042189 3300005364 Bacteria 3516
23 Ga0070673_100411826 3300005364 Bacteria 1210
24 Ga0070673_100445484 3300005364 Bacteria 1164
25 Ga0070673_100831441 3300005364 Bacteria 854
26 Ga0070667_100194044 3300005367 Bacteria 1800
27 Ga0070667_100214474 3300005367 Bacteria 1712
28 Ga0070701_10000854 3300005438 Bacteria 10926
29 Ga0070705_100000473 3300005440 Bacteria 23135
30 Ga0070700_100008675 3300005441 Bacteria 5545
31 Ga0070694_100001201 3300005444 Bacteria 14934
32 Ga0070694_100084162 3300005444 Bacteria 2218
33 Ga0070662_100038273 3300005457 Bacteria 3407
34 Ga0070681_10040259 3300005458 Bacteria 4683
35 Ga0070681_10615741 3300005458 Bacteria 1000
36 Ga0068867_100006649 3300005459 Bacteria 8174
37 Ga0070699_100282077 3300005518 Bacteria 1488
38 Ga0070679_100007832 3300005530 Bacteria 10017
39 Ga0070679_100028416 3300005530 Bacteria 5514
40 Ga0070697_100090532 3300005536 Bacteria 2528
41 Ga0070697_100347716 3300005536 Unclassified 1280
42 Ga0070697_100393498 3300005536 Bacteria 1202
43 Ga0070672_100064459 3300005543 Bacteria 2895
44 Ga0070672_100085115 3300005543 Bacteria 2540
45 Ga0070672_100471291 3300005543 Bacteria 1083
46 Ga0070686_100002127 3300005544 Bacteria 10911
47 Ga0070686_100286939 3300005544 Bacteria 1216
48 Ga0070695_100000891 3300005545 Bacteria 16128
49 Ga0070695_100359793 3300005545 Bacteria 1093
50 Ga0070696_100000008 3300005546 Bacteria 101365
51 Ga0070696_100019639 3300005546 Bacteria 4577
52 Ga0070696_100058001 3300005546 Bacteria 2703
53 Ga0070696_100247437 3300005546 Bacteria 1347
54 Ga0070693_100000008 3300005547 Bacteria 80726
55 Ga0070693_100079956 3300005547 Bacteria 1946
56 Ga0070665_100340047 3300005548 Bacteria 1505
57 Ga0070704_100002526 3300005549 Bacteria 10298
58 Ga0070704_100128799 3300005549 Bacteria 1958
59 Ga0070704_100258675 3300005549 Unclassified 1433
60 Ga0070704_100407380 3300005549 Bacteria 1162
61 Ga0068855_100070235 3300005563 Bacteria 4075
62 Ga0070664_100177346 3300005564 Bacteria 1892
63 Ga0068854_100003486 3300005578 Bacteria 9827
64 Ga0068856_100007752 3300005614 Bacteria 10485
65 Ga0070702_100000062 3300005615 Bacteria 31206
66 Ga0068859_100003274 3300005617 Bacteria 16483
67 Ga0068861_100002708 3300005719 Bacteria 11594
68 Ga0068851_10176893 3300005834 Bacteria 1180
69 Ga0068870_10100408 3300005840 Bacteria 1634
70 Ga0068863_100410965 3300005841 Bacteria 1325
71 Ga0068858_100003684 3300005842 Bacteria 15183
72 Ga0068860_100011051 3300005843 Bacteria 8902
73 Ga0068862_100008658 3300005844 Bacteria 8417
74 Ga0068862_100087190 3300005844 Bacteria 2715
75 Ga0075366_10071349 3300006195 Bacteria 2069
76 Ga0097621_100012215 3300006237 Bacteria 6356
77 Ga0068871_100000682 3300006358 Bacteria 23114
78 Ga0068871_100019879 3300006358 Bacteria 5134
79 Ga0075428_100000615 3300006844 Bacteria 36398
80 Ga0075428_100083984 3300006844 Bacteria 3474
81 Ga0075430_100018223 3300006846 Bacteria 5975
82 Ga0075430_100052930 3300006846 Unclassified 3418
83 Ga0075431_100002681 3300006847 Bacteria 17246
84 Ga0075431_100026728 3300006847 Bacteria 5920
85 Ga0075431_100051127 3300006847 Bacteria 4263
86 Ga0075433_10034452 3300006852 Bacteria 4349
87 Ga0075433_10138425 3300006852 Bacteria 2164
88 Ga0075434_100000002 3300006871 Bacteria 135661
89 Ga0075429_100000150 3300006880 Bacteria 43105
90 Ga0068865_100001702 3300006881 Bacteria 12899
91 Ga0075436_100000939 3300006914 Bacteria 19466
92 Ga0075436_100232778 3300006914 Bacteria 1309
93 Ga0097620_100003274 3300006931 Bacteria 16483
94 Ga0075435_100021533 3300007076 Bacteria 4960
95 Ga0075435_100033315 3300007076 Bacteria 4072
96 Ga0075435_100141667 3300007076 Bacteria 2017
97 Ga0099794_10045775 3300007265 Bacteria 2094
98 Ga0099794_10278426 3300007265 Bacteria 865
99 Ga0111539_10050332 3300009094 Bacteria 4962
100 Ga0111539_10099119 3300009094 Bacteria 3423
101 Ga0111539_10553555 3300009094 Bacteria 1340
102 Ga0105245_10000776 3300009098 Bacteria 28947
103 Ga0105245_10582165 3300009098 Bacteria 1144
104 Ga0114129_10000534 3300009147 Bacteria 46594
105 Ga0105243_10006740 3300009148 Bacteria 8861
106 Ga0105242_10013766 3300009176 Bacteria 6260
107 Ga0105248_10198731 3300009177 Unclassified 2259
108 Ga0105248_10450125 3300009177 Bacteria 1451
109 Ga0105249_10011784 3300009553 Bacteria 7686
110 Ga0105249_10021252 3300009553 Bacteria 5810
111 Ga0157378_10005811 3300013297 Bacteria 10814
112 Ga0163162_10308515 3300013306 Bacteria 1715
113 Ga0157375_10197034 3300013308 Bacteria 2169
114 Ga0157375_10272513 3300013308 Bacteria 1855
115 Ga0157380_10094056 3300014326 Bacteria 2480
116 Ga0157376_10006552 3300014969 Bacteria 8238
117 Ga0157376_10028031 3300014969 Bacteria 4472
118 Ga0157376_10459166 3300014969 Bacteria 1244
119 Ga0207682_10006030 3300025893 Bacteria 4900
120 Ga0207682_10125093 3300025893 Bacteria 1144
121 Ga0207682_10180236 3300025893 Unclassified 965
122 Ga0207642_10001205 3300025899 Bacteria 7991
123 Ga0207647_10069742 3300025904 Bacteria 2125
124 Ga0207699_10183491 3300025906 Bacteria 1408
125 Ga0207645_10103860 3300025907 Bacteria 1835
126 Ga0207645_10104126 3300025907 Bacteria 1833
127 Ga0207645_10182951 3300025907 Bacteria 1375
128 Ga0207707_10044178 3300025912 Bacteria 3885
129 Ga0207707_10455708 3300025912 Bacteria 1094
130 Ga0207662_10075693 3300025918 Bacteria 2045
131 Ga0207652_10014237 3300025921 Bacteria 6442
132 Ga0207652_10109894 3300025921 Unclassified 2444
133 Ga0207681_10169307 3300025923 Bacteria 1655
134 Ga0207650_10001506 3300025925 Bacteria 16663
135 Ga0207650_10017853 3300025925 Bacteria 4971
136 Ga0207650_10273632 3300025925 Bacteria 1373
137 Ga0207659_10048393 3300025926 Bacteria 3011
138 Ga0207659_10130032 3300025926 Bacteria 1942
139 Ga0207687_10004203 3300025927 Bacteria 9630
140 Ga0207664_10158168 3300025929 Bacteria 1930
141 Ga0207644_10441708 3300025931 Bacteria 1068
142 Ga0207706_10033949 3300025933 Bacteria 4541
143 Ga0207686_10001994 3300025934 Bacteria 11251
144 Ga0207709_10036830 3300025935 Unclassified 2902
145 Ga0207709_10263352 3300025935 Bacteria 1265
146 Ga0207670_10002287 3300025936 Bacteria 10036
147 Ga0207669_10224559 3300025937 Bacteria 1381
148 Ga0207669_10396798 3300025937 Bacteria 1079
149 Ga0207704_10006990 3300025938 Bacteria 5300
150 Ga0207665_10070508 3300025939 Bacteria 2385
151 Ga0207691_10006240 3300025940 Bacteria 11513
152 Ga0207691_10019378 3300025940 Bacteria 6438
153 Ga0207691_10051428 3300025940 Bacteria 3767
154 Ga0207691_10082127 3300025940 Bacteria 2895
155 Ga0207691_10129024 3300025940 Bacteria 2235
156 Ga0207691_10279209 3300025940 Bacteria 1437
157 Ga0207691_10280804 3300025940 Bacteria 1433
158 Ga0207711_10281430 3300025941 Bacteria 1532
159 Ga0207689_10001217 3300025942 Bacteria 24753
160 Ga0207661_10065454 3300025944 Bacteria 2951
161 Ga0207679_10183559 3300025945 Bacteria 1733
162 Ga0207651_10039546 3300025960 Bacteria 3111
163 Ga0207712_10014988 3300025961 Bacteria 4995
164 Ga0207640_10007328 3300025981 Bacteria 6091
165 Ga0207658_10134648 3300025986 Bacteria 1990
166 Ga0207658_10305246 3300025986 Bacteria 1373
167 Ga0207678_10258654 3300026067 Bacteria 1492
168 Ga0207678_10702254 3300026067 Bacteria 890
169 Ga0207708_10005256 3300026075 Bacteria 9532
170 Ga0207702_10132146 3300026078 Unclassified 2247
171 Ga0207648_10000708 3300026089 Bacteria 37374
172 Ga0207648_10023879 3300026089 Bacteria 5467
173 Ga0207648_10170640 3300026089 Unclassified 1923
174 Ga0207648_10452263 3300026089 Bacteria 1170
175 Ga0207675_100001101 3300026118 Bacteria 26742
176 Ga0207683_10049701 3300026121 Bacteria 3672
177 Ga0207698_10460482 3300026142 Bacteria 1230
178 Ga0207428_10036635 3300027907 Bacteria 4000
179 Ga0268264_10015270 3300028381 Bacteria 6298
180 Ga0307408_100042598 3300031548 Bacteria 3226
181 Ga0307405_10006111 3300031731 Bacteria 5893
182 Ga0307405_10023640 3300031731 Bacteria 3496
183 Ga0307410_10004097 3300031852 Bacteria 7463
184 Ga0307410_10450500 3300031852 Bacteria 1050
185 Ga0307406_10015511 3300031901 Bacteria 4412
186 Ga0307407_10035172 3300031903 Bacteria 2750
187 Ga0307412_10009226 3300031911 Bacteria 5655
188 Ga0307412_10052138 3300031911 Bacteria 2708
189 Ga0307409_100001262 3300031995 Bacteria 12197
190 Ga0307409_100004368 3300031995 Bacteria 7933
191 Ga0307416_100003871 3300032002 Bacteria 8910
192 Ga0307416_100115166 3300032002 Bacteria 2380
193 Ga0307414_10056633 3300032004 Bacteria 2751
194 Ga0307414_10567508 3300032004 Unclassified 1014
195 Ga0307411_10016963 3300032005 Bacteria 4134
196 Ga0307411_10034428 3300032005 Bacteria 3153
197 Ga0307411_10383368 3300032005 Bacteria 1157
198 Ga0307415_100001682 3300032126 Bacteria 10742
199 Ga0373930_0000956 3300034816 Bacteria 4135
200 Ga0373948_0006956 3300034817 Bacteria 1888
201 Ga0373926_0007570 3300035083 Bacteria 3616
202 Ga0373928_0007436 3300035084 Bacteria 2112
203 Ga0373944_0013313 3300035089 Unclassified 2279
204 Ga0373949_0005142 3300035090 Bacteria 2936
205 Ga0373951_0000936 3300035091 Bacteria 7850
206 Ga0373952_0028633 3300035092 Bacteria 1223
207 Ga0373953_0011942 3300035117 Bacteria 3061
208 Ga0373954_0000082 3300035118 Bacteria 33880
209 Ga0373960_0015419 3300035121 Unclassified 1951
210 Ga0373943_0017396 3300035170 Bacteria 3288
211 Ga0373946_0012329 3300035171 Bacteria 3198
212 Ga0373946_0036009 3300035171 Bacteria 2004
213 Ga0373955_0007680 3300035172 Bacteria 4966
214 Ga0373955_0117787 3300035172 Bacteria 1541
215 Ga0373942_0002904 3300035207 Bacteria 4065
216 Ga0373961_0006014 3300035241 Bacteria 2913
217 Ga0373924_0008352 3300035410 Bacteria 3758
218 Ga0373924_0042535 3300035410 Bacteria 1864
219 Ga0373931_0000123 3300035691 Bacteria 34923
220 Ga0373931_0005277 3300035691 Bacteria 5957
221 Ga0373931_0049370 3300035691 Bacteria 2235
222 Ga0373935_0013373 3300035692 Bacteria 4951
223 Ga0373935_0080060 3300035692 Bacteria 2121
224 Ga0373927_0063881 3300035695 Bacteria 2381
225 Ga0373933_0001013 3300035724 Bacteria 17051
226 Ga0373947_0108734 3300035725 Bacteria 1749
227 Ga0373937_0000696 3300036401 Bacteria 29326
228 Ga0373937_0011742 3300036401 Bacteria 7682
229 Ga0373937_0018426 3300036401 Bacteria 6235
230 Ga0373937_0028530 3300036401 Bacteria 5051
231 Ga0373937_0174774 3300036401 Bacteria 2016
232 Ga0373925_0021284 3300037068 Bacteria 4725
233 Ga0373925_0112746 3300037068 Unclassified 2102
234 Ga0395905_0209697 3300037471 Bacteria 1825
235 Ga0439464_0000635 3300042439 Bacteria 7462
236 Ga0451576_0026616 3300045051 Bacteria 6219
237 Ga0451576_0043218 3300045051 Bacteria 4755
238 Ga0451576_0102487 3300045051 Bacteria 2977
239 Ga0495592_0031573 3300046454 Bacteria 4002
240 Ga0495603_0007405 3300046455 Bacteria 6599
241 Ga0495629_0025371 3300046459 Bacteria 4214
242 Ga0495580_0008226 3300046472 Bacteria 8300
243 Ga0495580_0196059 3300046472 Bacteria 1392
244 Ga0495594_0055156 3300046499 Bacteria 2191
245 Ga0495608_0030379 3300046511 Bacteria 3657
246 Ga0495618_0017009 3300046514 Bacteria 4456
247 Ga0495628_0004277 3300046516 Bacteria 12699
248 Ga0495630_0010914 3300046517 Bacteria 6562
249 Ga0495666_0004404 3300046526 Bacteria 7119
250 Ga0495652_0042663 3300046529 Bacteria 3911
251 Ga0495586_0003458 3300046535 Bacteria 8466
252 Ga0495586_0006032 3300046535 Bacteria 6480
253 Ga0495587_0012604 3300046536 Bacteria 5316
254 Ga0495587_0333287 3300046536 Bacteria 847
255 Ga0495598_0027164 3300046537 Unclassified 1576
256 Ga0495667_0083007 3300046559 Bacteria 2081
257 Ga0495634_0011436 3300046642 Bacteria 6464
258 Ga0495635_0097748 3300046663 Bacteria 2007
259 Ga0495588_0001118 3300046674 Bacteria 11547
260 Ga0495599_0026712 3300046678 Bacteria 3619
261 Ga0495647_0000296 3300046681 Bacteria 13906
262 Ga0495647_0078355 3300046681 Bacteria 1336
263 Ga0495658_0003865 3300046683 Bacteria 7413
264 Ga0495658_0006613 3300046683 Bacteria 5696
265 Ga0495613_0002300 3300046689 Bacteria 14468
266 Ga0495624_0209057 3300046690 Bacteria 1184
267 Ga0495600_0012090 3300046809 Bacteria 5391
268 Ga0495581_0094314 3300047315 Bacteria 1737
269 Ga0495604_0001661 3300047317 Bacteria 18303
270 Ga0495674_0405660 3300047319 Bacteria 1100
271 Ga0495676_0121086 3300047321 Bacteria 1903
272 Ga0495680_0005343 3300047322 Bacteria 12118
273 Ga0495680_0299846 3300047322 Bacteria 1128
274 Ga0495684_0105898 3300047471 Bacteria 2125
275 Ga0495684_0377383 3300047471 Bacteria 1001
276 Ga0501032_0025016 3300049569 Bacteria 4118
277 Ga0501032_0038092 3300049569 Bacteria 3276
278 Ga0501033_0004982 3300049570 Bacteria 10559
279 Ga0501034_0134601 3300049571 Bacteria 2453
280 Ga0501034_0142077 3300049571 Bacteria 2379
281 Ga0501036_0005335 3300049572 Bacteria 10402
282 Ga0501037_0008974 3300049573 Bacteria 7323
283 Ga0501037_0027004 3300049573 Bacteria 4242
284 Ga0501038_0000189 3300049574 Bacteria 53371
285 Ga0501039_0002605 3300049575 Bacteria 13470
286 Ga0501039_0007329 3300049575 Bacteria 8404
287 Ga0501040_0000641 3300049576 Bacteria 21409
288 Ga0501040_0045402 3300049576 Unclassified 2997
289 Ga0501041_0000419 3300049577 Bacteria 21489
290 Ga0501041_0006847 3300049577 Bacteria 6679
291 Ga0501041_0052399 3300049577 Bacteria 2488
292 Ga0501042_0236834 3300049578 Archaea 1317
293 Ga0501043_0155564 3300049579 Unclassified 1788
294 Ga0501043_0368210 3300049579 Unclassified 1089
295 Ga0501046_0000156 3300049580 Bacteria 70512
296 Ga0501046_0159029 3300049580 Unclassified 1700
297 Ga0501047_0452683 3300049581 Bacteria 1113
298 Ga0501048_0006934 3300049582 Bacteria 8608
299 Ga0501048_0091308 3300049582 Bacteria 2148
300 Ga0501068_0010284 3300049584 Bacteria 5254
301 Ga0501068_0208431 3300049584 Archaea 1241
302 Ga0501069_0427147 3300049585 Bacteria 786
303 Ga0501070_0065987 3300049586 Bacteria 2997
304 Ga0501071_0007763 3300049587 Bacteria 7075
305 Ga0501072_0001123 3300049588 Bacteria 19892
306 Ga0501072_0067345 3300049588 Bacteria 2825
307 Ga0501072_0126537 3300049588 Unclassified 2036
308 Ga0501072_0253255 3300049588 Bacteria 1402
309 Ga0501074_0056206 3300049590 Bacteria 2836
310 Ga0501074_0310926 3300049590 Bacteria 1119
311 Ga0501075_0000053 3300049591 Bacteria 49110
312 Ga0501075_0098447 3300049591 Bacteria 2220
313 Ga0501076_0000699 3300049592 Bacteria 21626
314 Ga0501076_0003919 3300049592 Bacteria 10494
315 Ga0501076_0029682 3300049592 Bacteria 4254
316 Ga0501077_0000543 3300049593 Bacteria 22905
317 Ga0501077_0164236 3300049593 Bacteria 1410
318 Ga0501077_0217464 3300049593 Archaea 1214
319 Ga0501253_045575 3300049683 Bacteria 901
320 Ga0501079_0000351 3300049741 Bacteria 29422
321 Ga0501079_0005720 3300049741 Bacteria 9291
322 Ga0501079_0147079 3300049741 Unclassified 1836
323 Ga0501080_0011696 3300049742 Bacteria 8040
324 Ga0501081_0000440 3300049743 Bacteria 22990
325 Ga0501081_0006480 3300049743 Bacteria 7599
326 Ga0501083_0199321 3300049744 Unclassified 1306
327 Ga0501035_0008001 3300049822 Bacteria 9852
328 Ga0501044_0090019 3300049823 Bacteria 3097
329 Ga0501045_0001147 3300049824 Bacteria 17545
330 Ga0501045_0021006 3300049824 Bacteria 4667
331 Ga0501045_0046239 3300049824 Bacteria 3169
332 Ga0501045_0447670 3300049824 Unclassified 960
333 nmdc:mga0k408_17273_c1 3300050493 Bacteria 4017
334 nmdc:mga05p37_453_c1 3300050507 Bacteria 44606
335 nmdc:mga09592_1204_c1 3300050508 Bacteria 20724
336 nmdc:mga09592_297336_c1 3300050508 Bacteria 1400
337 nmdc:mga0qj67_13543_c1 3300050509 Bacteria 6152
338 nmdc:mga06r32_169489_c1 3300050510 Unclassified 2167
339 nmdc:mga06r32_211989_c1 3300050510 Bacteria 1925
340 nmdc:mga06r32_266981_c1 3300050510 Unclassified 1699
341 nmdc:mga08y16_1936_c1 3300050511 Bacteria 21123
342 nmdc:mga08y16_417247_c1 3300050511 Bacteria 1372
343 nmdc:mga08y16_86766_c1 3300050511 Bacteria 3261
344 nmdc:mga0n895_738_c1 3300050512 Bacteria 23103
345 nmdc:mga0rr50_257115_c1 3300050513 Bacteria 1452
346 nmdc:mga0rr50_34745_c1 3300050513 Bacteria 3613
347 nmdc:mga0rr50_7308_c1 3300050513 Bacteria 6798
348 nmdc:mga08x19_148542_c1 3300050514 Bacteria 1586
349 nmdc:mga0a205_56911_c1 3300050515 Bacteria 3775
350 nmdc:mga0a205_65426_c1 3300050515 Bacteria 3512
351 nmdc:mga0a205_98911_c1 3300050515 Bacteria 2815
352 Ga0495601_0069071 3300053077 Bacteria 2253
353 Ga0495601_0120387 3300053077 Bacteria 1704
354 Ga0495612_0096817 3300053078 Bacteria 1254
355 Ga0495619_0041501 3300053085 Bacteria 3010
356 Ga0495619_0167867 3300053085 Bacteria 1517
357 Ga0501084_0002898 3300054114 Bacteria 13881
358 Ga0501084_0212362 3300054114 Bacteria 1633
359 Ga0501084_0222744 3300054114 Bacteria 1592
360 Ga0501084_0417882 3300054114 Bacteria 1134
361 Ga0590077_008953 3300059426 Unclassified 2050
362 Ga0501082_0005532 3300060353 Bacteria 10968
363 Ga0501082_0006133 3300060353 Bacteria 10434
364 Ga0501082_0200453 3300060353 Unclassified 1736
365 Ga0530510_0000115 3300061734 Bacteria 45273

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049585 Ga0501069_0427147 Ga0501069_0427147_69_773 203
2 3300054114 Ga0501084_0222744 Ga0501084_0222744_471_1175 203
3 3300006846 Ga0075430_100018223 Ga0075430_1000182236 207
4 3300050509 nmdc:mga0qj67_13543_c1 nmdc:mga0qj67_13543_c1_1414_2160 207
5 3300005330 Ga0070690_100056158 Ga0070690_1000561582 208
6 3300005547 Ga0070693_100079956 Ga0070693_1000799561 208
7 3300006358 Ga0068871_100019879 Ga0068871_1000198792 208
8 3300005536 Ga0070697_100090532 Ga0070697_1000905323 214
9 3300006914 Ga0075436_100000939 Ga0075436_1000009398 214
10 3300032005 Ga0307411_10383368 Ga0307411_103833682 215
11 3300005546 Ga0070696_100058001 Ga0070696_1000580012 217
12 3300025918 Ga0207662_10075693 Ga0207662_100756932 217
13 3300025944 Ga0207661_10065454 Ga0207661_100654543 217
14 3300035691 Ga0373931_0005277 Ga0373931_0005277_3494_4255 217
15 3300047319 Ga0495674_0405660 Ga0495674_0405660_108_863 217
16 3300006871 Ga0075434_100000002 Ga0075434_10000000257 218
17 3300006914 Ga0075436_100232778 Ga0075436_1002327782 218
18 3300007076 Ga0075435_100021533 Ga0075435_1000215332 218
19 3300046537 Ga0495598_0027164 Ga0495598_0027164_47_715 218
20 3300050512 nmdc:mga0n895_738_c1 nmdc:mga0n895_738_c1_16045_16749 218
21 3300050513 nmdc:mga0rr50_7308_c1 nmdc:mga0rr50_7308_c1_3975_4679 218
22 3300050514 nmdc:mga08x19_148542_c1 nmdc:mga08x19_148542_c1_443_1147 218
23 3300050515 nmdc:mga0a205_65426_c1 nmdc:mga0a205_65426_c1_631_1335 218
24 3300059426 Ga0590077_008953 Ga0590077_008953_78_851 219
25 3300035171 Ga0373946_0012329 Ga0373946_0012329_1631_2341 220
26 3300035692 Ga0373935_0080060 Ga0373935_0080060_94_804 220
27 3300035695 Ga0373927_0063881 Ga0373927_0063881_429_1139 220
28 3300036401 Ga0373937_0174774 Ga0373937_0174774_819_1529 220
29 3300037068 Ga0373925_0021284 Ga0373925_0021284_1167_1877 220
30 3300049593 Ga0501077_0217464 Ga0501077_0217464_518_1204 220
31 3300005549 Ga0070704_100407380 Ga0070704_1004073802 222
32 3300006844 Ga0075428_100083984 Ga0075428_1000839842 224
33 3300006847 Ga0075431_100026728 Ga0075431_1000267287 224
34 3300006847 Ga0075431_100051127 Ga0075431_1000511272 224
35 3300009094 Ga0111539_10553555 Ga0111539_105535552 224
36 3300035172 Ga0373955_0007680 Ga0373955_0007680_2381_3136 224
37 3300035410 Ga0373924_0008352 Ga0373924_0008352_2529_3284 224
38 3300035724 Ga0373933_0001013 Ga0373933_0001013_4926_5681 224
39 3300036401 Ga0373937_0011742 Ga0373937_0011742_1076_1831 224
40 3300036401 Ga0373937_0018426 Ga0373937_0018426_218_922 224
41 3300046454 Ga0495592_0031573 Ga0495592_0031573_1055_1759 224
42 3300046511 Ga0495608_0030379 Ga0495608_0030379_843_1547 224
43 3300046514 Ga0495618_0017009 Ga0495618_0017009_3454_4158 224
44 3300046516 Ga0495628_0004277 Ga0495628_0004277_1499_2203 224
45 3300046517 Ga0495630_0010914 Ga0495630_0010914_2005_2709 224
46 3300046526 Ga0495666_0004404 Ga0495666_0004404_2862_3566 224
47 3300046529 Ga0495652_0042663 Ga0495652_0042663_1119_1823 224
48 3300046535 Ga0495586_0006032 Ga0495586_0006032_3639_4343 224
49 3300046536 Ga0495587_0012604 Ga0495587_0012604_4577_5281 224
50 3300046559 Ga0495667_0083007 Ga0495667_0083007_744_1499 224
51 3300046642 Ga0495634_0011436 Ga0495634_0011436_2113_2817 224
52 3300046663 Ga0495635_0097748 Ga0495635_0097748_448_1152 224
53 3300046678 Ga0495599_0026712 Ga0495599_0026712_2481_3185 224
54 3300046683 Ga0495658_0006613 Ga0495658_0006613_1146_1850 224
55 3300046689 Ga0495613_0002300 Ga0495613_0002300_4744_5448 224
56 3300046690 Ga0495624_0209057 Ga0495624_0209057_465_1169 224
57 3300046809 Ga0495600_0012090 Ga0495600_0012090_3283_3987 224
58 3300047317 Ga0495604_0001661 Ga0495604_0001661_17012_17716 224
59 3300047322 Ga0495680_0005343 Ga0495680_0005343_8784_9488 224
60 3300047471 Ga0495684_0377383 Ga0495684_0377383_56_760 224
61 3300049577 Ga0501041_0052399 Ga0501041_0052399_373_1137 224
62 3300049582 Ga0501048_0091308 Ga0501048_0091308_286_1050 224
63 3300049590 Ga0501074_0310926 Ga0501074_0310926_261_983 224
64 3300049591 Ga0501075_0098447 Ga0501075_0098447_406_1170 224
65 3300049593 Ga0501077_0164236 Ga0501077_0164236_451_1215 224
66 3300049824 Ga0501045_0046239 Ga0501045_0046239_1530_2294 224
67 3300050510 nmdc:mga06r32_211989_c1 nmdc:mga06r32_211989_c1_912_1619 224
68 3300050510 nmdc:mga06r32_266981_c1 nmdc:mga06r32_266981_c1_812_1531 224
69 3300050511 nmdc:mga08y16_417247_c1 nmdc:mga08y16_417247_c1_422_1141 224
70 3300050513 nmdc:mga0rr50_257115_c1 nmdc:mga0rr50_257115_c1_670_1389 224
71 3300053077 Ga0495601_0120387 Ga0495601_0120387_802_1506 224
72 3300053085 Ga0495619_0167867 Ga0495619_0167867_803_1507 224
73 3300006852 Ga0075433_10138425 Ga0075433_101384253 225
74 3300007076 Ga0075435_100033315 Ga0075435_1000333153 225
75 3300007265 Ga0099794_10278426 Ga0099794_102784262 225
76 3300050515 nmdc:mga0a205_98911_c1 nmdc:mga0a205_98911_c1_169_897 225
77 3300005536 Ga0070697_100393498 Ga0070697_1003934982 226
78 3300025929 Ga0207664_10158168 Ga0207664_101581683 226
79 3300025939 Ga0207665_10070508 Ga0207665_100705082 226
80 3300032002 Ga0307416_100115166 Ga0307416_1001151663 227
81 3300005444 Ga0070694_100084162 Ga0070694_1000841622 228
82 3300005458 Ga0070681_10615741 Ga0070681_106157411 228
83 3300005518 Ga0070699_100282077 Ga0070699_1002820772 228
84 3300005545 Ga0070695_100359793 Ga0070695_1003597931 228
85 3300005546 Ga0070696_100247437 Ga0070696_1002474372 228
86 3300005549 Ga0070704_100128799 Ga0070704_1001287992 228
87 3300025912 Ga0207707_10455708 Ga0207707_104557081 228
88 3300045051 Ga0451576_0043218 Ga0451576_0043218_2469_3212 228
89 3300005549 Ga0070704_100258675 Ga0070704_1002586751 229
90 3300005844 Ga0068862_100087190 Ga0068862_1000871901 229
91 3300009094 Ga0111539_10050332 Ga0111539_100503324 229
92 3300009553 Ga0105249_10021252 Ga0105249_100212523 229
93 3300050511 nmdc:mga08y16_86766_c1 nmdc:mga08y16_86766_c1_1982_2734 229
94 3300025906 Ga0207699_10183491 Ga0207699_101834912 230
95 3300049573 Ga0501037_0027004 Ga0501037_0027004_589_1314 230
96 3300049575 Ga0501039_0007329 Ga0501039_0007329_3866_4591 230
97 3300049576 Ga0501040_0045402 Ga0501040_0045402_1239_1964 230
98 3300049577 Ga0501041_0006847 Ga0501041_0006847_5320_6045 230
99 3300049578 Ga0501042_0236834 Ga0501042_0236834_376_1101 230
100 3300049579 Ga0501043_0155564 Ga0501043_0155564_370_1095 230
101 3300049584 Ga0501068_0208431 Ga0501068_0208431_249_974 230
102 3300049592 Ga0501076_0003919 Ga0501076_0003919_3725_4450 230
103 3300049741 Ga0501079_0005720 Ga0501079_0005720_939_1664 230
104 3300049742 Ga0501080_0011696 Ga0501080_0011696_332_1057 230
105 3300049824 Ga0501045_0021006 Ga0501045_0021006_2226_2951 230
106 3300060353 Ga0501082_0005532 Ga0501082_0005532_3331_4056 230
107 3300049579 Ga0501043_0368210 Ga0501043_0368210_100_852 231
108 3300049580 Ga0501046_0159029 Ga0501046_0159029_216_968 231
109 3300049588 Ga0501072_0126537 Ga0501072_0126537_1259_2011 231
110 3300049592 Ga0501076_0029682 Ga0501076_0029682_2199_2951 231
111 3300049683 Ga0501253_045575 Ga0501253_045575_93_824 231
112 3300049741 Ga0501079_0147079 Ga0501079_0147079_227_979 231
113 3300049743 Ga0501081_0006480 Ga0501081_0006480_4218_4970 231
114 3300049744 Ga0501083_0199321 Ga0501083_0199321_243_995 231
115 3300060353 Ga0501082_0200453 Ga0501082_0200453_432_1184 231
116 3300007265 Ga0099794_10045775 Ga0099794_100457752 233
117 3300046472 Ga0495580_0196059 Ga0495580_0196059_456_1196 233
118 3300049569 Ga0501032_0025016 Ga0501032_0025016_733_1503 234
119 3300049571 Ga0501034_0142077 Ga0501034_0142077_1153_1923 234
120 3300014969 Ga0157376_10459166 Ga0157376_104591661 236
121 3300032004 Ga0307414_10567508 Ga0307414_105675082 236
122 3300049569 Ga0501032_0038092 Ga0501032_0038092_1353_2123 236
123 3300049570 Ga0501033_0004982 Ga0501033_0004982_4218_4988 236
124 3300049571 Ga0501034_0134601 Ga0501034_0134601_956_1726 236
125 3300049572 Ga0501036_0005335 Ga0501036_0005335_4097_4867 236
126 3300049573 Ga0501037_0008974 Ga0501037_0008974_2278_3048 236
127 3300049574 Ga0501038_0000189 Ga0501038_0000189_2643_3413 236
128 3300049575 Ga0501039_0002605 Ga0501039_0002605_2335_3105 236
129 3300049576 Ga0501040_0000641 Ga0501040_0000641_797_1567 236
130 3300049577 Ga0501041_0000419 Ga0501041_0000419_15348_16118 236
131 3300049580 Ga0501046_0000156 Ga0501046_0000156_64551_65321 236
132 3300049581 Ga0501047_0452683 Ga0501047_0452683_225_995 236
133 3300049582 Ga0501048_0006934 Ga0501048_0006934_5583_6353 236
134 3300049584 Ga0501068_0010284 Ga0501068_0010284_2383_3153 236
135 3300049586 Ga0501070_0065987 Ga0501070_0065987_1670_2440 236
136 3300049587 Ga0501071_0007763 Ga0501071_0007763_1110_1880 236
137 3300049588 Ga0501072_0001123 Ga0501072_0001123_15348_16118 236
138 3300049588 Ga0501072_0253255 Ga0501072_0253255_425_1186 236
139 3300049590 Ga0501074_0056206 Ga0501074_0056206_196_966 236
140 3300049591 Ga0501075_0000053 Ga0501075_0000053_5066_5836 236
141 3300049592 Ga0501076_0000699 Ga0501076_0000699_6769_7539 236
142 3300049593 Ga0501077_0000543 Ga0501077_0000543_21975_22745 236
143 3300049741 Ga0501079_0000351 Ga0501079_0000351_7981_8751 236
144 3300049743 Ga0501081_0000440 Ga0501081_0000440_21110_21880 236
145 3300049822 Ga0501035_0008001 Ga0501035_0008001_5179_5949 236
146 3300049823 Ga0501044_0090019 Ga0501044_0090019_724_1494 236
147 3300049824 Ga0501045_0001147 Ga0501045_0001147_10366_11136 236
148 3300054114 Ga0501084_0002898 Ga0501084_0002898_8013_8783 236
149 3300060353 Ga0501082_0006133 Ga0501082_0006133_3060_3830 236
150 3300061734 Ga0530510_0000115 Ga0530510_0000115_5664_6434 236
151 3300005354 Ga0070675_100086276 Ga0070675_1000862762 237
152 3300013308 Ga0157375_10272513 Ga0157375_102725132 237
153 3300035117 Ga0373953_0011942 Ga0373953_0011942_1633_2409 237
154 3300035118 Ga0373954_0000082 Ga0373954_0000082_1792_2568 237
155 3300035172 Ga0373955_0117787 Ga0373955_0117787_308_1021 237
156 3300036401 Ga0373937_0000696 Ga0373937_0000696_5304_6080 237
157 3300036401 Ga0373937_0028530 Ga0373937_0028530_292_1005 237
158 3300037471 Ga0395905_0209697 Ga0395905_0209697_28_783 237
159 3300046459 Ga0495629_0025371 Ga0495629_0025371_603_1316 237
160 3300046536 Ga0495587_0333287 Ga0495587_0333287_31_744 237
161 3300046681 Ga0495647_0078355 Ga0495647_0078355_375_1088 237
162 3300047322 Ga0495680_0299846 Ga0495680_0299846_272_985 237
163 3300047471 Ga0495684_0105898 Ga0495684_0105898_157_870 237
164 3300053077 Ga0495601_0069071 Ga0495601_0069071_997_1710 237
165 3300053078 Ga0495612_0096817 Ga0495612_0096817_233_946 237
166 3300053085 Ga0495619_0041501 Ga0495619_0041501_192_905 237
167 3300006852 Ga0075433_10034452 Ga0075433_100344523 238
168 3300007076 Ga0075435_100141667 Ga0075435_1001416672 238
169 3300050513 nmdc:mga0rr50_34745_c1 nmdc:mga0rr50_34745_c1_98_847 238
170 3300050515 nmdc:mga0a205_56911_c1 nmdc:mga0a205_56911_c1_2328_3077 238
171 3300005543 Ga0070672_100064459 Ga0070672_1000644593 239
172 3300013306 Ga0163162_10308515 Ga0163162_103085152 239
173 3300014969 Ga0157376_10028031 Ga0157376_100280312 239
174 3300005356 Ga0070674_100078216 Ga0070674_1000782162 240
175 3300035083 Ga0373926_0007570 Ga0373926_0007570_1877_2677 240
176 3300035171 Ga0373946_0036009 Ga0373946_0036009_388_1188 240
177 3300035725 Ga0373947_0108734 Ga0373947_0108734_77_877 240
178 3300037068 Ga0373925_0112746 Ga0373925_0112746_1235_2035 240
179 3300046455 Ga0495603_0007405 Ga0495603_0007405_2265_3065 240
180 3300046472 Ga0495580_0008226 Ga0495580_0008226_7433_8233 240
181 3300046499 Ga0495594_0055156 Ga0495594_0055156_46_846 240
182 3300046535 Ga0495586_0003458 Ga0495586_0003458_7432_8232 240
183 3300046674 Ga0495588_0001118 Ga0495588_0001118_8410_9210 240
184 3300046681 Ga0495647_0000296 Ga0495647_0000296_8862_9662 240
185 3300046683 Ga0495658_0003865 Ga0495658_0003865_4502_5302 240
186 3300047315 Ga0495581_0094314 Ga0495581_0094314_762_1562 240
187 3300047321 Ga0495676_0121086 Ga0495676_0121086_720_1520 240
188 3300035089 Ga0373944_0013313 Ga0373944_0013313_762_1562 241
189 3300035170 Ga0373943_0017396 Ga0373943_0017396_881_1681 241
190 3300035410 Ga0373924_0042535 Ga0373924_0042535_598_1398 241
191 3300035692 Ga0373935_0013373 Ga0373935_0013373_3459_4259 241
192 3300005364 Ga0070673_100831441 Ga0070673_1008314411 242
193 3300025937 Ga0207669_10396798 Ga0207669_103967981 242
194 3300042439 Ga0439464_0000635 Ga0439464_0000635_5488_6249 242
195 3300005331 Ga0070670_100079715 Ga0070670_1000797153 243
196 3300005333 Ga0070677_10005859 Ga0070677_100058592 243
197 3300005354 Ga0070675_100070358 Ga0070675_1000703582 243
198 3300005355 Ga0070671_100177326 Ga0070671_1001773262 243
199 3300005364 Ga0070673_100042189 Ga0070673_1000421894 243
200 3300005367 Ga0070667_100194044 Ga0070667_1001940441 243
201 3300005457 Ga0070662_100038273 Ga0070662_1000382734 243
202 3300005564 Ga0070664_100177346 Ga0070664_1001773461 243
203 3300025933 Ga0207706_10033949 Ga0207706_100339492 243
204 3300025940 Ga0207691_10082127 Ga0207691_100821272 243
205 3300025945 Ga0207679_10183559 Ga0207679_101835591 243
206 3300049588 Ga0501072_0067345 Ga0501072_0067345_2033_2809 243
207 3300054114 Ga0501084_0212362 Ga0501084_0212362_579_1355 243
208 3300005530 Ga0070679_100007832 Ga0070679_1000078327 244
209 3300005840 Ga0068870_10100408 Ga0068870_101004082 244
210 3300014326 Ga0157380_10094056 Ga0157380_100940562 244
211 3300025921 Ga0207652_10109894 Ga0207652_101098942 244
212 3300025940 Ga0207691_10129024 Ga0207691_101290243 244
213 3300026089 Ga0207648_10170640 Ga0207648_101706402 244
214 3300026089 Ga0207648_10452263 Ga0207648_104522632 244
215 3300054114 Ga0501084_0417882 Ga0501084_0417882_134_925 244
216 3300025893 Ga0207682_10180236 Ga0207682_101802361 245
217 3300049824 Ga0501045_0447670 Ga0501045_0447670_143_922 245
218 3300005330 Ga0070690_100001783 Ga0070690_1000017838 246
219 3300005334 Ga0068869_100002060 Ga0068869_1000020608 246
220 3300005336 Ga0070680_100003307 Ga0070680_1000033076 246
221 3300005337 Ga0070682_100058635 Ga0070682_1000586353 246
222 3300005338 Ga0068868_100003770 Ga0068868_1000037708 246
223 3300005340 Ga0070689_100001092 Ga0070689_10000109212 246
224 3300005341 Ga0070691_10002036 Ga0070691_100020369 246
225 3300005343 Ga0070687_100000798 Ga0070687_1000007986 246
226 3300005354 Ga0070675_100621222 Ga0070675_1006212221 246
227 3300005355 Ga0070671_100299601 Ga0070671_1002996012 246
228 3300005364 Ga0070673_100445484 Ga0070673_1004454841 246
229 3300005438 Ga0070701_10000854 Ga0070701_100008548 246
230 3300005440 Ga0070705_100000473 Ga0070705_1000004736 246
231 3300005441 Ga0070700_100008675 Ga0070700_1000086757 246
232 3300005444 Ga0070694_100001201 Ga0070694_1000012011 246
233 3300005458 Ga0070681_10040259 Ga0070681_100402592 246
234 3300005459 Ga0068867_100006649 Ga0068867_1000066499 246
235 3300005530 Ga0070679_100028416 Ga0070679_1000284163 246
236 3300005536 Ga0070697_100347716 Ga0070697_1003477162 246
237 3300005544 Ga0070686_100002127 Ga0070686_1000021278 246
238 3300005545 Ga0070695_100000891 Ga0070695_1000008918 246
239 3300005546 Ga0070696_100000008 Ga0070696_1000000088 246
240 3300005547 Ga0070693_100000008 Ga0070693_10000000869 246
241 3300005549 Ga0070704_100002526 Ga0070704_1000025265 246
242 3300005563 Ga0068855_100070235 Ga0068855_1000702355 246
243 3300005578 Ga0068854_100003486 Ga0068854_1000034866 246
244 3300005614 Ga0068856_100007752 Ga0068856_1000077526 246
245 3300005615 Ga0070702_100000062 Ga0070702_10000006226 246
246 3300005617 Ga0068859_100003274 Ga0068859_10000327412 246
247 3300005719 Ga0068861_100002708 Ga0068861_1000027088 246
248 3300005842 Ga0068858_100003684 Ga0068858_1000036845 246
249 3300005843 Ga0068860_100011051 Ga0068860_1000110515 246
250 3300005844 Ga0068862_100008658 Ga0068862_1000086588 246
251 3300006237 Ga0097621_100012215 Ga0097621_1000122152 246
252 3300006358 Ga0068871_100000682 Ga0068871_1000006828 246
253 3300006844 Ga0075428_100000615 Ga0075428_10000061512 246
254 3300006880 Ga0075429_100000150 Ga0075429_10000015012 246
255 3300006881 Ga0068865_100001702 Ga0068865_1000017028 246
256 3300006931 Ga0097620_100003274 Ga0097620_10000327412 246
257 3300009094 Ga0111539_10099119 Ga0111539_100991192 246
258 3300009098 Ga0105245_10000776 Ga0105245_1000077622 246
259 3300009147 Ga0114129_10000534 Ga0114129_1000053447 246
260 3300009148 Ga0105243_10006740 Ga0105243_100067408 246
261 3300009176 Ga0105242_10013766 Ga0105242_100137662 246
262 3300009177 Ga0105248_10198731 Ga0105248_101987313 246
263 3300009553 Ga0105249_10011784 Ga0105249_100117846 246
264 3300013297 Ga0157378_10005811 Ga0157378_100058118 246
265 3300014969 Ga0157376_10006552 Ga0157376_100065523 246
266 3300025899 Ga0207642_10001205 Ga0207642_100012055 246
267 3300025904 Ga0207647_10069742 Ga0207647_100697423 246
268 3300025907 Ga0207645_10104126 Ga0207645_101041262 246
269 3300025912 Ga0207707_10044178 Ga0207707_100441783 246
270 3300025921 Ga0207652_10014237 Ga0207652_100142375 246
271 3300025926 Ga0207659_10130032 Ga0207659_101300322 246
272 3300025927 Ga0207687_10004203 Ga0207687_100042032 246
273 3300025931 Ga0207644_10441708 Ga0207644_104417081 246
274 3300025934 Ga0207686_10001994 Ga0207686_100019945 246
275 3300025935 Ga0207709_10036830 Ga0207709_100368303 246
276 3300025936 Ga0207670_10002287 Ga0207670_100022876 246
277 3300025938 Ga0207704_10006990 Ga0207704_100069905 246
278 3300025942 Ga0207689_10001217 Ga0207689_100012177 246
279 3300025961 Ga0207712_10014988 Ga0207712_100149883 246
280 3300025981 Ga0207640_10007328 Ga0207640_100073286 246
281 3300026075 Ga0207708_10005256 Ga0207708_1000525610 246
282 3300026078 Ga0207702_10132146 Ga0207702_101321463 246
283 3300026089 Ga0207648_10000708 Ga0207648_1000070819 246
284 3300026118 Ga0207675_100001101 Ga0207675_10000110121 246
285 3300027907 Ga0207428_10036635 Ga0207428_100366352 246
286 3300028381 Ga0268264_10015270 Ga0268264_100152705 246
287 3300031852 Ga0307410_10450500 Ga0307410_104505001 246
288 3300034816 Ga0373930_0000956 Ga0373930_0000956_1241_2023 246
289 3300034817 Ga0373948_0006956 Ga0373948_0006956_132_914 246
290 3300035084 Ga0373928_0007436 Ga0373928_0007436_90_872 246
291 3300035090 Ga0373949_0005142 Ga0373949_0005142_1896_2678 246
292 3300035091 Ga0373951_0000936 Ga0373951_0000936_4726_5508 246
293 3300035092 Ga0373952_0028633 Ga0373952_0028633_378_1160 246
294 3300035121 Ga0373960_0015419 Ga0373960_0015419_308_1090 246
295 3300035207 Ga0373942_0002904 Ga0373942_0002904_990_1772 246
296 3300035241 Ga0373961_0006014 Ga0373961_0006014_1061_1843 246
297 3300035691 Ga0373931_0000123 Ga0373931_0000123_14491_15273 246
298 3300035691 Ga0373931_0049370 Ga0373931_0049370_277_1059 246
299 3300045051 Ga0451576_0026616 Ga0451576_0026616_4939_5721 246
300 3300045051 Ga0451576_0102487 Ga0451576_0102487_1650_2432 246
301 3300050507 nmdc:mga05p37_453_c1 nmdc:mga05p37_453_c1_5924_6706 246
302 3300050508 nmdc:mga09592_1204_c1 nmdc:mga09592_1204_c1_9232_10014 246
303 3300050511 nmdc:mga08y16_1936_c1 nmdc:mga08y16_1936_c1_19615_20397 246
304 3300005546 Ga0070696_100019639 Ga0070696_1000196392 247
305 3300006846 Ga0075430_100052930 Ga0075430_1000529303 247
306 3300006847 Ga0075431_100002681 Ga0075431_10000268118 247
307 3300026142 Ga0207698_10460482 Ga0207698_104604822 247
308 3300050510 nmdc:mga06r32_169489_c1 nmdc:mga06r32_169489_c1_1280_2065 247
309 3300006195 Ga0075366_10071349 Ga0075366_100713493 248
310 3300050493 nmdc:mga0k408_17273_c1 nmdc:mga0k408_17273_c1_1071_1850 248
311 3300005356 Ga0070674_100028993 Ga0070674_1000289932 250
312 3300005367 Ga0070667_100214474 Ga0070667_1002144742 250
313 3300005834 Ga0068851_10176893 Ga0068851_101768932 250
314 3300005841 Ga0068863_100410965 Ga0068863_1004109652 250
315 3300013308 Ga0157375_10197034 Ga0157375_101970342 250
316 3300025893 Ga0207682_10125093 Ga0207682_101250931 250
317 3300025925 Ga0207650_10017853 Ga0207650_100178534 250
318 3300025940 Ga0207691_10006240 Ga0207691_1000624011 250
319 3300025986 Ga0207658_10305246 Ga0207658_103052462 250
320 3300005328 Ga0070676_10195404 Ga0070676_101954041 251
321 3300005353 Ga0070669_100494532 Ga0070669_1004945321 251
322 3300005354 Ga0070675_100023299 Ga0070675_1000232993 251
323 3300005364 Ga0070673_100411826 Ga0070673_1004118262 251
324 3300005543 Ga0070672_100085115 Ga0070672_1000851152 251
325 3300005543 Ga0070672_100471291 Ga0070672_1004712911 251
326 3300005544 Ga0070686_100286939 Ga0070686_1002869392 251
327 3300005548 Ga0070665_100340047 Ga0070665_1003400473 251
328 3300009098 Ga0105245_10582165 Ga0105245_105821652 251
329 3300009177 Ga0105248_10450125 Ga0105248_104501252 251
330 3300025893 Ga0207682_10006030 Ga0207682_100060304 251
331 3300025907 Ga0207645_10103860 Ga0207645_101038602 251
332 3300025907 Ga0207645_10182951 Ga0207645_101829512 251
333 3300025923 Ga0207681_10169307 Ga0207681_101693072 251
334 3300025925 Ga0207650_10001506 Ga0207650_100015062 251
335 3300025925 Ga0207650_10273632 Ga0207650_102736322 251
336 3300025926 Ga0207659_10048393 Ga0207659_100483933 251
337 3300025935 Ga0207709_10263352 Ga0207709_102633522 251
338 3300025937 Ga0207669_10224559 Ga0207669_102245592 251
339 3300025940 Ga0207691_10019378 Ga0207691_100193782 251
340 3300025940 Ga0207691_10051428 Ga0207691_100514284 251
341 3300025940 Ga0207691_10279209 Ga0207691_102792092 251
342 3300025940 Ga0207691_10280804 Ga0207691_102808042 251
343 3300025941 Ga0207711_10281430 Ga0207711_102814302 251
344 3300025960 Ga0207651_10039546 Ga0207651_100395463 251
345 3300025986 Ga0207658_10134648 Ga0207658_101346482 251
346 3300026067 Ga0207678_10258654 Ga0207678_102586542 251
347 3300026067 Ga0207678_10702254 Ga0207678_107022542 251
348 3300026089 Ga0207648_10023879 Ga0207648_100238794 251
349 3300026121 Ga0207683_10049701 Ga0207683_100497013 251
350 3300031548 Ga0307408_100042598 Ga0307408_1000425984 251
351 3300031731 Ga0307405_10006111 Ga0307405_100061114 251
352 3300031731 Ga0307405_10023640 Ga0307405_100236401 251
353 3300031852 Ga0307410_10004097 Ga0307410_100040976 251
354 3300031901 Ga0307406_10015511 Ga0307406_100155112 251
355 3300031903 Ga0307407_10035172 Ga0307407_100351723 251
356 3300031911 Ga0307412_10009226 Ga0307412_100092265 251
357 3300031911 Ga0307412_10052138 Ga0307412_100521383 251
358 3300031995 Ga0307409_100001262 Ga0307409_1000012627 251
359 3300031995 Ga0307409_100004368 Ga0307409_1000043685 251
360 3300032002 Ga0307416_100003871 Ga0307416_1000038711 251
361 3300032004 Ga0307414_10056633 Ga0307414_100566332 251
362 3300032005 Ga0307411_10016963 Ga0307411_100169635 251
363 3300032005 Ga0307411_10034428 Ga0307411_100344284 251
364 3300032126 Ga0307415_100001682 Ga0307415_1000016828 251
365 3300050508 nmdc:mga09592_297336_c1 nmdc:mga09592_297336_c1_56_865 251

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12570

DUF3750

Protein of unknown function (DUF3750)

48

179

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4g29-assembly1.cif.gz_A structure of the catalytic domain of the salmonella virulence factor ssei 0.5386 41 92
6r99-assembly1.cif.gz_A crystal structure of human cln protein 5 (ceroid lipofuscinosis neuronal protein 5) 0.4775 23 126
7qng-assembly1.cif.gz_C structure of a mhc i-tapasin-erp57 complex 0.4734 38 95
8to0-assembly1.cif.gz_E1 48-nm repeating structure of doublets from mouse sperm flagella 0.4551 27 120
4g2b-assembly1.cif.gz_B structure of the catalytic domain of the salmonella virulence factor ssei 0.44 38 92
ID Description Score Start End Superfamily
af_Q9VH94_6_100_2.30.29.170 Mainly Beta;Roll;PH-domain like; 0.6345 35 74 2.30.29.170
2ofjD01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.5415 39 73 3.30.390.10
4g29A00 Alpha Beta;Roll;Secreted effector protein ssei fold;Secreted effector protein ssei. 0.5225 41 92 3.10.670.10
af_A4I1J2_267_409_2.30.29.170 Mainly Beta;Roll;PH-domain like; 0.509 36 124 2.30.29.170
af_I1KEN6_13_74_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.4658 42 95 2.30.30.140
ID Description Score Start End GO Terms
AF-A0A537CLQ0-F1-model_v4 DUF3750 domain-containing protein 0.9647 27 223
AF-A0A3N5PC53-F1-model_v4 DUF3750 domain-containing protein 0.9511 64 228
AF-A0A2H0QIL2-F1-model_v4 DUF3750 domain-containing protein 0.9387 27 230
AF-A0A4Q5W4V6-F1-model_v4 deleted 0.9374 42 232
AF-A0A7Z9PQU1-F1-model_v4 DUF3750 domain-containing protein 0.9344 24 229

Feature Viewer

pLDDT pTM Quality
74.22 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map