F423664

General Info

Members Datasets Scaffolds Average Seq Length
365 177 364 262

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10037505|Ga0105238_100375052
Length 320
Sequence VHDRPRADKGVDDRAAQRARAPGNDHLASFHHDAQDGATISALELAMSLRLXPEIPLYQVDAFTNHPFGGNPAAVCPLGAWLPAPLMQKIAAENNLSETAFFVPDAEGFALRWFTPTTEVDLCGHATLASAFVLMTELTPERKRVVFSTRSGPLVVERDGDKLTMDFPARPPTKLSTPFPVLAAALGKTPSAVWTARSLVAVFDDAETVRGLRPDFSKISALDTYGVIATAPGTGADADVDCVSRFFAPRQGVPEDPVTGSAHCTLTPYWAARLGRTRLRARQVSARGGEIDCELNGDRVSLSGNAVLLIRGTLRLPADA

Samples

Sample ID Description Type Environment
1 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
95 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
96 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
97 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
98 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
99 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
100 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
101 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
102 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
103 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
104 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
105 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
106 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
107 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
108 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
109 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
110 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
111 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
112 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
118 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
119 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
120 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
121 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
122 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
123 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
126 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
127 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
132 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
135 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
136 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
137 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
140 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
141 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
148 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
149 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
150 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
151 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
152 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
153 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
154 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
155 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
156 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
166 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
167 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
169 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
173 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
174 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
175 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
176 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
177 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.45
Metatranscriptomes 0.27
Isolates 0.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.82
Nodule 0.27
Rhizoplane 0.55
Rhizosphere 97.81
Stem 0
Stem Tuber 0
Unclassified 0.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1001113 3300001904 Bacteria 4914
2 JGI24741J21665_1019110 3300001915 Bacteria 1089
3 JGI24737J22298_10033998 3300001990 Bacteria 1582
4 Ga0070658_10000431 3300005327 Bacteria 36455
5 Ga0070658_10006937 3300005327 Bacteria 9149
6 Ga0070658_10037689 3300005327 Bacteria 3898
7 Ga0070658_10038869 3300005327 Bacteria 3838
8 Ga0070658_10046318 3300005327 Bacteria 3520
9 Ga0070658_10123956 3300005327 Bacteria 2149
10 Ga0070658_10191571 3300005327 Bacteria 1723
11 Ga0070658_10220912 3300005327 Bacteria 1602
12 Ga0070658_10383654 3300005327 Bacteria 1206
13 Ga0070658_10474989 3300005327 Bacteria 1079
14 Ga0070676_10228836 3300005328 Bacteria 1231
15 Ga0070683_100002329 3300005329 Bacteria 15071
16 Ga0070683_100003064 3300005329 Bacteria 13449
17 Ga0070683_100031687 3300005329 Bacteria 4811
18 Ga0068869_100382982 3300005334 Unclassified 1153
19 Ga0070680_100004013 3300005336 Bacteria 11011
20 Ga0070680_100006559 3300005336 Bacteria 8852
21 Ga0070680_100074071 3300005336 Bacteria 2801
22 Ga0070680_100136362 3300005336 Bacteria 2056
23 Ga0070680_100244277 3300005336 Bacteria 1518
24 Ga0070682_100004007 3300005337 Bacteria 8187
25 Ga0068868_100201881 3300005338 Bacteria 1658
26 Ga0070660_100000053 3300005339 Bacteria 67349
27 Ga0070660_100087238 3300005339 Bacteria 2456
28 Ga0070660_100132745 3300005339 Bacteria 1994
29 Ga0070687_100003040 3300005343 Bacteria 6454
30 Ga0070661_100028152 3300005344 Bacteria 4052
31 Ga0070692_10283418 3300005345 Bacteria 1005
32 Ga0070668_100376301 3300005347 Bacteria 1208
33 Ga0070674_100118042 3300005356 Bacteria 1960
34 Ga0070673_100018754 3300005364 Bacteria 4954
35 Ga0070659_100269819 3300005366 Bacteria 1413
36 Ga0070659_100353633 3300005366 Bacteria 1233
37 Ga0070667_100012164 3300005367 Bacteria 7122
38 Ga0070714_100008475 3300005435 Bacteria 8032
39 Ga0070705_100047191 3300005440 Bacteria 2488
40 Ga0070700_100206004 3300005441 Bacteria 1385
41 Ga0070694_100057911 3300005444 Bacteria 2635
42 Ga0070708_100058129 3300005445 Bacteria 3445
43 Ga0070663_100008434 3300005455 Bacteria 6340
44 Ga0070663_100023600 3300005455 Bacteria 4125
45 Ga0070663_100028929 3300005455 Bacteria 3779
46 Ga0070663_100104500 3300005455 Bacteria 2119
47 Ga0070681_10075373 3300005458 Bacteria 3334
48 Ga0070681_10330001 3300005458 Bacteria 1435
49 Ga0070699_100161885 3300005518 Bacteria 1981
50 Ga0070679_100001057 3300005530 Bacteria 24020
51 Ga0070679_100034414 3300005530 Bacteria 5020
52 Ga0070679_100037097 3300005530 Bacteria 4840
53 Ga0070679_100062345 3300005530 Bacteria 3717
54 Ga0070679_100223702 3300005530 Bacteria 1842
55 Ga0070679_100415730 3300005530 Bacteria 1290
56 Ga0070679_100457520 3300005530 Bacteria 1221
57 Ga0070684_100052851 3300005535 Bacteria 3534
58 Ga0068853_100003926 3300005539 Bacteria 11414
59 Ga0068853_100034537 3300005539 Bacteria 4293
60 Ga0068853_100347686 3300005539 Bacteria 1379
61 Ga0070686_100083779 3300005544 Bacteria 2117
62 Ga0070704_100272421 3300005549 Bacteria 1399
63 Ga0068855_100000433 3300005563 Bacteria 51890
64 Ga0068855_100013172 3300005563 Bacteria 9974
65 Ga0068855_100127607 3300005563 Bacteria 2907
66 Ga0068855_100148977 3300005563 Bacteria 2661
67 Ga0068855_100186702 3300005563 Bacteria 2341
68 Ga0068857_100079294 3300005577 Bacteria 2931
69 Ga0068857_100297501 3300005577 Bacteria 1487
70 Ga0068854_100007774 3300005578 Bacteria 6857
71 Ga0068854_100032007 3300005578 Bacteria 3657
72 Ga0068856_100014558 3300005614 Bacteria 7599
73 Ga0068856_100418750 3300005614 Bacteria 1360
74 Ga0068856_100462908 3300005614 Bacteria 1289
75 Ga0068856_100533751 3300005614 Bacteria 1194
76 Ga0068856_100576040 3300005614 Bacteria 1147
77 Ga0068852_100003515 3300005616 Bacteria 10961
78 Ga0068852_100011580 3300005616 Bacteria 6651
79 Ga0068852_100026037 3300005616 Bacteria 4748
80 Ga0068852_100034580 3300005616 Bacteria 4206
81 Ga0068852_100167778 3300005616 Bacteria 2055
82 Ga0068859_100095550 3300005617 Bacteria 3024
83 Ga0068861_100496907 3300005719 Unclassified 1102
84 Ga0068863_100207262 3300005841 Bacteria 1887
85 Ga0068863_100268534 3300005841 Bacteria 1651
86 Ga0075365_10375063 3300006038 Bacteria 1003
87 Ga0068871_100192088 3300006358 Bacteria 1759
88 Ga0075428_100204779 3300006844 Bacteria 2132
89 Ga0075431_100017838 3300006847 Bacteria 7217
90 Ga0097620_100095543 3300006931 Bacteria 3024
91 Ga0105240_10000717 3300009093 Bacteria 60700
92 Ga0105240_10017309 3300009093 Bacteria 9717
93 Ga0105240_10027323 3300009093 Bacteria 7472
94 Ga0105240_10117509 3300009093 Bacteria 3206
95 Ga0111539_10038808 3300009094 Bacteria 5744
96 Ga0111539_10050866 3300009094 Bacteria 4936
97 Ga0111539_10133500 3300009094 Bacteria 2906
98 Ga0105247_10315142 3300009101 Unclassified 1090
99 Ga0114129_10075063 3300009147 Bacteria 4708
100 Ga0105237_10000235 3300009545 Bacteria 79122
101 Ga0105238_10037505 3300009551 Bacteria 4926
102 Ga0105238_10095105 3300009551 Bacteria 2967
103 Ga0105238_10837955 3300009551 Bacteria 936
104 Ga0105239_10059512 3300010375 Bacteria 4193
105 Ga0157373_10008257 3300013100 Bacteria 7740
106 Ga0157373_10129529 3300013100 Bacteria 1774
107 Ga0157373_10176667 3300013100 Bacteria 1503
108 Ga0157373_10416773 3300013100 Bacteria 964
109 Ga0157371_10000468 3300013102 Bacteria 49508
110 Ga0157371_10055770 3300013102 Bacteria 2804
111 Ga0157371_10083052 3300013102 Bacteria 2268
112 Ga0157371_10425222 3300013102 Unclassified 974
113 Ga0157370_10067039 3300013104 Bacteria 3393
114 Ga0157370_10087646 3300013104 Bacteria 2924
115 Ga0157370_10146384 3300013104 Bacteria 2200
116 Ga0157370_10207792 3300013104 Bacteria 1815
117 Ga0157370_10388648 3300013104 Bacteria 1285
118 Ga0157370_10632720 3300013104 Bacteria 978
119 Ga0157370_10644175 3300013104 Bacteria 969
120 Ga0157369_10007345 3300013105 Bacteria 12686
121 Ga0157369_10013212 3300013105 Bacteria 9345
122 Ga0157369_10022126 3300013105 Bacteria 7103
123 Ga0157369_10113105 3300013105 Bacteria 2884
124 Ga0157369_10140820 3300013105 Bacteria 2552
125 Ga0157369_10165759 3300013105 Bacteria 2330
126 Ga0157369_10445248 3300013105 Bacteria 1341
127 Ga0157369_10793550 3300013105 Bacteria 973
128 Ga0157372_10129387 3300013307 Bacteria 2904
129 Ga0157372_10167977 3300013307 Bacteria 2537
130 Ga0157372_10209488 3300013307 Bacteria 2259
131 Ga0157375_10017010 3300013308 Bacteria 6550
132 Ga0163163_10009276 3300014325 Bacteria 8778
133 Ga0157379_10159902 3300014968 Bacteria 2033
134 Ga0206353_10141028 3300020082 Bacteria 1247
135 Ga0213875_10004183 3300021388 Bacteria 7982
136 Ga0207647_10036029 3300025904 Bacteria 3147
137 Ga0207647_10054301 3300025904 Bacteria 2465
138 Ga0207647_10202349 3300025904 Bacteria 1148
139 Ga0207705_10000526 3300025909 Bacteria 32452
140 Ga0207705_10001929 3300025909 Bacteria 16208
141 Ga0207705_10002377 3300025909 Bacteria 14544
142 Ga0207705_10046708 3300025909 Bacteria 3112
143 Ga0207705_10079600 3300025909 Bacteria 2386
144 Ga0207705_10094885 3300025909 Bacteria 2188
145 Ga0207705_10114132 3300025909 Bacteria 1998
146 Ga0207705_10143350 3300025909 Bacteria 1785
147 Ga0207707_10191524 3300025912 Bacteria 1784
148 Ga0207707_10206513 3300025912 Bacteria 1712
149 Ga0207707_10328523 3300025912 Bacteria 1319
150 Ga0207695_10015302 3300025913 Bacteria 9039
151 Ga0207695_10016026 3300025913 Bacteria 8795
152 Ga0207695_10028165 3300025913 Bacteria 6238
153 Ga0207695_10079317 3300025913 Bacteria 3328
154 Ga0207671_10001281 3300025914 Bacteria 29556
155 Ga0207660_10001621 3300025917 Bacteria 15097
156 Ga0207660_10010517 3300025917 Bacteria 6010
157 Ga0207660_10110843 3300025917 Bacteria 2065
158 Ga0207660_10247185 3300025917 Bacteria 1407
159 Ga0207660_10491203 3300025917 Bacteria 995
160 Ga0207662_10110031 3300025918 Bacteria 1717
161 Ga0207657_10000058 3300025919 Bacteria 103811
162 Ga0207657_10000088 3300025919 Bacteria 88065
163 Ga0207657_10076240 3300025919 Bacteria 2829
164 Ga0207657_10140313 3300025919 Bacteria 1975
165 Ga0207649_10010803 3300025920 Bacteria 5020
166 Ga0207652_10000162 3300025921 Bacteria 72698
167 Ga0207652_10005175 3300025921 Bacteria 10589
168 Ga0207652_10047529 3300025921 Bacteria 3666
169 Ga0207652_10110964 3300025921 Bacteria 2432
170 Ga0207652_10218177 3300025921 Bacteria 1718
171 Ga0207652_10256242 3300025921 Bacteria 1578
172 Ga0207652_10283112 3300025921 Bacteria 1496
173 Ga0207652_10294313 3300025921 Bacteria 1465
174 Ga0207659_10162951 3300025926 Bacteria 1752
175 Ga0207664_10069597 3300025929 Bacteria 2830
176 Ga0207690_10214320 3300025932 Bacteria 1470
177 Ga0207690_10250622 3300025932 Bacteria 1368
178 Ga0207669_10099508 3300025937 Bacteria 1918
179 Ga0207691_10058717 3300025940 Bacteria 3499
180 Ga0207661_10044225 3300025944 Bacteria 3519
181 Ga0207661_10437312 3300025944 Bacteria 1190
182 Ga0207661_10628298 3300025944 Bacteria 987
183 Ga0207667_10000114 3300025949 Bacteria 128923
184 Ga0207667_10028908 3300025949 Bacteria 6017
185 Ga0207667_10063117 3300025949 Bacteria 3871
186 Ga0207667_10121008 3300025949 Bacteria 2697
187 Ga0207667_10190256 3300025949 Bacteria 2106
188 Ga0207667_10393186 3300025949 Bacteria 1412
189 Ga0207640_10004852 3300025981 Bacteria 7302
190 Ga0207640_10027664 3300025981 Bacteria 3458
191 Ga0207658_10166632 3300025986 Bacteria 1811
192 Ga0207677_10384421 3300026023 Bacteria 1186
193 Ga0207639_10003573 3300026041 Bacteria 10445
194 Ga0207639_10034072 3300026041 Bacteria 3761
195 Ga0207639_10140025 3300026041 Bacteria 2014
196 Ga0207678_10003213 3300026067 Bacteria 14771
197 Ga0207678_10011689 3300026067 Bacteria 7707
198 Ga0207678_10039611 3300026067 Bacteria 4089
199 Ga0207678_10666859 3300026067 Bacteria 914
200 Ga0207708_10285063 3300026075 Bacteria 1339
201 Ga0207702_10017757 3300026078 Bacteria 5889
202 Ga0207702_10447162 3300026078 Bacteria 1253
203 Ga0207641_10162099 3300026088 Bacteria 2034
204 Ga0207641_10173248 3300026088 Bacteria 1971
205 Ga0207674_10016312 3300026116 Bacteria 8136
206 Ga0207675_100756657 3300026118 Unclassified 983
207 Ga0207698_10000412 3300026142 Bacteria 24694
208 Ga0207698_10002621 3300026142 Bacteria 10691
209 Ga0207698_10017857 3300026142 Bacteria 4822
210 Ga0207698_10055708 3300026142 Bacteria 3049
211 Ga0207428_10085831 3300027907 Bacteria 2450
212 Ga0268266_10015757 3300028379 Bacteria 6474
213 Ga0265326_10014713 3300028558 Bacteria 2278
214 Ga0265318_10000014 3300028577 Bacteria 208921
215 Ga0265330_10000214 3300031235 Bacteria 44995
216 Ga0265332_10000244 3300031238 Bacteria 43234
217 Ga0265328_10004641 3300031239 Bacteria 5945
218 Ga0265320_10000036 3300031240 Bacteria 136231
219 Ga0265325_10002487 3300031241 Bacteria 12420
220 Ga0265325_10204572 3300031241 Bacteria 909
221 Ga0265329_10005076 3300031242 Bacteria 5371
222 Ga0265339_10018044 3300031249 Bacteria 4168
223 Ga0265339_10111885 3300031249 Bacteria 1412
224 Ga0265331_10000205 3300031250 Bacteria 71426
225 Ga0265331_10023531 3300031250 Bacteria 3129
226 Ga0265316_10003320 3300031344 Bacteria 16304
227 Ga0265316_10065004 3300031344 Bacteria 2825
228 Ga0265316_10181771 3300031344 Bacteria 1566
229 Ga0265316_10243418 3300031344 Bacteria 1322
230 Ga0265313_10000327 3300031595 Bacteria 51611
231 Ga0265314_10000296 3300031711 Bacteria 71336
232 Ga0265314_10105565 3300031711 Bacteria 1801
233 Ga0265342_10006564 3300031712 Bacteria 8651
234 Ga0265342_10066411 3300031712 Bacteria 2112
235 Ga0316576_10059553 3300031727 Bacteria 2796
236 Ga0316576_10101772 3300031727 Bacteria 2148
237 Ga0316577_10083221 3300031733 Bacteria 1790
238 Ga0307410_10031020 3300031852 Bacteria 3424
239 Ga0307406_10098585 3300031901 Bacteria 1985
240 Ga0307407_10344466 3300031903 Bacteria 1053
241 Ga0307409_100077354 3300031995 Bacteria 2672
242 Ga0307416_100241359 3300032002 Bacteria 1751
243 Ga0307411_10351727 3300032005 Bacteria 1201
244 Ga0307415_100019595 3300032126 Bacteria 4111
245 Ga0307415_100108604 3300032126 Bacteria 2053
246 Ga0373934_0122951 3300035086 Bacteria 1056
247 Ga0373954_0095408 3300035118 Bacteria 1432
248 Ga0373956_0022156 3300035119 Bacteria 2716
249 Ga0373943_0261172 3300035170 Bacteria 975
250 Ga0316574_0151066 3300035398 Bacteria 1496
251 Ga0373931_0215497 3300035691 Bacteria 1154
252 Ga0373933_0080914 3300035724 Bacteria 1992
253 Ga0373937_0008331 3300036401 Bacteria 8999
254 Ga0373937_0018810 3300036401 Bacteria 6175
255 Ga0373937_0039727 3300036401 Bacteria 4288
256 Ga0316582_0081290 3300036647 Bacteria 2116
257 Ga0316584_0058141 3300036712 Bacteria 2895
258 Ga0316584_0067262 3300036712 Bacteria 2686
259 Ga0395899_0017389 3300037312 Bacteria 5477
260 Ga0395899_0032111 3300037312 Bacteria 3944
261 Ga0395899_0033317 3300037312 Bacteria 3868
262 Ga0395899_0096660 3300037312 Bacteria 2135
263 Ga0395899_0156158 3300037312 Bacteria 1614
264 Ga0395899_0222057 3300037312 Bacteria 1308
265 Ga0395899_0259424 3300037312 Bacteria 1189
266 Ga0395899_0327569 3300037312 Bacteria 1030
267 Ga0395900_0000124 3300037418 Bacteria 133210
268 Ga0395900_0001090 3300037418 Bacteria 34516
269 Ga0395900_0006790 3300037418 Bacteria 11878
270 Ga0395900_0033053 3300037418 Bacteria 5324
271 Ga0395900_0033884 3300037418 Bacteria 5255
272 Ga0395900_0111480 3300037418 Bacteria 2810
273 Ga0395900_0129757 3300037418 Bacteria 2584
274 Ga0395900_0220349 3300037418 Bacteria 1912
275 Ga0395900_0330545 3300037418 Bacteria 1502
276 Ga0395900_0407680 3300037418 Bacteria 1322
277 Ga0395900_0712443 3300037418 Bacteria 936
278 Ga0395898_0003043 3300037466 Bacteria 18995
279 Ga0395898_0014234 3300037466 Bacteria 8177
280 Ga0395898_0042803 3300037466 Bacteria 4466
281 Ga0395898_0060620 3300037466 Bacteria 3677
282 Ga0395898_0068791 3300037466 Bacteria 3426
283 Ga0395898_0107525 3300037466 Bacteria 2675
284 Ga0395898_0402908 3300037466 Bacteria 1304
285 Ga0395905_0001328 3300037471 Bacteria 30188
286 Ga0395905_0071765 3300037471 Bacteria 3246
287 Ga0395905_0172795 3300037471 Bacteria 2029
288 Ga0395905_0234474 3300037471 Bacteria 1716
289 Ga0395905_0278207 3300037471 Bacteria 1559
290 Ga0395905_0280135 3300037471 Bacteria 1553
291 Ga0395905_0345510 3300037471 Bacteria 1379
292 Ga0395905_0595834 3300037471 Unclassified 1007
293 Ga0395905_0681249 3300037471 Bacteria 930
294 Ga0316581_0029103 3300037588 Bacteria 1658
295 Ga0436364_0293754 3300037853 Bacteria 44649
296 Ga0395901_0000031 3300038443 Bacteria 241733
297 Ga0395901_0000168 3300038443 Bacteria 85645
298 Ga0395901_0009746 3300038443 Bacteria 9739
299 Ga0395901_0016719 3300038443 Bacteria 7475
300 Ga0395901_0108331 3300038443 Bacteria 2916
301 Ga0395901_0176000 3300038443 Bacteria 2244
302 Ga0395901_0324629 3300038443 Bacteria 1592
303 Ga0395901_0394929 3300038443 Bacteria 1421
304 Ga0395901_0984030 3300038443 Bacteria 820
305 Ga0451577_0039450 3300042876 Bacteria 4244
306 Ga0451577_0139504 3300042876 Bacteria 2178
307 Ga0451577_0213069 3300042876 Bacteria 1745
308 Ga0466969_0055649 3300044656 Bacteria 1934
309 Ga0466966_0025929 3300044684 Bacteria 3829
310 Ga0466966_0027598 3300044684 Bacteria 3701
311 Ga0466961_0039858 3300044693 Bacteria 3011
312 Ga0466961_0048820 3300044693 Bacteria 2706
313 Ga0466961_0122549 3300044693 Bacteria 1631
314 Ga0466961_0237994 3300044693 Bacteria 1119
315 Ga0466963_0012851 3300044694 Bacteria 5130
316 Ga0466963_0171992 3300044694 Bacteria 1510
317 Ga0453684_0001907 3300044712 Bacteria 54115
318 Ga0466971_0224154 3300044719 Bacteria 891
319 Ga0466970_0028839 3300044765 Bacteria 2919
320 Ga0466957_0164939 3300044842 Bacteria 1440
321 Ga0466959_0060717 3300045049 Bacteria 2750
322 Ga0466959_0129162 3300045049 Bacteria 1791
323 Ga0466959_0408907 3300045049 Bacteria 922
324 Ga0451576_0000247 3300045051 Bacteria 132668
325 Ga0451576_0501447 3300045051 Bacteria 1275
326 Ga0466958_0057999 3300045836 Bacteria 2353
327 Ga0466958_0133709 3300045836 Bacteria 1559
328 Ga0466967_0014427 3300045976 Bacteria 6155
329 Ga0466967_0022442 3300045976 Bacteria 5150
330 Ga0466967_0047781 3300045976 Bacteria 3733
331 Ga0466967_0573975 3300045976 Bacteria 1111
332 Ga0466967_1138020 3300045976 Bacteria 778
333 Ga0495592_0052985 3300046454 Bacteria 3010
334 Ga0495653_0298834 3300046463 Bacteria 1051
335 Ga0495594_0085363 3300046499 Bacteria 1766
336 Ga0495618_0052188 3300046514 Bacteria 2584
337 Ga0495640_0128784 3300046533 Bacteria 1639
338 Ga0495587_0099802 3300046536 Bacteria 1673
339 Ga0495667_0016660 3300046559 Bacteria 4962
340 Ga0495667_0065313 3300046559 Bacteria 2380
341 Ga0495635_0085873 3300046663 Bacteria 2153
342 Ga0495600_0111955 3300046809 Bacteria 1777
343 Ga0495604_0037451 3300047317 Bacteria 3820
344 Ga0495680_0011655 3300047322 Bacteria 7767
345 Ga0496100_0233873 3300048903 Bacteria 1353
346 Ga0496114_0000249 3300048917 Bacteria 39187
347 Ga0501032_0030562 3300049569 Bacteria 3696
348 Ga0501033_0140143 3300049570 Bacteria 1748
349 Ga0501037_0218637 3300049573 Bacteria 1341
350 Ga0501039_0490650 3300049575 Bacteria 964
351 Ga0501043_0153639 3300049579 Bacteria 1800
352 Ga0501077_0088732 3300049593 Bacteria 1960
353 Ga0501079_0263095 3300049741 Bacteria 1348
354 Ga0501035_0068041 3300049822 Bacteria 3158
355 Ga0501044_0004929 3300049823 Bacteria 14924
356 nmdc:mga0yw44_358629_c1 3300050492 Bacteria 982
357 nmdc:mga05p37_199345_c1 3300050507 Bacteria 2425
358 nmdc:mga09592_144095_c1 3300050508 Bacteria 2054
359 nmdc:mga06r32_474973_c1 3300050510 Bacteria 1229
360 nmdc:mga08y16_42847_c1 3300050511 Bacteria 4741
361 Ga0495601_0005248 3300053077 Bacteria 7539
362 Ga0495595_0049639 3300053084 Bacteria 1941
363 Ga0495619_0008326 3300053085 Bacteria 6556
364 Ga0500566_0001132 3300053094 Bacteria 15471

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047317 Ga0495604_0037451 Ga0495604_0037451_618_1289 213
2 3300031235 Ga0265330_10000214 Ga0265330_1000021415 216
3 3300036712 Ga0316584_0058141 Ga0316584_0058141_1630_2325 217
4 3300025949 Ga0207667_10393186 Ga0207667_103931861 219
5 3300037466 Ga0395898_0014234 Ga0395898_0014234_11_685 224
6 3300013100 Ga0157373_10008257 Ga0157373_100082577 235
7 3300037418 Ga0395900_0712443 Ga0395900_0712443_175_882 235
8 3300037471 Ga0395905_0681249 Ga0395905_0681249_212_919 235
9 3300038443 Ga0395901_0984030 Ga0395901_0984030_91_801 235
10 3300044765 Ga0466970_0028839 Ga0466970_0028839_14_721 235
11 3300045976 Ga0466967_1138020 Ga0466967_1138020_17_724 235
12 3300021388 Ga0213875_10004183 Ga0213875_100041834 237
13 3300037853 Ga0436364_0293754 Ga0436364_0293754_41144_41941 237
14 3300005841 Ga0068863_100268534 Ga0068863_1002685342 239
15 3300005444 Ga0070694_100057911 Ga0070694_1000579112 244
16 3300005338 Ga0068868_100201881 Ga0068868_1002018812 246
17 3300005343 Ga0070687_100003040 Ga0070687_1000030402 246
18 3300025918 Ga0207662_10110031 Ga0207662_101100311 246
19 3300026023 Ga0207677_10384421 Ga0207677_103844211 246
20 3300026088 Ga0207641_10162099 Ga0207641_101620992 246
21 3300025986 Ga0207658_10166632 Ga0207658_101666322 248
22 3300036712 Ga0316584_0067262 Ga0316584_0067262_952_1815 248
23 3300045976 Ga0466967_0014427 Ga0466967_0014427_539_1321 248
24 iso_pu_bacteria 2842333319 2842337549 248
25 3300005334 Ga0068869_100382982 Ga0068869_1003829822 249
26 3300005445 Ga0070708_100058129 Ga0070708_1000581292 249
27 3300005518 Ga0070699_100161885 Ga0070699_1001618851 249
28 3300005617 Ga0068859_100095550 Ga0068859_1000955503 249
29 3300006931 Ga0097620_100095543 Ga0097620_1000955433 249
30 3300009147 Ga0114129_10075063 Ga0114129_100750635 249
31 3300014325 Ga0163163_10009276 Ga0163163_100092768 249
32 3300014968 Ga0157379_10159902 Ga0157379_101599023 249
33 3300050507 nmdc:mga05p37_199345_c1 nmdc:mga05p37_199345_c1_240_1040 249
34 3300005356 Ga0070674_100118042 Ga0070674_1001180422 250
35 3300005364 Ga0070673_100018754 Ga0070673_1000187542 250
36 3300005441 Ga0070700_100206004 Ga0070700_1002060042 250
37 3300005544 Ga0070686_100083779 Ga0070686_1000837793 250
38 3300005719 Ga0068861_100496907 Ga0068861_1004969071 250
39 3300005841 Ga0068863_100207262 Ga0068863_1002072622 250
40 3300006358 Ga0068871_100192088 Ga0068871_1001920882 250
41 3300009101 Ga0105247_10315142 Ga0105247_103151421 250
42 3300013308 Ga0157375_10017010 Ga0157375_100170107 250
43 3300025926 Ga0207659_10162951 Ga0207659_101629512 250
44 3300025937 Ga0207669_10099508 Ga0207669_100995083 250
45 3300025940 Ga0207691_10058717 Ga0207691_100587173 250
46 3300026075 Ga0207708_10285063 Ga0207708_102850632 250
47 3300026088 Ga0207641_10173248 Ga0207641_101732482 250
48 3300026118 Ga0207675_100756657 Ga0207675_1007566571 250
49 3300028379 Ga0268266_10015757 Ga0268266_100157575 250
50 3300031727 Ga0316576_10059553 Ga0316576_100595534 250
51 3300031727 Ga0316576_10101772 Ga0316576_101017722 250
52 3300035086 Ga0373934_0122951 Ga0373934_0122951_42_830 250
53 3300035118 Ga0373954_0095408 Ga0373954_0095408_186_971 250
54 3300035119 Ga0373956_0022156 Ga0373956_0022156_1590_2375 250
55 3300035170 Ga0373943_0261172 Ga0373943_0261172_10_795 250
56 3300035724 Ga0373933_0080914 Ga0373933_0080914_914_1696 250
57 3300036401 Ga0373937_0008331 Ga0373937_0008331_678_1460 250
58 3300036401 Ga0373937_0018810 Ga0373937_0018810_4312_5100 250
59 3300036401 Ga0373937_0039727 Ga0373937_0039727_1049_1834 250
60 3300042876 Ga0451577_0039450 Ga0451577_0039450_199_981 250
61 3300042876 Ga0451577_0213069 Ga0451577_0213069_792_1577 250
62 3300045051 Ga0451576_0000247 Ga0451576_0000247_40898_41680 250
63 3300046454 Ga0495592_0052985 Ga0495592_0052985_1055_1840 250
64 3300046463 Ga0495653_0298834 Ga0495653_0298834_66_851 250
65 3300046499 Ga0495594_0085363 Ga0495594_0085363_186_971 250
66 3300046514 Ga0495618_0052188 Ga0495618_0052188_1679_2464 250
67 3300046533 Ga0495640_0128784 Ga0495640_0128784_328_1113 250
68 3300046536 Ga0495587_0099802 Ga0495587_0099802_505_1287 250
69 3300046559 Ga0495667_0016660 Ga0495667_0016660_1093_1878 250
70 3300046559 Ga0495667_0065313 Ga0495667_0065313_22_804 250
71 3300046663 Ga0495635_0085873 Ga0495635_0085873_783_1568 250
72 3300046809 Ga0495600_0111955 Ga0495600_0111955_645_1427 250
73 3300047322 Ga0495680_0011655 Ga0495680_0011655_5181_5966 250
74 3300053077 Ga0495601_0005248 Ga0495601_0005248_1048_1833 250
75 3300053084 Ga0495595_0049639 Ga0495595_0049639_967_1749 250
76 3300053085 Ga0495619_0008326 Ga0495619_0008326_5146_5928 250
77 3300005327 Ga0070658_10038869 Ga0070658_100388693 251
78 3300005329 Ga0070683_100003064 Ga0070683_1000030644 251
79 3300005336 Ga0070680_100136362 Ga0070680_1001363621 251
80 3300005337 Ga0070682_100004007 Ga0070682_1000040073 251
81 3300005458 Ga0070681_10075373 Ga0070681_100753732 251
82 3300005530 Ga0070679_100001057 Ga0070679_10000105718 251
83 3300005530 Ga0070679_100415730 Ga0070679_1004157301 251
84 3300005535 Ga0070684_100052851 Ga0070684_1000528513 251
85 3300005539 Ga0068853_100003926 Ga0068853_1000039262 251
86 3300005549 Ga0070704_100272421 Ga0070704_1002724212 251
87 3300005563 Ga0068855_100127607 Ga0068855_1001276071 251
88 3300005563 Ga0068855_100186702 Ga0068855_1001867022 251
89 3300005614 Ga0068856_100576040 Ga0068856_1005760401 251
90 3300009093 Ga0105240_10000717 Ga0105240_1000071719 251
91 3300009094 Ga0111539_10038808 Ga0111539_100388082 251
92 3300009094 Ga0111539_10133500 Ga0111539_101335002 251
93 3300009545 Ga0105237_10000235 Ga0105237_1000023523 251
94 3300009551 Ga0105238_10037505 Ga0105238_100375052 251
95 3300010375 Ga0105239_10059512 Ga0105239_100595122 251
96 3300025912 Ga0207707_10191524 Ga0207707_101915242 251
97 3300025913 Ga0207695_10079317 Ga0207695_100793173 251
98 3300025914 Ga0207671_10001281 Ga0207671_1000128121 251
99 3300025917 Ga0207660_10110843 Ga0207660_101108433 251
100 3300025921 Ga0207652_10000162 Ga0207652_100001624 251
101 3300025921 Ga0207652_10005175 Ga0207652_100051755 251
102 3300025949 Ga0207667_10190256 Ga0207667_101902562 251
103 3300026041 Ga0207639_10003573 Ga0207639_100035736 251
104 3300027907 Ga0207428_10085831 Ga0207428_100858312 251
105 3300028558 Ga0265326_10014713 Ga0265326_100147132 251
106 3300028577 Ga0265318_10000014 Ga0265318_10000014138 251
107 3300031238 Ga0265332_10000244 Ga0265332_1000024414 251
108 3300031239 Ga0265328_10004641 Ga0265328_100046416 251
109 3300031240 Ga0265320_10000036 Ga0265320_1000003669 251
110 3300031241 Ga0265325_10204572 Ga0265325_102045721 251
111 3300031242 Ga0265329_10005076 Ga0265329_100050764 251
112 3300031249 Ga0265339_10111885 Ga0265339_101118851 251
113 3300031250 Ga0265331_10000205 Ga0265331_1000020548 251
114 3300031344 Ga0265316_10003320 Ga0265316_1000332013 251
115 3300031344 Ga0265316_10065004 Ga0265316_100650042 251
116 3300031595 Ga0265313_10000327 Ga0265313_1000032716 251
117 3300031711 Ga0265314_10000296 Ga0265314_1000029647 251
118 3300031712 Ga0265342_10006564 Ga0265342_100065648 251
119 3300031712 Ga0265342_10066411 Ga0265342_100664112 251
120 3300031733 Ga0316577_10083221 Ga0316577_100832212 251
121 3300032002 Ga0307416_100241359 Ga0307416_1002413592 251
122 3300035398 Ga0316574_0151066 Ga0316574_0151066_172_969 251
123 3300036647 Ga0316582_0081290 Ga0316582_0081290_1068_1865 251
124 3300037588 Ga0316581_0029103 Ga0316581_0029103_681_1478 251
125 3300044712 Ga0453684_0001907 Ga0453684_0001907_49140_49922 251
126 3300048903 Ga0496100_0233873 Ga0496100_0233873_282_1079 251
127 3300048917 Ga0496114_0000249 Ga0496114_0000249_28541_29338 251
128 3300049593 Ga0501077_0088732 Ga0501077_0088732_597_1394 251
129 3300049741 Ga0501079_0263095 Ga0501079_0263095_185_982 251
130 3300050508 nmdc:mga09592_144095_c1 nmdc:mga09592_144095_c1_222_1025 251
131 3300050511 nmdc:mga08y16_42847_c1 nmdc:mga08y16_42847_c1_770_1564 251
132 3300005440 Ga0070705_100047191 Ga0070705_1000471914 252
133 3300006038 Ga0075365_10375063 Ga0075365_103750632 252
134 3300009094 Ga0111539_10050866 Ga0111539_100508664 252
135 3300025921 Ga0207652_10294313 Ga0207652_102943132 252
136 3300031901 Ga0307406_10098585 Ga0307406_100985852 252
137 3300032126 Ga0307415_100108604 Ga0307415_1001086042 252
138 3300035691 Ga0373931_0215497 Ga0373931_0215497_278_1069 252
139 3300042876 Ga0451577_0139504 Ga0451577_0139504_782_1573 252
140 3300045051 Ga0451576_0501447 Ga0451576_0501447_328_1113 252
141 3300045836 Ga0466958_0133709 Ga0466958_0133709_117_917 252
142 3300050492 nmdc:mga0yw44_358629_c1 nmdc:mga0yw44_358629_c1_28_819 252
143 3300053094 Ga0500566_0001132 Ga0500566_0001132_8232_9023 252
144 3300049569 Ga0501032_0030562 Ga0501032_0030562_2042_2893 253
145 3300049570 Ga0501033_0140143 Ga0501033_0140143_195_1046 253
146 3300049573 Ga0501037_0218637 Ga0501037_0218637_326_1177 253
147 3300049575 Ga0501039_0490650 Ga0501039_0490650_10_861 253
148 3300049579 Ga0501043_0153639 Ga0501043_0153639_727_1578 253
149 3300049822 Ga0501035_0068041 Ga0501035_0068041_887_1738 253
150 3300049823 Ga0501044_0004929 Ga0501044_0004929_12625_13476 253
151 3300005530 Ga0070679_100034414 Ga0070679_1000344144 254
152 3300005614 Ga0068856_100462908 Ga0068856_1004629082 254
153 3300006844 Ga0075428_100204779 Ga0075428_1002047793 254
154 3300006847 Ga0075431_100017838 Ga0075431_1000178383 254
155 3300026078 Ga0207702_10447162 Ga0207702_104471622 254
156 3300050510 nmdc:mga06r32_474973_c1 nmdc:mga06r32_474973_c1_307_1146 254
157 3300005530 Ga0070679_100037097 Ga0070679_1000370973 255
158 3300031250 Ga0265331_10023531 Ga0265331_100235312 255
159 3300031344 Ga0265316_10181771 Ga0265316_101817712 255
160 3300031241 Ga0265325_10002487 Ga0265325_100024879 256
161 3300031249 Ga0265339_10018044 Ga0265339_100180444 256
162 3300031344 Ga0265316_10243418 Ga0265316_102434182 256
163 3300031711 Ga0265314_10105565 Ga0265314_101055652 256
164 3300001904 JGI24736J21556_1001113 JGI24736J21556_10011133 259
165 3300001915 JGI24741J21665_1019110 JGI24741J21665_10191102 259
166 3300001990 JGI24737J22298_10033998 JGI24737J22298_100339982 259
167 3300005327 Ga0070658_10000431 Ga0070658_1000043130 259
168 3300005327 Ga0070658_10006937 Ga0070658_1000693711 259
169 3300005327 Ga0070658_10037689 Ga0070658_100376895 259
170 3300005327 Ga0070658_10046318 Ga0070658_100463185 259
171 3300005327 Ga0070658_10123956 Ga0070658_101239561 259
172 3300005327 Ga0070658_10191571 Ga0070658_101915712 259
173 3300005327 Ga0070658_10220912 Ga0070658_102209122 259
174 3300005327 Ga0070658_10383654 Ga0070658_103836542 259
175 3300005327 Ga0070658_10474989 Ga0070658_104749891 259
176 3300005328 Ga0070676_10228836 Ga0070676_102288362 259
177 3300005329 Ga0070683_100002329 Ga0070683_10000232913 259
178 3300005329 Ga0070683_100031687 Ga0070683_1000316874 259
179 3300005336 Ga0070680_100004013 Ga0070680_1000040136 259
180 3300005336 Ga0070680_100006559 Ga0070680_1000065593 259
181 3300005336 Ga0070680_100074071 Ga0070680_1000740713 259
182 3300005336 Ga0070680_100244277 Ga0070680_1002442772 259
183 3300005339 Ga0070660_100000053 Ga0070660_10000005340 259
184 3300005339 Ga0070660_100087238 Ga0070660_1000872383 259
185 3300005339 Ga0070660_100132745 Ga0070660_1001327452 259
186 3300005344 Ga0070661_100028152 Ga0070661_1000281523 259
187 3300005345 Ga0070692_10283418 Ga0070692_102834182 259
188 3300005347 Ga0070668_100376301 Ga0070668_1003763012 259
189 3300005366 Ga0070659_100269819 Ga0070659_1002698192 259
190 3300005366 Ga0070659_100353633 Ga0070659_1003536331 259
191 3300005367 Ga0070667_100012164 Ga0070667_1000121644 259
192 3300005435 Ga0070714_100008475 Ga0070714_1000084756 259
193 3300005455 Ga0070663_100008434 Ga0070663_1000084342 259
194 3300005455 Ga0070663_100023600 Ga0070663_1000236002 259
195 3300005455 Ga0070663_100028929 Ga0070663_1000289293 259
196 3300005455 Ga0070663_100104500 Ga0070663_1001045001 259
197 3300005458 Ga0070681_10330001 Ga0070681_103300012 259
198 3300005530 Ga0070679_100062345 Ga0070679_1000623455 259
199 3300005530 Ga0070679_100223702 Ga0070679_1002237022 259
200 3300005530 Ga0070679_100457520 Ga0070679_1004575202 259
201 3300005539 Ga0068853_100034537 Ga0068853_1000345373 259
202 3300005539 Ga0068853_100347686 Ga0068853_1003476862 259
203 3300005563 Ga0068855_100000433 Ga0068855_1000004339 259
204 3300005563 Ga0068855_100013172 Ga0068855_1000131725 259
205 3300005563 Ga0068855_100148977 Ga0068855_1001489774 259
206 3300005577 Ga0068857_100079294 Ga0068857_1000792943 259
207 3300005577 Ga0068857_100297501 Ga0068857_1002975012 259
208 3300005578 Ga0068854_100007774 Ga0068854_1000077743 259
209 3300005578 Ga0068854_100032007 Ga0068854_1000320072 259
210 3300005614 Ga0068856_100014558 Ga0068856_1000145588 259
211 3300005614 Ga0068856_100418750 Ga0068856_1004187503 259
212 3300005614 Ga0068856_100533751 Ga0068856_1005337512 259
213 3300005616 Ga0068852_100003515 Ga0068852_1000035155 259
214 3300005616 Ga0068852_100011580 Ga0068852_10001158010 259
215 3300005616 Ga0068852_100026037 Ga0068852_1000260373 259
216 3300005616 Ga0068852_100034580 Ga0068852_1000345805 259
217 3300005616 Ga0068852_100167778 Ga0068852_1001677783 259
218 3300009093 Ga0105240_10017309 Ga0105240_100173094 259
219 3300009093 Ga0105240_10027323 Ga0105240_100273234 259
220 3300009093 Ga0105240_10117509 Ga0105240_101175093 259
221 3300009551 Ga0105238_10095105 Ga0105238_100951053 259
222 3300009551 Ga0105238_10837955 Ga0105238_108379552 259
223 3300013100 Ga0157373_10129529 Ga0157373_101295293 259
224 3300013100 Ga0157373_10176667 Ga0157373_101766672 259
225 3300013100 Ga0157373_10416773 Ga0157373_104167732 259
226 3300013102 Ga0157371_10000468 Ga0157371_1000046842 259
227 3300013102 Ga0157371_10055770 Ga0157371_100557703 259
228 3300013102 Ga0157371_10083052 Ga0157371_100830522 259
229 3300013102 Ga0157371_10425222 Ga0157371_104252222 259
230 3300013104 Ga0157370_10067039 Ga0157370_100670392 259
231 3300013104 Ga0157370_10087646 Ga0157370_100876462 259
232 3300013104 Ga0157370_10146384 Ga0157370_101463842 259
233 3300013104 Ga0157370_10207792 Ga0157370_102077922 259
234 3300013104 Ga0157370_10388648 Ga0157370_103886482 259
235 3300013104 Ga0157370_10632720 Ga0157370_106327202 259
236 3300013104 Ga0157370_10644175 Ga0157370_106441751 259
237 3300013105 Ga0157369_10007345 Ga0157369_100073458 259
238 3300013105 Ga0157369_10013212 Ga0157369_1001321210 259
239 3300013105 Ga0157369_10022126 Ga0157369_100221264 259
240 3300013105 Ga0157369_10113105 Ga0157369_101131053 259
241 3300013105 Ga0157369_10140820 Ga0157369_101408203 259
242 3300013105 Ga0157369_10165759 Ga0157369_101657593 259
243 3300013105 Ga0157369_10445248 Ga0157369_104452482 259
244 3300013105 Ga0157369_10793550 Ga0157369_107935501 259
245 3300013307 Ga0157372_10129387 Ga0157372_101293873 259
246 3300013307 Ga0157372_10167977 Ga0157372_101679773 259
247 3300013307 Ga0157372_10209488 Ga0157372_102094882 259
248 3300020082 Ga0206353_10141028 Ga0206353_101410282 259
249 3300025904 Ga0207647_10036029 Ga0207647_100360293 259
250 3300025904 Ga0207647_10054301 Ga0207647_100543012 259
251 3300025904 Ga0207647_10202349 Ga0207647_102023492 259
252 3300025909 Ga0207705_10000526 Ga0207705_100005264 259
253 3300025909 Ga0207705_10001929 Ga0207705_1000192914 259
254 3300025909 Ga0207705_10002377 Ga0207705_1000237714 259
255 3300025909 Ga0207705_10046708 Ga0207705_100467082 259
256 3300025909 Ga0207705_10079600 Ga0207705_100796003 259
257 3300025909 Ga0207705_10094885 Ga0207705_100948853 259
258 3300025909 Ga0207705_10114132 Ga0207705_101141322 259
259 3300025909 Ga0207705_10143350 Ga0207705_101433502 259
260 3300025912 Ga0207707_10206513 Ga0207707_102065132 259
261 3300025912 Ga0207707_10328523 Ga0207707_103285232 259
262 3300025913 Ga0207695_10015302 Ga0207695_100153025 259
263 3300025913 Ga0207695_10016026 Ga0207695_100160269 259
264 3300025913 Ga0207695_10028165 Ga0207695_100281652 259
265 3300025917 Ga0207660_10001621 Ga0207660_1000162113 259
266 3300025917 Ga0207660_10010517 Ga0207660_100105173 259
267 3300025917 Ga0207660_10247185 Ga0207660_102471852 259
268 3300025917 Ga0207660_10491203 Ga0207660_104912031 259
269 3300025919 Ga0207657_10000058 Ga0207657_1000005830 259
270 3300025919 Ga0207657_10000088 Ga0207657_1000008830 259
271 3300025919 Ga0207657_10076240 Ga0207657_100762403 259
272 3300025919 Ga0207657_10140313 Ga0207657_101403132 259
273 3300025920 Ga0207649_10010803 Ga0207649_100108037 259
274 3300025921 Ga0207652_10047529 Ga0207652_100475295 259
275 3300025921 Ga0207652_10110964 Ga0207652_101109642 259
276 3300025921 Ga0207652_10218177 Ga0207652_102181772 259
277 3300025921 Ga0207652_10256242 Ga0207652_102562423 259
278 3300025921 Ga0207652_10283112 Ga0207652_102831123 259
279 3300025929 Ga0207664_10069597 Ga0207664_100695974 259
280 3300025932 Ga0207690_10214320 Ga0207690_102143201 259
281 3300025932 Ga0207690_10250622 Ga0207690_102506222 259
282 3300025944 Ga0207661_10044225 Ga0207661_100442254 259
283 3300025944 Ga0207661_10437312 Ga0207661_104373122 259
284 3300025944 Ga0207661_10628298 Ga0207661_106282982 259
285 3300025949 Ga0207667_10000114 Ga0207667_1000011425 259
286 3300025949 Ga0207667_10028908 Ga0207667_100289088 259
287 3300025949 Ga0207667_10063117 Ga0207667_100631173 259
288 3300025949 Ga0207667_10121008 Ga0207667_101210082 259
289 3300025981 Ga0207640_10004852 Ga0207640_100048524 259
290 3300025981 Ga0207640_10027664 Ga0207640_100276644 259
291 3300026041 Ga0207639_10034072 Ga0207639_100340723 259
292 3300026041 Ga0207639_10140025 Ga0207639_101400252 259
293 3300026067 Ga0207678_10003213 Ga0207678_1000321312 259
294 3300026067 Ga0207678_10011689 Ga0207678_1001168911 259
295 3300026067 Ga0207678_10039611 Ga0207678_100396112 259
296 3300026067 Ga0207678_10666859 Ga0207678_106668592 259
297 3300026078 Ga0207702_10017757 Ga0207702_100177572 259
298 3300026116 Ga0207674_10016312 Ga0207674_100163124 259
299 3300026142 Ga0207698_10000412 Ga0207698_1000041229 259
300 3300026142 Ga0207698_10002621 Ga0207698_1000262111 259
301 3300026142 Ga0207698_10017857 Ga0207698_100178573 259
302 3300026142 Ga0207698_10055708 Ga0207698_100557083 259
303 3300031852 Ga0307410_10031020 Ga0307410_100310204 259
304 3300031903 Ga0307407_10344466 Ga0307407_103444662 259
305 3300031995 Ga0307409_100077354 Ga0307409_1000773543 259
306 3300032005 Ga0307411_10351727 Ga0307411_103517272 259
307 3300032126 Ga0307415_100019595 Ga0307415_1000195952 259
308 3300037312 Ga0395899_0017389 Ga0395899_0017389_3100_3879 259
309 3300037312 Ga0395899_0032111 Ga0395899_0032111_1652_2431 259
310 3300037312 Ga0395899_0033317 Ga0395899_0033317_318_1097 259
311 3300037312 Ga0395899_0096660 Ga0395899_0096660_25_804 259
312 3300037312 Ga0395899_0156158 Ga0395899_0156158_679_1458 259
313 3300037312 Ga0395899_0222057 Ga0395899_0222057_151_930 259
314 3300037312 Ga0395899_0259424 Ga0395899_0259424_138_917 259
315 3300037312 Ga0395899_0327569 Ga0395899_0327569_145_924 259
316 3300037418 Ga0395900_0000124 Ga0395900_0000124_30046_30825 259
317 3300037418 Ga0395900_0001090 Ga0395900_0001090_29171_29950 259
318 3300037418 Ga0395900_0006790 Ga0395900_0006790_10882_11661 259
319 3300037418 Ga0395900_0033053 Ga0395900_0033053_1518_2297 259
320 3300037418 Ga0395900_0033884 Ga0395900_0033884_255_1034 259
321 3300037418 Ga0395900_0111480 Ga0395900_0111480_717_1496 259
322 3300037418 Ga0395900_0129757 Ga0395900_0129757_203_982 259
323 3300037418 Ga0395900_0220349 Ga0395900_0220349_976_1755 259
324 3300037418 Ga0395900_0330545 Ga0395900_0330545_421_1200 259
325 3300037418 Ga0395900_0407680 Ga0395900_0407680_271_1053 259
326 3300037466 Ga0395898_0003043 Ga0395898_0003043_521_1300 259
327 3300037466 Ga0395898_0042803 Ga0395898_0042803_3520_4299 259
328 3300037466 Ga0395898_0060620 Ga0395898_0060620_1260_2039 259
329 3300037466 Ga0395898_0068791 Ga0395898_0068791_728_1507 259
330 3300037466 Ga0395898_0107525 Ga0395898_0107525_1816_2595 259
331 3300037466 Ga0395898_0402908 Ga0395898_0402908_221_1000 259
332 3300037471 Ga0395905_0001328 Ga0395905_0001328_16467_17246 259
333 3300037471 Ga0395905_0071765 Ga0395905_0071765_1995_2777 259
334 3300037471 Ga0395905_0172795 Ga0395905_0172795_1036_1815 259
335 3300037471 Ga0395905_0234474 Ga0395905_0234474_911_1690 259
336 3300037471 Ga0395905_0278207 Ga0395905_0278207_218_997 259
337 3300037471 Ga0395905_0280135 Ga0395905_0280135_261_1040 259
338 3300037471 Ga0395905_0345510 Ga0395905_0345510_165_944 259
339 3300037471 Ga0395905_0595834 Ga0395905_0595834_98_877 259
340 3300038443 Ga0395901_0000031 Ga0395901_0000031_30489_31268 259
341 3300038443 Ga0395901_0000168 Ga0395901_0000168_19396_20175 259
342 3300038443 Ga0395901_0009746 Ga0395901_0009746_2574_3353 259
343 3300038443 Ga0395901_0016719 Ga0395901_0016719_121_900 259
344 3300038443 Ga0395901_0108331 Ga0395901_0108331_1920_2699 259
345 3300038443 Ga0395901_0176000 Ga0395901_0176000_134_913 259
346 3300038443 Ga0395901_0324629 Ga0395901_0324629_54_833 259
347 3300038443 Ga0395901_0394929 Ga0395901_0394929_485_1264 259
348 3300044656 Ga0466969_0055649 Ga0466969_0055649_173_952 259
349 3300044684 Ga0466966_0025929 Ga0466966_0025929_2202_2981 259
350 3300044684 Ga0466966_0027598 Ga0466966_0027598_1651_2430 259
351 3300044693 Ga0466961_0039858 Ga0466961_0039858_1006_1785 259
352 3300044693 Ga0466961_0048820 Ga0466961_0048820_571_1353 259
353 3300044693 Ga0466961_0122549 Ga0466961_0122549_275_1054 259
354 3300044693 Ga0466961_0237994 Ga0466961_0237994_66_845 259
355 3300044694 Ga0466963_0012851 Ga0466963_0012851_3470_4249 259
356 3300044694 Ga0466963_0171992 Ga0466963_0171992_148_927 259
357 3300044719 Ga0466971_0224154 Ga0466971_0224154_57_836 259
358 3300044842 Ga0466957_0164939 Ga0466957_0164939_225_1004 259
359 3300045049 Ga0466959_0060717 Ga0466959_0060717_979_1758 259
360 3300045049 Ga0466959_0129162 Ga0466959_0129162_275_1054 259
361 3300045049 Ga0466959_0408907 Ga0466959_0408907_111_890 259
362 3300045836 Ga0466958_0057999 Ga0466958_0057999_663_1442 259
363 3300045976 Ga0466967_0022442 Ga0466967_0022442_4273_5052 259
364 3300045976 Ga0466967_0047781 Ga0466967_0047781_1739_2518 259
365 3300045976 Ga0466967_0573975 Ga0466967_0573975_144_923 259

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02567

PhzC-PhzF

Phenazine biosynthesis-like protein

60

312

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7j-assembly2.cif.gz_B crystal structure of phenazine biosynthesis protein phzf family (enterococcus faecalis) 0.9319 2 259
1s7j-assembly2.cif.gz_B crystal structure of phenazine biosynthesis protein phzf family (enterococcus faecalis) 0.9249 2 259
4dun-assembly1.cif.gz_A-2 1.76a x-ray crystal structure of a putative phenazine biosynthesis phzc/phzf protein from clostridium difficile (strain 630) 0.906 4 259
5iwe-assembly1.cif.gz_A-2 e45q mutant of phenazine biosynthesis protein phzf in complex with (5r,6r)-6-azaniumyl-5-ethoxycyclohexa-1,3-diene-1-carboxylate 0.9 2 259
1xub-assembly1.cif.gz_A-2 structure and function of the phenazine biosynthetic protein phzf from pseudomonas fluorescens 0.8971 4 259
ID Description Score Start End Superfamily
af_K7LH11_163_288_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9467 141 253 3.10.310.10
af_A0A1P8ARL5_195_308_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9467 148 253 3.10.310.10
af_I1JFB7_3_158_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9459 6 104 3.10.310.10
af_A0A2R8Q0H1_3_123_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.943 6 115 3.10.310.10
af_Q8NIL3_2_111_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9422 2 104 3.10.310.10
ID Description Score Start End GO Terms
AF-A0A848SF56-F1-model_v4 deleted 0.9896 1 84
AF-A0A6J4SZT6-F1-model_v4 Phenazine biosynthesis protein PhzF like 0.9868 1 110 GO:0005737
GO:0009058
GO:0016853
AF-A0A7X3YAN9-F1-model_v4 PhzF family phenazine biosynthesis protein 0.9865 146 259 GO:0005737
GO:0009058
GO:0016853
AF-A0A1M4ERE3-F1-model_v4 Phenazine biosynthesis protein PhzF like 0.9849 151 259 GO:0005737
GO:0009058
GO:0016853
AF-A0A7X5W2D9-F1-model_v4 deleted 0.9798 148 247

Feature Viewer

pLDDT pTM Quality
94.67 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map