F423696

General Info

Members Datasets Scaffolds Average Seq Length
365 235 730 132

Family's Representative Sequence

Representative Sequence 3300025284|Ga0209130_1020776|Ga0209130_10207762
Length 161
Sequence MVLTTAFEQHIRSYPIKAEANEKLTRKDFTMTEKLLFTGKTHISGGRNGSARSSDGTIDIKLPQPHPAAENLFGIAWSACYIGAIELAASQRKITLPAGPEVDAEIDLNVDNGSFFLRARLNVSLPGIGRDVAQELIEAAHGICPYSKATHGNVDVETTLL

Samples

Sample ID Description Type Environment
1 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
56 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
63 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
64 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
65 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
75 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
99 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
100 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
101 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
102 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
103 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
104 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
105 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
106 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
107 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
108 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
109 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
110 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
111 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
112 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
113 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
114 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
117 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
118 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
119 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
120 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
121 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
122 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
123 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
124 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
125 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
126 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
127 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
128 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
129 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
130 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
131 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
132 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
133 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
134 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
135 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
136 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
137 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
138 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
139 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
140 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
141 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
144 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
145 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
146 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
147 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
148 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
149 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
150 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
151 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
152 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
153 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
154 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
155 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
156 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
157 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
158 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
159 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
160 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
161 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
162 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
163 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
164 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
165 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
166 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
167 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
168 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
169 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
170 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
171 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
172 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
173 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
178 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
179 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
180 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
183 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
184 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
185 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
186 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
187 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
188 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
189 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
192 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
195 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
196 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
197 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
198 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
199 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
200 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
201 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
202 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
203 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
204 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
205 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
206 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
207 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
208 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
209 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
210 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
211 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
212 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
213 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
214 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
215 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
216 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
217 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
218 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
219 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
220 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
221 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
222 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
223 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
224 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
225 2904699407
226 2906610324
227 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
228 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
229 2922425934
230 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
231 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
232 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
233 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
234 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
235 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.75
Metatranscriptomes 0
Isolates 5.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 36.71
Nodule 3.84
Rhizoplane 3.01
Rhizosphere 41.92
Stem 0
Stem Tuber 0
Unclassified 0.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209130_1020776 3300025284 Bacteria 1495
2 JGI24743J22301_10000468 3300001991 Bacteria 4658
3 JGI24033J26618_1000350 3300002155 Bacteria 4762
4 JGI25152J39213_1035718 3300002773 Bacteria 732
5 JGI25150J39212_1022853 3300002774 Bacteria 935
6 JGI25151J46595_10001028 3300003187 Bacteria 20920
7 JGI25153J46596_10006938 3300003215 Bacteria 5644
8 JGI25153J46596_10022843 3300003215 Bacteria 2295
9 JGI25153J46596_10062932 3300003215 Bacteria 997
10 rootH2_10019180 3300003320 Bacteria 13240
11 rootL2_10111317 3300003322 Bacteria 5830
12 rootL2_10114096 3300003322 Bacteria 3477
13 JGI25160J50197_1003325 3300003354 Bacteria 7233
14 JGI25161J50226_1002712 3300003374 Bacteria 4385
15 JGI25161J50226_1003474 3300003374 Bacteria 3590
16 Ga0055526_1010046 3300003771 Bacteria 4459
17 Ga0055537_1000893 3300003773 Bacteria 14128
18 Ga0055524_1012293 3300003775 Bacteria 3293
19 Ga0055524_1017526 3300003775 Bacteria 2524
20 Ga0055524_1018611 3300003775 Bacteria 2405
21 Ga0055524_1020386 3300003775 Bacteria 2234
22 Ga0055536_1002895 3300003781 Bacteria 9429
23 Ga0055536_1005127 3300003781 Bacteria 6478
24 Ga0055536_1037130 3300003781 Bacteria 1196
25 Ga0055528_1000269 3300003790 Bacteria 44061
26 Ga0055528_1002448 3300003790 Bacteria 9929
27 Ga0055528_1007602 3300003790 Bacteria 4768
28 Ga0055528_1019074 3300003790 Bacteria 2294
29 Ga0055530_10000116 3300003791 Bacteria 69428
30 Ga0055530_10022648 3300003791 Bacteria 1823
31 Ga0055540_1000192 3300003792 Bacteria 58828
32 Ga0055540_1006121 3300003792 Bacteria 4850
33 Ga0055531_10000451 3300003794 Bacteria 38162
34 Ga0055531_10005605 3300003794 Bacteria 7311
35 Ga0055543_1000329 3300004625 Bacteria 32613
36 Ga0065165_1003879 3300005262 Bacteria 9908
37 Ga0070676_10597938 3300005328 Unclassified 795
38 Ga0070680_100509291 3300005336 Bacteria 1030
39 Ga0070661_100000454 3300005344 Bacteria 31233
40 Ga0070661_100303036 3300005344 Bacteria 1244
41 Ga0070669_100665832 3300005353 Bacteria 877
42 Ga0070675_100969544 3300005354 Bacteria 780
43 Ga0070674_100031341 3300005356 Bacteria 3523
44 Ga0070674_100359895 3300005356 Bacteria 1178
45 Ga0070674_100398602 3300005356 Bacteria 1124
46 Ga0070659_100025104 3300005366 Bacteria 4575
47 Ga0070714_100038477 3300005435 Bacteria 4021
48 Ga0070713_100109870 3300005436 Bacteria 2402
49 Ga0070663_102125454 3300005455 Bacteria 506
50 Ga0070678_100137367 3300005456 Bacteria 1951
51 Ga0068861_100816347 3300005719 Bacteria 876
52 Ga0068860_100953387 3300005843 Bacteria 875
53 Ga0068862_100092209 3300005844 Bacteria 2640
54 Ga0068862_100142584 3300005844 Bacteria 2128
55 Ga0081538_10012989 3300005981 Bacteria 6626
56 Ga0081539_10326561 3300005985 Bacteria 651
57 Ga0070717_10071390 3300006028 Bacteria 2897
58 Ga0075365_10000975 3300006038 Bacteria 12193
59 Ga0075368_10025809 3300006042 Bacteria 2255
60 Ga0075368_10571150 3300006042 Bacteria 510
61 Ga0075363_100021670 3300006048 Bacteria 3241
62 Ga0075363_100154431 3300006048 Bacteria 1297
63 Ga0075362_10000395 3300006177 Bacteria 12551
64 Ga0075367_10017119 3300006178 Bacteria 3973
65 Ga0075367_10495433 3300006178 Bacteria 775
66 Ga0075367_10778943 3300006178 Bacteria 609
67 Ga0075369_10000652 3300006186 Bacteria 11053
68 Ga0075369_10281869 3300006186 Bacteria 774
69 Ga0075366_10013962 3300006195 Bacteria 4581
70 Ga0075366_10222492 3300006195 Bacteria 1150
71 Ga0075366_10379629 3300006195 Bacteria 869
72 Ga0075370_10047152 3300006353 Bacteria 2439
73 Ga0075370_10069924 3300006353 Bacteria 2007
74 Ga0068871_100311008 3300006358 Bacteria 1385
75 Ga0075428_101112712 3300006844 Bacteria 834
76 Ga0075430_100001497 3300006846 Bacteria 19065
77 Ga0111539_10026194 3300009094 Bacteria 7135
78 Ga0114129_10104432 3300009147 Bacteria 3916
79 Ga0105243_10792537 3300009148 Bacteria 933
80 Ga0105243_10808635 3300009148 Bacteria 925
81 Ga0105241_10052533 3300009174 Bacteria 3112
82 Ga0105249_10133498 3300009553 Bacteria 2373
83 Ga0105249_10163335 3300009553 Bacteria 2154
84 Ga0105249_10268705 3300009553 Bacteria 1698
85 Ga0123341_1000013 3300009765 Bacteria 97696
86 Ga0123342_1029184 3300009766 Bacteria 2889
87 Ga0105239_12375494 3300010375 Bacteria 617
88 Ga0157374_10089145 3300013296 Bacteria 2939
89 Ga0157378_10008937 3300013297 Bacteria 8721
90 Ga0163162_12814066 3300013306 Bacteria 560
91 Ga0157375_10176416 3300013308 Bacteria 2287
92 Ga0213875_10302654 3300021388 Bacteria 757
93 Ga0207425_1002767 3300025245 Bacteria 5958
94 Ga0209129_1002229 3300025258 Bacteria 9710
95 Ga0209565_1000118 3300025263 Bacteria 113196
96 Ga0209565_1036915 3300025263 Bacteria 927
97 Ga0209673_1000013 3300025273 Bacteria 571633
98 Ga0209673_1000325 3300025273 Bacteria 87535
99 Ga0209673_1001150 3300025273 Bacteria 28906
100 Ga0209673_1001202 3300025273 Bacteria 27769
101 Ga0209673_1005093 3300025273 Bacteria 6752
102 Ga0209675_1000258 3300025291 Bacteria 52281
103 Ga0209675_1002511 3300025291 Bacteria 9377
104 Ga0209676_1000146 3300025292 Bacteria 174095
105 Ga0209676_1000569 3300025292 Bacteria 55557
106 Ga0209676_1000688 3300025292 Bacteria 47633
107 Ga0209676_1017939 3300025292 Unclassified 2484
108 Ga0209025_1000483 3300025294 Bacteria 77146
109 Ga0209564_1000264 3300025295 Bacteria 111404
110 Ga0209564_1002390 3300025295 Bacteria 15002
111 Ga0209564_1010486 3300025295 Bacteria 4260
112 Ga0209564_1019055 3300025295 Bacteria 2582
113 Ga0209564_1022840 3300025295 Bacteria 2194
114 Ga0209758_1001861 3300025297 Bacteria 23130
115 Ga0209758_1002674 3300025297 Bacteria 17602
116 Ga0209758_1010928 3300025297 Bacteria 5346
117 Ga0209758_1016416 3300025297 Bacteria 3763
118 Ga0209758_1104949 3300025297 Bacteria 794
119 Ga0209758_1108179 3300025297 Bacteria 775
120 Ga0209758_1150366 3300025297 Bacteria 592
121 Ga0209050_1000218 3300025298 Bacteria 128776
122 Ga0209050_1001746 3300025298 Bacteria 21622
123 Ga0209050_1007871 3300025298 Bacteria 5848
124 Ga0209050_1007971 3300025298 Bacteria 5788
125 Ga0209050_1036408 3300025298 Bacteria 1436
126 Ga0209256_1000245 3300025299 Bacteria 96643
127 Ga0209256_1000369 3300025299 Bacteria 72557
128 Ga0209256_1000962 3300025299 Bacteria 34745
129 Ga0209256_1008817 3300025299 Bacteria 4574
130 Ga0207426_1000039 3300025302 Bacteria 439937
131 Ga0209051_1000253 3300025303 Bacteria 90622
132 Ga0209051_1010056 3300025303 Bacteria 4814
133 Ga0209257_1000248 3300025304 Bacteria 125170
134 Ga0209257_1000375 3300025304 Bacteria 89617
135 Ga0209257_1002797 3300025304 Bacteria 16431
136 Ga0209257_1102745 3300025304 Bacteria 694
137 Ga0207688_10062050 3300025901 Bacteria 2107
138 Ga0207647_10367389 3300025904 Bacteria 814
139 Ga0207699_10389226 3300025906 Bacteria 991
140 Ga0207645_10707957 3300025907 Bacteria 685
141 Ga0207654_10023759 3300025911 Bacteria 3288
142 Ga0207649_10005290 3300025920 Bacteria 6981
143 Ga0207681_10042993 3300025923 Bacteria 3022
144 Ga0207659_10819061 3300025926 Bacteria 800
145 Ga0207700_10035983 3300025928 Bacteria 3571
146 Ga0207664_10765284 3300025929 Bacteria 868
147 Ga0207690_10018391 3300025932 Bacteria 4286
148 Ga0207709_11047743 3300025935 Bacteria 668
149 Ga0207709_11131713 3300025935 Bacteria 643
150 Ga0207669_10299130 3300025937 Bacteria 1222
151 Ga0207665_10146168 3300025939 Bacteria 1689
152 Ga0207712_10101245 3300025961 Bacteria 2142
153 Ga0207712_11274546 3300025961 Bacteria 656
154 Ga0207712_12072747 3300025961 Bacteria 509
155 Ga0207648_10645962 3300026089 Bacteria 978
156 Ga0207675_100396586 3300026118 Bacteria 1359
157 Ga0207683_10054424 3300026121 Bacteria 3509
158 Ga0209813_10063528 3300027866 Bacteria 1184
159 Ga0209813_10345835 3300027866 Bacteria 588
160 Ga0207428_10102057 3300027907 Bacteria 2215
161 Ga0268264_10362343 3300028381 Bacteria 1383
162 Ga0307515_10069370 3300028794 Bacteria 4820
163 Ga0307515_10194059 3300028794 Bacteria 1930
164 Ga0307515_10342536 3300028794 Bacteria 1146
165 Ga0307515_10851357 3300028794 Bacteria 538
166 Ga0307512_10090151 3300030522 Bacteria 2141
167 Ga0265331_10147613 3300031250 Bacteria 1068
168 Ga0265327_10098909 3300031251 Bacteria 1411
169 Ga0265316_10987600 3300031344 Bacteria 586
170 Ga0307513_11028326 3300031456 Bacteria 534
171 Ga0307508_10088283 3300031616 Bacteria 2685
172 Ga0307516_10142346 3300031730 Bacteria 2166
173 Ga0307405_10213323 3300031731 Bacteria 1411
174 Ga0307413_10032270 3300031824 Bacteria 2967
175 Ga0307406_10126365 3300031901 Bacteria 1788
176 Ga0307407_10074359 3300031903 Bacteria 2033
177 Ga0307409_102757239 3300031995 Bacteria 519
178 Ga0307510_10147817 3300033180 Bacteria 1977
179 Ga0315911_1000006 3300033442 Bacteria 414563
180 Ga0316212_1036435 3300033547 Bacteria 693
181 Ga0436364_1269254 3300037853 Bacteria 1744
182 Ga0436365_0505464 3300039437 Bacteria 805
183 Ga0436365_1808909 3300039437 Bacteria 4123
184 Ga0436360_0035211 3300039438 Bacteria 694
185 Ga0439436_0026787 3300041404 Bacteria 1688
186 Ga0439436_0049460 3300041404 Bacteria 1191
187 Ga0439447_137147 3300041407 Bacteria 562
188 Ga0439453_0107503 3300041408 Bacteria 628
189 Ga0439466_0134549 3300041411 Bacteria 760
190 Ga0451787_595464 3300041441 Bacteria 3726
191 Ga0451789_0414206 3300041443 Bacteria 2172
192 Ga0451797_0695431 3300041453 Bacteria 1313
193 Ga0451795_1356076 3300041456 Bacteria 991
194 Ga0451804_1090665 3300041463 Bacteria 852
195 Ga0451807_0245592 3300041486 Bacteria 1071
196 Ga0451807_1764193 3300041486 Bacteria 698
197 Ga0451833_0058585 3300041491 Bacteria 8618
198 Ga0451833_0334281 3300041491 Bacteria 1006
199 Ga0451835_0540988 3300041492 Bacteria 921
200 Ga0451837_0383817 3300041494 Bacteria 1686
201 Ga0451837_0963211 3300041494 Bacteria 687
202 Ga0451839_0482178 3300041496 Bacteria 1316
203 Ga0451839_0624672 3300041496 Bacteria 2658
204 Ga0451841_0296417 3300041498 Bacteria 2116
205 Ga0451841_1101896 3300041498 Bacteria 671
206 Ga0451841_1232351 3300041498 Bacteria 1055
207 Ga0451845_0267647 3300041501 Bacteria 2887
208 Ga0451847_0246048 3300041503 Bacteria 2499
209 Ga0451847_0465822 3300041503 Bacteria 772
210 Ga0451849_0193008 3300041505 Bacteria 1139
211 Ga0451849_0978160 3300041505 Bacteria 1034
212 Ga0451849_1068945 3300041505 Bacteria 1149
213 Ga0451851_0413526 3300041507 Bacteria 3226
214 Ga0451851_0984963 3300041507 Bacteria 1261
215 Ga0451855_0080566 3300041511 Bacteria 2215
216 Ga0451855_0518671 3300041511 Bacteria 1529
217 Ga0451853_1859300 3300041512 Bacteria 3674
218 Ga0451853_4032906 3300041512 Bacteria 1791
219 Ga0439445_0137476 3300042004 Bacteria 707
220 Ga0439432_070005 3300042006 Bacteria 1071
221 Ga0439462_0022999 3300042015 Bacteria 1633
222 Ga0439462_0247166 3300042015 Bacteria 513
223 Ga0439459_0038195 3300042438 Bacteria 1009
224 Ga0466957_0007398 3300044842 Bacteria 6206
225 Ga0495638_0001206 3300046460 Bacteria 24684
226 Ga0495638_0195847 3300046460 Bacteria 1144
227 Ga0495650_0000069 3300046471 Bacteria 261124
228 Ga0495650_0057064 3300046471 Bacteria 1582
229 Ga0495650_0204159 3300046471 Bacteria 686
230 Ga0495605_0053058 3300046474 Bacteria 1968
231 Ga0495596_0020541 3300046500 Bacteria 2703
232 Ga0495607_0175114 3300046501 Bacteria 1080
233 Ga0495606_0004031 3300046507 Bacteria 14979
234 Ga0495606_0509184 3300046507 Bacteria 606
235 Ga0495610_0000378 3300046512 Bacteria 45991
236 Ga0495610_0008031 3300046512 Bacteria 6907
237 Ga0495610_0150093 3300046512 Bacteria 995
238 Ga0495610_0222002 3300046512 Bacteria 762
239 Ga0495616_0079199 3300046513 Bacteria 1575
240 Ga0495616_0119910 3300046513 Bacteria 1215
241 Ga0495620_0115754 3300046515 Bacteria 1060
242 Ga0495620_0328607 3300046515 Bacteria 580
243 Ga0495632_0173428 3300046519 Bacteria 990
244 Ga0495637_0016978 3300046520 Bacteria 3399
245 Ga0495637_0071010 3300046520 Bacteria 1405
246 Ga0495637_0074876 3300046520 Bacteria 1359
247 Ga0495643_0011820 3300046522 Bacteria 5295
248 Ga0495643_0014703 3300046522 Bacteria 4650
249 Ga0495643_0101151 3300046522 Bacteria 1477
250 Ga0495648_0003811 3300046524 Bacteria 13096
251 Ga0495648_0019793 3300046524 Bacteria 4716
252 Ga0495663_0041634 3300046525 Bacteria 1398
253 Ga0495654_0000285 3300046530 Bacteria 46016
254 Ga0495654_0040565 3300046530 Bacteria 2319
255 Ga0495654_0062851 3300046530 Bacteria 1779
256 Ga0495609_0033637 3300046538 Bacteria 2327
257 Ga0495609_0396858 3300046538 Bacteria 552
258 Ga0495633_0072703 3300046558 Bacteria 1603
259 Ga0495656_0110978 3300046615 Bacteria 1283
260 Ga0495668_0000439 3300046616 Bacteria 53300
261 Ga0495668_0233740 3300046616 Bacteria 1007
262 Ga0495668_0447955 3300046616 Bacteria 710
263 Ga0495668_0590981 3300046616 Bacteria 613
264 Ga0495625_0000384 3300046660 Bacteria 67484
265 Ga0495625_0000528 3300046660 Bacteria 56251
266 Ga0495625_0003460 3300046660 Bacteria 15720
267 Ga0495625_0011893 3300046660 Bacteria 7066
268 Ga0495625_0032619 3300046660 Bacteria 3859
269 Ga0495625_0053572 3300046660 Bacteria 2884
270 Ga0495625_0271369 3300046660 Bacteria 1094
271 Ga0495625_0380669 3300046660 Bacteria 885
272 Ga0495661_0082251 3300046665 Bacteria 1854
273 Ga0495670_0490278 3300046691 Bacteria 667
274 Ga0495671_0124213 3300046692 Bacteria 1259
275 Ga0495649_0154822 3300046694 Bacteria 1203
276 Ga0495660_0038699 3300046810 Bacteria 2650
277 Ga0495636_0157143 3300047318 Bacteria 1023
278 Ga0495672_0000663 3300047320 Bacteria 38282
279 Ga0495687_014487 3300047443 Bacteria 4056
280 Ga0495677_0121442 3300047445 Bacteria 997
281 Ga0495681_0130719 3300047470 Bacteria 1069
282 Ga0495686_0005217 3300047472 Bacteria 10331
283 Ga0495686_0011752 3300047472 Bacteria 6163
284 Ga0495686_0022976 3300047472 Bacteria 4119
285 Ga0495686_0095853 3300047472 Bacteria 1796
286 Ga0495686_0681735 3300047472 Bacteria 526
287 Ga0496102_0617953 3300048905 Bacteria 1007
288 Ga0496106_0358761 3300048909 Bacteria 1171
289 Ga0496115_0061491 3300048918 Bacteria 3027
290 Ga0496121_0278619 3300048924 Bacteria 1145
291 Ga0496121_0495078 3300048924 Bacteria 777
292 Ga0496122_0481903 3300048925 Bacteria 607
293 Ga0496125_0000147 3300048928 Bacteria 154731
294 Ga0496125_0062153 3300048928 Bacteria 2989
295 Ga0501300_028822 3300049523 Bacteria 818
296 Ga0501038_0000379 3300049574 Bacteria 38322
297 Ga0501067_0010852 3300049583 Bacteria 5042
298 nmdc:mga03683_3731_c1 3300050489 Bacteria 4965
299 nmdc:mga03n38_34579_c1 3300050490 Bacteria 2159
300 nmdc:mga03n38_3930_c1 3300050490 Bacteria 4844
301 nmdc:mga00v17_147865_c1 3300050491 Bacteria 1508
302 nmdc:mga0yw44_316822_c1 3300050492 Bacteria 1047
303 nmdc:mga06z11_11126_c1 3300050494 Bacteria 3867
304 nmdc:mga06z11_27521_c1 3300050494 Bacteria 2718
305 nmdc:mga06z11_453934_c1 3300050494 Bacteria 774
306 nmdc:mga04h51_380610_c1 3300050495 Bacteria 588
307 nmdc:mga04h51_75791_c1 3300050495 Bacteria 1184
308 nmdc:mga07m45_1210_c1 3300050496 Bacteria 11689
309 nmdc:mga07m45_59136_c2 3300050496 Bacteria 1427
310 nmdc:mga05p37_188428_c1 3300050507 Bacteria 2506
311 nmdc:mga0qj67_53_c1 3300050509 Bacteria 83612
312 nmdc:mga0qj67_723854_c1 3300050509 Bacteria 790
313 nmdc:mga06r32_514218_c1 3300050510 Bacteria 1173
314 nmdc:mga08y16_20076_c1 3300050511 Bacteria 7050
315 nmdc:mga0sz30_18048_c1 3300050516 Bacteria 2820
316 nmdc:mga0sz30_477135_c1 3300050516 Bacteria 560
317 nmdc:mga0sz30_90770_c1 3300050516 Bacteria 1329
318 Ga0500578_0298678 3300053086 Bacteria 955
319 Ga0500644_0175355 3300053088 Bacteria 874
320 Ga0500646_0002840 3300053090 Bacteria 4450
321 Ga0500651_0030893 3300053093 Bacteria 3372
322 Ga0500555_017435 3300053103 Bacteria 2071
323 Ga0500556_0001162 3300053104 Bacteria 12663
324 Ga0500569_016819 3300053109 Bacteria 1859
325 Ga0500592_001356 3300053116 Bacteria 3962
326 Ga0500594_0064922 3300053118 Bacteria 1061
327 Ga0500608_113507 3300053122 Bacteria 1239
328 Ga0500658_0004127 3300053134 Bacteria 5459
329 Ga0500658_0105412 3300053134 Bacteria 1235
330 Ga0500658_0336349 3300053134 Bacteria 693
331 Ga0500659_0404912 3300053135 Bacteria 581
332 Ga0500568_0002314 3300053139 Bacteria 11304
333 Ga0500604_0018253 3300053151 Bacteria 1953
334 Ga0500616_0015452 3300053153 Bacteria 4364
335 Ga0500616_0049290 3300053153 Bacteria 2229
336 Ga0500627_0000008 3300053158 Bacteria 161914
337 Ga0500627_0053744 3300053158 Bacteria 1761
338 Ga0500645_006179 3300053730 Bacteria 4303
339 Ga0500645_022922 3300053730 Bacteria 1916
340 Ga0500645_025064 3300053730 Bacteria 1821
341 Ga0500609_000123 3300053731 Bacteria 10289
342 Ga0500609_007299 3300053731 Bacteria 1493
343 Ga0500599_031090 3300053736 Bacteria 795
344 2513657962 2513237096 Bacteria 8722461
345 2513855661 2513237137 Bacteria 9558895
346 2513919945 2513237145 Bacteria 8979722
347 2524437549 2524023205 Bacteria 8918781
348 2524534290 2524023228 Bacteria 10118060
349 2671120552 2667528175 Bacteria 7532676
350 2745079665 2744054633 Bacteria 8678936
351 2793068731 2791355197 Bacteria 8420563
352 2852681504 2852680915 Bacteria 4100189
353 2885382671 2885374607 Bacteria 8927485
354 2903751572 2903748898 Bacteria 9972761
355 2904702343
356 2906617323
357 2906642652 2906635258 Bacteria 8601019
358 2906666170 2906660503 Bacteria 8595048
359 2922430502
360 3005480413 3005474847 Bacteria 9259049
361 3005715095 3005710791 Bacteria 7622528
362 8006940461 8006933436 Bacteria 10410654
363 8006980150 8006973647 Bacteria 10679141
364 8019568777 8019565922 Bacteria 9639779
365 8056691324 8056689827 Bacteria 6712655
366 Ga0209130_1020776
367 JGI24743J22301_10000468
368 JGI24033J26618_1000350
369 JGI25152J39213_1035718
370 JGI25150J39212_1022853
371 JGI25151J46595_10001028
372 JGI25153J46596_10006938
373 JGI25153J46596_10022843
374 JGI25153J46596_10062932
375 rootH2_10019180
376 rootL2_10111317
377 rootL2_10114096
378 JGI25160J50197_1003325
379 JGI25161J50226_1002712
380 JGI25161J50226_1003474
381 Ga0055526_1010046
382 Ga0055537_1000893
383 Ga0055524_1012293
384 Ga0055524_1017526
385 Ga0055524_1018611
386 Ga0055524_1020386
387 Ga0055536_1002895
388 Ga0055536_1005127
389 Ga0055536_1037130
390 Ga0055528_1000269
391 Ga0055528_1002448
392 Ga0055528_1007602
393 Ga0055528_1019074
394 Ga0055530_10000116
395 Ga0055530_10022648
396 Ga0055540_1000192
397 Ga0055540_1006121
398 Ga0055531_10000451
399 Ga0055531_10005605
400 Ga0055543_1000329
401 Ga0065165_1003879
402 Ga0070676_10597938
403 Ga0070680_100509291
404 Ga0070661_100000454
405 Ga0070661_100303036
406 Ga0070669_100665832
407 Ga0070675_100969544
408 Ga0070674_100031341
409 Ga0070674_100359895
410 Ga0070674_100398602
411 Ga0070659_100025104
412 Ga0070714_100038477
413 Ga0070713_100109870
414 Ga0070663_102125454
415 Ga0070678_100137367
416 Ga0068861_100816347
417 Ga0068860_100953387
418 Ga0068862_100092209
419 Ga0068862_100142584
420 Ga0081538_10012989
421 Ga0081539_10326561
422 Ga0070717_10071390
423 Ga0075365_10000975
424 Ga0075368_10025809
425 Ga0075368_10571150
426 Ga0075363_100021670
427 Ga0075363_100154431
428 Ga0075362_10000395
429 Ga0075367_10017119
430 Ga0075367_10495433
431 Ga0075367_10778943
432 Ga0075369_10000652
433 Ga0075369_10281869
434 Ga0075366_10013962
435 Ga0075366_10222492
436 Ga0075366_10379629
437 Ga0075370_10047152
438 Ga0075370_10069924
439 Ga0068871_100311008
440 Ga0075428_101112712
441 Ga0075430_100001497
442 Ga0111539_10026194
443 Ga0114129_10104432
444 Ga0105243_10792537
445 Ga0105243_10808635
446 Ga0105241_10052533
447 Ga0105249_10133498
448 Ga0105249_10163335
449 Ga0105249_10268705
450 Ga0123341_1000013
451 Ga0123342_1029184
452 Ga0105239_12375494
453 Ga0157374_10089145
454 Ga0157378_10008937
455 Ga0163162_12814066
456 Ga0157375_10176416
457 Ga0213875_10302654
458 Ga0207425_1002767
459 Ga0209129_1002229
460 Ga0209565_1000118
461 Ga0209565_1036915
462 Ga0209673_1000013
463 Ga0209673_1000325
464 Ga0209673_1001150
465 Ga0209673_1001202
466 Ga0209673_1005093
467 Ga0209675_1000258
468 Ga0209675_1002511
469 Ga0209676_1000146
470 Ga0209676_1000569
471 Ga0209676_1000688
472 Ga0209676_1017939
473 Ga0209025_1000483
474 Ga0209564_1000264
475 Ga0209564_1002390
476 Ga0209564_1010486
477 Ga0209564_1019055
478 Ga0209564_1022840
479 Ga0209758_1001861
480 Ga0209758_1002674
481 Ga0209758_1010928
482 Ga0209758_1016416
483 Ga0209758_1104949
484 Ga0209758_1108179
485 Ga0209758_1150366
486 Ga0209050_1000218
487 Ga0209050_1001746
488 Ga0209050_1007871
489 Ga0209050_1007971
490 Ga0209050_1036408
491 Ga0209256_1000245
492 Ga0209256_1000369
493 Ga0209256_1000962
494 Ga0209256_1008817
495 Ga0207426_1000039
496 Ga0209051_1000253
497 Ga0209051_1010056
498 Ga0209257_1000248
499 Ga0209257_1000375
500 Ga0209257_1002797
501 Ga0209257_1102745
502 Ga0207688_10062050
503 Ga0207647_10367389
504 Ga0207699_10389226
505 Ga0207645_10707957
506 Ga0207654_10023759
507 Ga0207649_10005290
508 Ga0207681_10042993
509 Ga0207659_10819061
510 Ga0207700_10035983
511 Ga0207664_10765284
512 Ga0207690_10018391
513 Ga0207709_11047743
514 Ga0207709_11131713
515 Ga0207669_10299130
516 Ga0207665_10146168
517 Ga0207712_10101245
518 Ga0207712_11274546
519 Ga0207712_12072747
520 Ga0207648_10645962
521 Ga0207675_100396586
522 Ga0207683_10054424
523 Ga0209813_10063528
524 Ga0209813_10345835
525 Ga0207428_10102057
526 Ga0268264_10362343
527 Ga0307515_10069370
528 Ga0307515_10194059
529 Ga0307515_10342536
530 Ga0307515_10851357
531 Ga0307512_10090151
532 Ga0265331_10147613
533 Ga0265327_10098909
534 Ga0265316_10987600
535 Ga0307513_11028326
536 Ga0307508_10088283
537 Ga0307516_10142346
538 Ga0307405_10213323
539 Ga0307413_10032270
540 Ga0307406_10126365
541 Ga0307407_10074359
542 Ga0307409_102757239
543 Ga0307510_10147817
544 Ga0315911_1000006
545 Ga0316212_1036435
546 Ga0436364_1269254
547 Ga0436365_0505464
548 Ga0436365_1808909
549 Ga0436360_0035211
550 Ga0439436_0026787
551 Ga0439436_0049460
552 Ga0439447_137147
553 Ga0439453_0107503
554 Ga0439466_0134549
555 Ga0451787_595464
556 Ga0451789_0414206
557 Ga0451797_0695431
558 Ga0451795_1356076
559 Ga0451804_1090665
560 Ga0451807_0245592
561 Ga0451807_1764193
562 Ga0451833_0058585
563 Ga0451833_0334281
564 Ga0451835_0540988
565 Ga0451837_0383817
566 Ga0451837_0963211
567 Ga0451839_0482178
568 Ga0451839_0624672
569 Ga0451841_0296417
570 Ga0451841_1101896
571 Ga0451841_1232351
572 Ga0451845_0267647
573 Ga0451847_0246048
574 Ga0451847_0465822
575 Ga0451849_0193008
576 Ga0451849_0978160
577 Ga0451849_1068945
578 Ga0451851_0413526
579 Ga0451851_0984963
580 Ga0451855_0080566
581 Ga0451855_0518671
582 Ga0451853_1859300
583 Ga0451853_4032906
584 Ga0439445_0137476
585 Ga0439432_070005
586 Ga0439462_0022999
587 Ga0439462_0247166
588 Ga0439459_0038195
589 Ga0466957_0007398
590 Ga0495638_0001206
591 Ga0495638_0195847
592 Ga0495650_0000069
593 Ga0495650_0057064
594 Ga0495650_0204159
595 Ga0495605_0053058
596 Ga0495596_0020541
597 Ga0495607_0175114
598 Ga0495606_0004031
599 Ga0495606_0509184
600 Ga0495610_0000378
601 Ga0495610_0008031
602 Ga0495610_0150093
603 Ga0495610_0222002
604 Ga0495616_0079199
605 Ga0495616_0119910
606 Ga0495620_0115754
607 Ga0495620_0328607
608 Ga0495632_0173428
609 Ga0495637_0016978
610 Ga0495637_0071010
611 Ga0495637_0074876
612 Ga0495643_0011820
613 Ga0495643_0014703
614 Ga0495643_0101151
615 Ga0495648_0003811
616 Ga0495648_0019793
617 Ga0495663_0041634
618 Ga0495654_0000285
619 Ga0495654_0040565
620 Ga0495654_0062851
621 Ga0495609_0033637
622 Ga0495609_0396858
623 Ga0495633_0072703
624 Ga0495656_0110978
625 Ga0495668_0000439
626 Ga0495668_0233740
627 Ga0495668_0447955
628 Ga0495668_0590981
629 Ga0495625_0000384
630 Ga0495625_0000528
631 Ga0495625_0003460
632 Ga0495625_0011893
633 Ga0495625_0032619
634 Ga0495625_0053572
635 Ga0495625_0271369
636 Ga0495625_0380669
637 Ga0495661_0082251
638 Ga0495670_0490278
639 Ga0495671_0124213
640 Ga0495649_0154822
641 Ga0495660_0038699
642 Ga0495636_0157143
643 Ga0495672_0000663
644 Ga0495687_014487
645 Ga0495677_0121442
646 Ga0495681_0130719
647 Ga0495686_0005217
648 Ga0495686_0011752
649 Ga0495686_0022976
650 Ga0495686_0095853
651 Ga0495686_0681735
652 Ga0496102_0617953
653 Ga0496106_0358761
654 Ga0496115_0061491
655 Ga0496121_0278619
656 Ga0496121_0495078
657 Ga0496122_0481903
658 Ga0496125_0000147
659 Ga0496125_0062153
660 Ga0501300_028822
661 Ga0501038_0000379
662 Ga0501067_0010852
663 nmdc:mga03683_3731_c1
664 nmdc:mga03n38_34579_c1
665 nmdc:mga03n38_3930_c1
666 nmdc:mga00v17_147865_c1
667 nmdc:mga0yw44_316822_c1
668 nmdc:mga06z11_11126_c1
669 nmdc:mga06z11_27521_c1
670 nmdc:mga06z11_453934_c1
671 nmdc:mga04h51_380610_c1
672 nmdc:mga04h51_75791_c1
673 nmdc:mga07m45_1210_c1
674 nmdc:mga07m45_59136_c2
675 nmdc:mga05p37_188428_c1
676 nmdc:mga0qj67_53_c1
677 nmdc:mga0qj67_723854_c1
678 nmdc:mga06r32_514218_c1
679 nmdc:mga08y16_20076_c1
680 nmdc:mga0sz30_18048_c1
681 nmdc:mga0sz30_477135_c1
682 nmdc:mga0sz30_90770_c1
683 Ga0500578_0298678
684 Ga0500644_0175355
685 Ga0500646_0002840
686 Ga0500651_0030893
687 Ga0500555_017435
688 Ga0500556_0001162
689 Ga0500569_016819
690 Ga0500592_001356
691 Ga0500594_0064922
692 Ga0500608_113507
693 Ga0500658_0004127
694 Ga0500658_0105412
695 Ga0500658_0336349
696 Ga0500659_0404912
697 Ga0500568_0002314
698 Ga0500604_0018253
699 Ga0500616_0015452
700 Ga0500616_0049290
701 Ga0500627_0000008
702 Ga0500627_0053744
703 Ga0500645_006179
704 Ga0500645_022922
705 Ga0500645_025064
706 Ga0500609_000123
707 Ga0500609_007299
708 Ga0500599_031090
709 2513657962
710 2513855661
711 2513919945
712 2524437549
713 2524534290
714 2671120552
715 2745079665
716 2793068731
717 2852681504
718 2885382671
719 2903751572
720 2904702343
721 2906617323
722 2906642652
723 2906666170
724 2922430502
725 3005480413
726 3005715095
727 8006940461
728 8006980150
729 8019568777
730 8056691324

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

62

159

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ecy-assembly1.cif.gz_A ohra (organic hydroperoxide resistance protein) wild type from chromobacterium violaceum 0.9049 4 131
1usp-assembly1.cif.gz_A organic hydroperoxide resistance protein from deinococcus radiodurans 0.8932 5 130
4mh4-assembly1.cif.gz_B crystal structure of osmc-like protein from burkholderia cenocepacia j2315 0.89 1 131
4mh4-assembly1.cif.gz_B crystal structure of osmc-like protein from burkholderia cenocepacia j2315 0.8837 1 131
6ed0-assembly1.cif.gz_B "ohra (organic hydroperoxide resistance protein) mutant (c61s) in the ""open conformation"" from chromobacterium violaceum" 0.8822 1 131
ID Description Score Start End Superfamily
6mjnB02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9015 39 131 3.30.300.20
4xx2A02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9004 39 131 3.30.300.20
4xx2A02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8826 39 131 3.30.300.20
6mjnB02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8667 39 131 3.30.300.20
1uspA01 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.8496 5 32 2.20.25.10
ID Description Score Start End GO Terms
AF-A0A426SWX4-F1-model_v4 deleted 0.9396 40 131
AF-A0A508X706-F1-model_v4 Organic hydroperoxide resistance protein 0.9392 40 131 GO:0006979
AF-A0A7X6EK14-F1-model_v4 deleted 0.9372 47 131
AF-A0A0P9ULJ2-F1-model_v4 Organic hydroperoxide resistance protein 0.9361 40 131 GO:0006979
AF-A0A4R6EP02-F1-model_v4 Ohr subfamily peroxiredoxin 0.9344 40 131 GO:0006979

Map