F423723

General Info

Members Datasets Scaffolds Average Seq Length
365 252 732 373

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10000009|Ga0265327_10000009352
Length 407
Sequence MQVFLLYPRGYGYLRQHFFVLHKQVIVMKIGIVCYPTFGGSGVLATELGMALSEKGHEIHFITYQQPVRLNFHPNIYYHEVTVPTYPLFDFPPYETALASTMVNVILNNNLDLLHVHYAIPHASAAYFARQILKKQGRDIPFITTLHGTDITLVGKDQTYAPVVTFSINESNAITAVSDNLREETYRSFAIEKDIQVIPNFVDSIRFRQTDKGHFKKMLAPNGERILAHVSNFRKVKRVEDVVRVFERVHEVIPSKLLMIGDGPERQSAEELCRTLRICNDIRFLGKQEQMDEILSITDLFILPSQYESFGLAALEAMSCGVPVISTNAGGLPEINVQGKTGYLSDVGDVTDMAKHAIEILKEDSTLERFKRNAIEHARNFEKEKIIPMYEDLYNQVVADYRRQASV

Samples

Sample ID Description Type Environment
1 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
45 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
46 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
47 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
63 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
72 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
95 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
96 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
99 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
100 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
101 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
102 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
103 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
107 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
108 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
111 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
114 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
115 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
119 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
120 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
121 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
122 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
123 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
124 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
125 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
126 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
127 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
128 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
129 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
132 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
133 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
134 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
135 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
136 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
137 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
138 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
139 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
140 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
141 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
142 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
143 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
144 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
145 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
146 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
147 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
148 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
149 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
150 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
151 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
152 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
153 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
154 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
155 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
156 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
157 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
158 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
159 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
160 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
161 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
162 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
165 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
166 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
167 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
168 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
169 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
170 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
171 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
172 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
178 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
181 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
182 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
185 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
186 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
187 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
191 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
192 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
193 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
194 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
195 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
196 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
197 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
198 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
199 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
200 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
201 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
202 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
203 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
204 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
205 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
206 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
207 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
208 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
211 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
212 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
213 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
214 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
215 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
216 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
217 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
218 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
219 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
220 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
221 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
222 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
223 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
224 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
225 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
226 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
227 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
228 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
229 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
230 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
231 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
232 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
233 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
234 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
235 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
236 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
237 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
238 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
239 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
240 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
241 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
242 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
243 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
244 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
245 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
246 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
247 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
248 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
249 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
250 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
251 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
252 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.49
Metatranscriptomes 0
Isolates 11.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.32
Nodule 1.37
Rhizoplane 0.55
Rhizosphere 76.16
Stem 0
Stem Tuber 0
Unclassified 1.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265327_10000009 3300031251 Bacteria 616360
2 SwRhRL2b_contig_1496964 2162886007 Bacteria 130484
3 rootH2_10112982 3300003320 Bacteria 2598
4 rootL2_10017393 3300003322 Bacteria 16257
5 rootL2_10033096 3300003322 Bacteria 4969
6 rootL2_10104533 3300003322 Unclassified 2889
7 rootL2_10155258 3300003322 Bacteria 3928
8 rootL2_10249890 3300003322 Bacteria 5537
9 rootH1_10001269 3300003316 Bacteria 3482
10 rootH1_10001269 3300003323 Bacteria 14822
11 rootH1_10050108 3300003316 Bacteria 3166
12 rootH1_10050108 3300003323 Bacteria 5996
13 JGI25160J50197_1002636 3300003354 Bacteria 8267
14 Ga0055542_1004764 3300003762 Bacteria 3194
15 Ga0055530_10003151 3300003791 Bacteria 9709
16 Ga0055531_10000115 3300003794 Bacteria 88381
17 Ga0065165_1009172 3300005262 Bacteria 4479
18 Ga0065714_10001966 3300005288 Bacteria 3263
19 Ga0065714_10115703 3300005288 Bacteria 1412
20 Ga0065714_10127929 3300005288 Bacteria 1218
21 Ga0065704_10070178 3300005289 Bacteria 132449
22 Ga0065704_10071298 3300005289 Bacteria 11890
23 Ga0065704_10090471 3300005289 Bacteria 2784
24 Ga0065715_10096529 3300005293 Bacteria 3831
25 Ga0065715_10156609 3300005293 Bacteria 1670
26 Ga0065715_10181132 3300005293 Bacteria 1476
27 Ga0070658_10086032 3300005327 Bacteria 2585
28 Ga0070683_100002964 3300005329 Bacteria 13608
29 Ga0070683_100220389 3300005329 Bacteria 1803
30 Ga0070680_100099728 3300005336 Bacteria 2410
31 Ga0070680_100202701 3300005336 Bacteria 1673
32 Ga0070682_100000079 3300005337 Bacteria 87919
33 Ga0070682_100014099 3300005337 Bacteria 4615
34 Ga0070682_100081260 3300005337 Bacteria 2098
35 Ga0068868_100005618 3300005338 Bacteria 8824
36 Ga0070660_100180598 3300005339 Bacteria 1708
37 Ga0070689_100002657 3300005340 Bacteria 11721
38 Ga0070691_10012668 3300005341 Bacteria 3862
39 Ga0070661_100035350 3300005344 Bacteria 3628
40 Ga0070661_100060198 3300005344 Bacteria 2786
41 Ga0070673_100177867 3300005364 Bacteria 1820
42 Ga0070673_100259080 3300005364 Bacteria 1519
43 Ga0070659_100127699 3300005366 Bacteria 2063
44 Ga0070714_100010710 3300005435 Bacteria 7256
45 Ga0070714_100013815 3300005435 Bacteria 6474
46 Ga0070681_10002112 3300005458 Bacteria 18045
47 Ga0070681_10101741 3300005458 Bacteria 2819
48 Ga0070681_10165021 3300005458 Bacteria 2137
49 Ga0068867_100147387 3300005459 Bacteria 1846
50 Ga0070679_100057778 3300005530 Bacteria 3867
51 Ga0070679_100078142 3300005530 Bacteria 3298
52 Ga0070679_100147143 3300005530 Bacteria 2333
53 Ga0070684_100009730 3300005535 Bacteria 7587
54 Ga0068853_100316043 3300005539 Bacteria 1447
55 Ga0070672_100000368 3300005543 Bacteria 25953
56 Ga0070672_100020062 3300005543 Bacteria 4869
57 Ga0070696_100009598 3300005546 Bacteria 6473
58 Ga0070665_100004307 3300005548 Bacteria 14962
59 Ga0068855_100010993 3300005563 Bacteria 10923
60 Ga0068855_100193682 3300005563 Bacteria 2291
61 Ga0068855_100297848 3300005563 Bacteria 1787
62 Ga0068857_100191871 3300005577 Bacteria 1861
63 Ga0068854_100036275 3300005578 Bacteria 3456
64 Ga0068852_100043467 3300005616 Bacteria 3811
65 Ga0068852_100269415 3300005616 Bacteria 1638
66 Ga0068852_100281585 3300005616 Bacteria 1603
67 Ga0068859_100142821 3300005617 Bacteria 2467
68 Ga0068864_100000001 3300005618 Bacteria 686767
69 Ga0068858_100000467 3300005842 Bacteria 42180
70 Ga0070716_100037908 3300006173 Bacteria 2666
71 Ga0075436_100008633 3300006914 Bacteria 6965
72 Ga0097620_100142817 3300006931 Bacteria 2467
73 Ga0099824_1005289 3300006942 Bacteria 18237
74 Ga0079104_1000057 3300006946 Bacteria 165780
75 Ga0099826_10004737 3300006948 Bacteria 9597
76 Ga0105244_10000002 3300009036 Bacteria 495554
77 Ga0105240_10011725 3300009093 Bacteria 12177
78 Ga0105240_10121483 3300009093 Bacteria 3145
79 Ga0105240_10184782 3300009093 Unclassified 2456
80 Ga0111539_10226270 3300009094 Bacteria 2179
81 Ga0111539_10273649 3300009094 Bacteria 1965
82 Ga0105245_10000957 3300009098 Bacteria 26254
83 Ga0105241_10090822 3300009174 Bacteria 2409
84 Ga0105237_10046294 3300009545 Bacteria 4375
85 Ga0105237_10048551 3300009545 Bacteria 4267
86 Ga0105237_10061982 3300009545 Bacteria 3739
87 Ga0105239_10045378 3300010375 Bacteria 4816
88 Ga0105239_10066188 3300010375 Bacteria 3969
89 Ga0105239_10097867 3300010375 Bacteria 3243
90 Ga0105239_10243607 3300010375 Bacteria 2018
91 Ga0157373_10000001 3300013100 Bacteria 864756
92 Ga0157373_10001719 3300013100 Bacteria 16638
93 Ga0157371_10001958 3300013102 Bacteria 20459
94 Ga0157371_10018808 3300013102 Bacteria 5103
95 Ga0157371_10038631 3300013102 Bacteria 3415
96 Ga0157371_10056953 3300013102 Bacteria 2772
97 Ga0157371_10140107 3300013102 Bacteria 1723
98 Ga0157370_10000225 3300013104 Bacteria 71924
99 Ga0157370_10001396 3300013104 Bacteria 29939
100 Ga0157370_10004519 3300013104 Bacteria 15945
101 Ga0157370_10004619 3300013104 Bacteria 15745
102 Ga0157370_10004859 3300013104 Bacteria 15261
103 Ga0157370_10023531 3300013104 Bacteria 6113
104 Ga0157370_10035381 3300013104 Bacteria 4854
105 Ga0157370_10091110 3300013104 Bacteria 2863
106 Ga0157370_10143329 3300013104 Bacteria 2225
107 Ga0157370_10155376 3300013104 Bacteria 2128
108 Ga0157369_10006877 3300013105 Bacteria 13125
109 Ga0157378_10000891 3300013297 Bacteria 27532
110 Ga0157378_10015971 3300013297 Bacteria 6576
111 Ga0163162_10142436 3300013306 Bacteria 2511
112 Ga0157372_10006599 3300013307 Bacteria 12350
113 Ga0157372_10020253 3300013307 Bacteria 7174
114 Ga0157372_10036980 3300013307 Bacteria 5383
115 Ga0157372_10137382 3300013307 Bacteria 2816
116 Ga0157372_10159685 3300013307 Bacteria 2605
117 Ga0157372_10202809 3300013307 Bacteria 2298
118 Ga0157372_10311034 3300013307 Bacteria 1834
119 Ga0157372_10411161 3300013307 Bacteria 1577
120 Ga0157375_10000077 3300013308 Bacteria 100528
121 Ga0157375_10324524 3300013308 Bacteria 1704
122 Ga0182006_1004757 3300015261 Bacteria 6628
123 Ga0182005_1000100 3300015265 Bacteria 65235
124 Ga0163161_10000061 3300017792 Bacteria 112295
125 Ga0163161_10013706 3300017792 Bacteria 5645
126 Ga0163161_10063687 3300017792 Bacteria 2688
127 Ga0163161_10175932 3300017792 Bacteria 1638
128 Ga0213876_10013716 3300021384 Bacteria 4294
129 Ga0209258_100032 3300025242 Bacteria 452764
130 Ga0209148_1000223 3300025254 Bacteria 93490
131 Ga0209676_1000106 3300025292 Bacteria 222576
132 Ga0209564_1004857 3300025295 Bacteria 7987
133 Ga0209050_1000174 3300025298 Bacteria 148871
134 Ga0207426_1000059 3300025302 Bacteria 363842
135 Ga0209257_1000128 3300025304 Bacteria 214268
136 Ga0207655_1000012 3300025728 Bacteria 640488
137 Ga0207707_10000742 3300025912 Bacteria 32154
138 Ga0207707_10011628 3300025912 Bacteria 7662
139 Ga0207707_10080427 3300025912 Bacteria 2846
140 Ga0207695_10005977 3300025913 Bacteria 15920
141 Ga0207695_10006385 3300025913 Bacteria 15338
142 Ga0207695_10062724 3300025913 Bacteria 3836
143 Ga0207671_10000198 3300025914 Bacteria 93274
144 Ga0207671_10069786 3300025914 Bacteria 2619
145 Ga0207649_10011090 3300025920 Bacteria 4960
146 Ga0207652_10002728 3300025921 Bacteria 14815
147 Ga0207652_10134720 3300025921 Bacteria 2205
148 Ga0207652_10271991 3300025921 Bacteria 1528
149 Ga0207687_10007205 3300025927 Bacteria 7332
150 Ga0207690_10112619 3300025932 Bacteria 1962
151 Ga0207670_10000577 3300025936 Bacteria 20250
152 Ga0207665_10160150 3300025939 Bacteria 1618
153 Ga0207665_10231901 3300025939 Bacteria 1357
154 Ga0207691_10000966 3300025940 Bacteria 28538
155 Ga0207689_10096886 3300025942 Bacteria 2423
156 Ga0207661_10017233 3300025944 Bacteria 5342
157 Ga0207661_10048970 3300025944 Bacteria 3361
158 Ga0207667_10060577 3300025949 Bacteria 3961
159 Ga0207667_10196238 3300025949 Bacteria 2071
160 Ga0207667_10410623 3300025949 Bacteria 1378
161 Ga0207640_10007048 3300025981 Bacteria 6189
162 Ga0207677_10000003 3300026023 Bacteria 450061
163 Ga0207703_10000085 3300026035 Bacteria 107333
164 Ga0207678_10262971 3300026067 Bacteria 1479
165 Ga0207702_10295393 3300026078 Bacteria 1536
166 Ga0207676_10000002 3300026095 Bacteria 1198607
167 Ga0207674_10124524 3300026116 Bacteria 2543
168 Ga0207674_10139697 3300026116 Bacteria 2382
169 Ga0209281_1000276 3300027111 Bacteria 97890
170 Ga0209489_115417 3300027361 Bacteria 4689
171 Ga0209968_1000889 3300027526 Bacteria 4637
172 Ga0268266_10002462 3300028379 Bacteria 19795
173 Ga0265334_10044199 3300028573 Unclassified 1731
174 Ga0265318_10043084 3300028577 Bacteria 1711
175 Ga0307515_10282317 3300028794 Bacteria 1366
176 Ga0265328_10024899 3300031239 Bacteria 2258
177 Ga0265325_10003729 3300031241 Bacteria 9846
178 Ga0265331_10027598 3300031250 Bacteria 2845
179 Ga0265327_10000197 3300031251 Bacteria 126837
180 Ga0265327_10022045 3300031251 Bacteria 3824
181 Ga0265327_10064222 3300031251 Bacteria 1861
182 Ga0307408_100015004 3300031548 Bacteria 5155
183 Ga0265314_10017746 3300031711 Bacteria 5576
184 Ga0265314_10101414 3300031711 Bacteria 1849
185 Ga0265314_10179247 3300031711 Bacteria 1271
186 Ga0307405_10000007 3300031731 Bacteria 348101
187 Ga0307413_10000933 3300031824 Bacteria 10419
188 Ga0307413_10031990 3300031824 Bacteria 2976
189 Ga0307410_10000070 3300031852 Bacteria 35922
190 Ga0307410_10033819 3300031852 Bacteria 3304
191 Ga0307406_10000036 3300031901 Bacteria 82585
192 Ga0307407_10002764 3300031903 Bacteria 6987
193 Ga0307414_10000008 3300032004 Bacteria 375832
194 Ga0307414_10008289 3300032004 Bacteria 5885
195 Ga0307414_10024963 3300032004 Bacteria 3819
196 Ga0307414_10039400 3300032004 Bacteria 3182
197 Ga0307414_10040075 3300032004 Bacteria 3161
198 Ga0307414_10052865 3300032004 Bacteria 2830
199 Ga0307414_10150450 3300032004 Bacteria 1836
200 Ga0307411_10000012 3300032005 Bacteria 161467
201 Ga0307510_10061899 3300033180 Bacteria 3830
202 Ga0373950_0000003 3300034818 Bacteria 541085
203 Ga0316584_0100884 3300036712 Bacteria 2161
204 Ga0395899_0000088 3300037312 Bacteria 156987
205 Ga0395905_0000003 3300037471 Bacteria 1347396
206 Ga0395905_0077441 3300037471 Unclassified 3116
207 Ga0436365_0784550 3300039437 Bacteria 26843
208 Ga0436365_1143821 3300039437 Bacteria 24571
209 Ga0439436_0026883 3300041404 Bacteria 1685
210 Ga0439447_001615 3300041407 Bacteria 8262
211 Ga0439466_0012224 3300041411 Bacteria 3167
212 Ga0439446_0027916 3300042156 Bacteria 1622
213 Ga0439434_0019563 3300042435 Bacteria 2030
214 Ga0451577_0000161 3300042876 Bacteria 146704
215 Ga0451577_0003932 3300042876 Bacteria 16050
216 Ga0451577_0016846 3300042876 Bacteria 6760
217 Ga0466969_0044868 3300044656 Bacteria 2197
218 Ga0453683_0000718 3300044673 Bacteria 34148
219 Ga0453684_0012324 3300044712 Bacteria 14148
220 Ga0453684_0125157 3300044712 Bacteria 3095
221 Ga0453684_0344188 3300044712 Bacteria 1683
222 Ga0466968_0038868 3300044735 Bacteria 2001
223 Ga0466959_0023668 3300045049 Bacteria 4546
224 Ga0451576_0012426 3300045051 Bacteria 9565
225 Ga0495627_001180 3300046453 Bacteria 16626
226 Ga0495627_003064 3300046453 Bacteria 7604
227 Ga0495592_0000045 3300046454 Bacteria 118163
228 Ga0495592_0089547 3300046454 Bacteria 2210
229 Ga0495662_0021760 3300046476 Bacteria 3098
230 Ga0495662_0032855 3300046476 Bacteria 2507
231 Ga0495664_0015106 3300046477 Bacteria 4386
232 Ga0495594_0011590 3300046499 Bacteria 4585
233 Ga0495607_0012594 3300046501 Bacteria 5574
234 Ga0495606_0094501 3300046507 Bacteria 1832
235 Ga0495616_0020888 3300046513 Bacteria 3556
236 Ga0495618_0000362 3300046514 Bacteria 32670
237 Ga0495628_0000028 3300046516 Bacteria 126332
238 Ga0495630_0009365 3300046517 Bacteria 7040
239 Ga0495643_0000392 3300046522 Bacteria 57744
240 Ga0495652_0016125 3300046529 Bacteria 6684
241 Ga0495652_0281772 3300046529 Bacteria 1217
242 Ga0495640_0020559 3300046533 Bacteria 4857
243 Ga0495586_0000312 3300046535 Bacteria 30763
244 Ga0495587_0011683 3300046536 Bacteria 5559
245 Ga0495645_0027361 3300046543 Bacteria 4143
246 Ga0495645_0079773 3300046543 Bacteria 2350
247 Ga0495645_0084771 3300046543 Bacteria 2269
248 Ga0495633_0001243 3300046558 Bacteria 20376
249 Ga0495667_0090352 3300046559 Bacteria 1984
250 Ga0495668_0000595 3300046616 Bacteria 43979
251 Ga0495634_0069474 3300046642 Bacteria 2324
252 Ga0495625_0057611 3300046660 Bacteria 2762
253 Ga0495599_0005059 3300046678 Bacteria 7848
254 Ga0495624_0010466 3300046690 Bacteria 6394
255 Ga0495670_0051886 3300046691 Bacteria 2053
256 Ga0495600_0056597 3300046809 Bacteria 2562
257 Ga0495581_0005163 3300047315 Bacteria 7556
258 Ga0495636_0000012 3300047318 Bacteria 85270
259 Ga0495674_0035795 3300047319 Bacteria 4475
260 Ga0495680_0017737 3300047322 Bacteria 6062
261 Ga0495686_0000542 3300047472 Bacteria 54039
262 Ga0495602_0060635 3300048088 Bacteria 3295
263 Ga0496114_0001571 3300048917 Bacteria 17354
264 Ga0496115_0019035 3300048918 Bacteria 5280
265 Ga0496116_0000004 3300048919 Bacteria 839841
266 Ga0496117_0042497 3300048920 Bacteria 3316
267 Ga0496121_0000051 3300048924 Bacteria 315378
268 Ga0496123_0111678 3300048926 Bacteria 1560
269 Ga0496124_0009014 3300048927 Bacteria 10322
270 Ga0496125_0000012 3300048928 Bacteria 651142
271 Ga0496125_0000185 3300048928 Bacteria 135607
272 Ga0496126_0026493 3300048929 Bacteria 5558
273 Ga0496126_0027497 3300048929 Bacteria 5432
274 Ga0496126_0049183 3300048929 Bacteria 3850
275 Ga0501033_0116033 3300049570 Bacteria 1946
276 Ga0501034_0000789 3300049571 Bacteria 47088
277 Ga0501034_0044790 3300049571 Bacteria 4473
278 Ga0501036_0047485 3300049572 Bacteria 3636
279 Ga0501046_0028873 3300049580 Bacteria 4513
280 Ga0501047_0000014 3300049581 Bacteria 321541
281 Ga0501047_0019130 3300049581 Bacteria 6570
282 Ga0501067_0000169 3300049583 Bacteria 36872
283 Ga0501067_0023809 3300049583 Bacteria 3395
284 Ga0501069_0037528 3300049585 Bacteria 2674
285 Ga0501070_0000154 3300049586 Bacteria 63395
286 Ga0501070_0119859 3300049586 Bacteria 2174
287 Ga0501073_0000470 3300049589 Bacteria 27861
288 Ga0501073_0007983 3300049589 Bacteria 7857
289 Ga0501073_0162634 3300049589 Bacteria 1546
290 Ga0501074_0043479 3300049590 Bacteria 3251
291 Ga0501249_000006 3300049679 Bacteria 224148
292 Ga0501080_0046890 3300049742 Bacteria 4023
293 Ga0501081_0037185 3300049743 Bacteria 3321
294 Ga0501266_000017 3300049763 Bacteria 155699
295 Ga0501269_002994 3300049766 Bacteria 2052
296 Ga0501280_000509 3300049776 Bacteria 9182
297 Ga0501035_0380239 3300049822 Bacteria 1178
298 Ga0501044_0143428 3300049823 Bacteria 2376
299 nmdc:mga08y16_112234_c1 3300050511 Bacteria 2837
300 nmdc:mga08x19_7824_c1 3300050514 Bacteria 6349
301 Ga0500644_0000032 3300053088 Bacteria 85851
302 Ga0500644_0005731 3300053088 Bacteria 3146
303 Ga0500646_0007567 3300053090 Bacteria 2778
304 Ga0500651_0025696 3300053093 Bacteria 3697
305 Ga0500651_0046193 3300053093 Bacteria 2739
306 Ga0500641_0000009 3300053096 Bacteria 173260
307 Ga0500641_0000160 3300053096 Bacteria 25000
308 Ga0500641_0007950 3300053096 Bacteria 3783
309 Ga0500569_003978 3300053109 Bacteria 3069
310 Ga0500594_0027783 3300053118 Bacteria 1467
311 Ga0500607_054900 3300053121 Bacteria 2108
312 Ga0500658_0000035 3300053134 Bacteria 87202
313 Ga0500559_0010154 3300053136 Bacteria 4050
314 Ga0500577_0000683 3300053142 Bacteria 8682
315 Ga0500616_0000008 3300053153 Bacteria 785239
316 Ga0500616_0001739 3300053153 Bacteria 19962
317 Ga0500622_0000109 3300053156 Bacteria 83962
318 Ga0500627_0005333 3300053158 Bacteria 4264
319 Ga0500633_0007440 3300053160 Bacteria 2758
320 Ga0500634_0074673 3300053161 Bacteria 1765
321 Ga0500636_0005236 3300053177 Bacteria 7383
322 Ga0500584_006030 3300053726 Bacteria 5150
323 Ga0501084_0130709 3300054114 Bacteria 2114
324 Ga0501082_0004782 3300060353 Bacteria 11809
325 Ga0501082_0014929 3300060353 Bacteria 6693
326 2513233158 2513020052 Bacteria 5120511
327 2520882251 2519899754 Bacteria 5336938
328 2644010210 2643221600 Bacteria 5530138
329 2644373562 2643221667 Bacteria 5627472
330 2644640254 2643221716 Bacteria 4986332
331 2644683372 2643221725 Bacteria 5087956
332 2738736721 2738541279 Bacteria 6149495
333 2738769177 2738541285 Bacteria 6150075
334 2739218303 2738543007 Bacteria 6149845
335 2740001714 2739367857 Bacteria 5433684
336 2740006530 2739367858 Bacteria 5432813
337 2802652745 2802428842 Bacteria 4926114
338 2817417059 2816332280 Bacteria 5109718
339 2819577297 2818991442 Bacteria 8318214
340 2821140600 2821136567 Bacteria 8080116
341 2840678290 2840677318 Bacteria 2664183
342 2857616185 2857613821 Bacteria 4917088
343 2857622647 2857618242 Bacteria 5635925
344 2881249767 2881247448 Bacteria 3717788
345 2881360365 2881359912 Bacteria 4935907
346 2881957621 2881955468 Bacteria 3545609
347 2883071215 2883068021 Bacteria 6192739
348 2890805310 2890804823 Bacteria 3717572
349 2896086107 2896085136 Bacteria 6129793
350 2903896469 2903895155 Bacteria 5258610
351 2904423530 2904419702 Bacteria 5166287
352 2904473019 2904467357 Bacteria 8057758
353 2904560331 2904555929 Bacteria 5218588
354 2919191669 2919191525 Bacteria 5765973
355 2919511028 2919509842 Bacteria 4104664
356 2919688165 2919683626 Bacteria 5534354
357 2929154336 2929150217 Bacteria 5462483
358 2929240518 2929239360 Bacteria 7745570
359 2958459436 2958458903 Bacteria 5301041
360 2958515326 2958512119 Bacteria 4528530
361 2965320992 2965320100 Bacteria 3975600
362 2977271155 2977268062 Bacteria 5243061
363 8036738320 8036736890 Bacteria 2944828
364 8054308422 8054307821 Bacteria 5212224
365 8055422651 8055419101 Bacteria 5289643
366 8055595501 8055592153 Bacteria 5961247
367 8056443716 8056440228 Bacteria 4946504
368 Ga0265327_10000009
369 SwRhRL2b_contig_1496964
370 rootH2_10112982
371 rootL2_10017393
372 rootL2_10033096
373 rootL2_10104533
374 rootL2_10155258
375 rootL2_10249890
376 rootH1_10001269
377 rootH1_10050108
378 JGI25160J50197_1002636
379 Ga0055542_1004764
380 Ga0055530_10003151
381 Ga0055531_10000115
382 Ga0065165_1009172
383 Ga0065714_10001966
384 Ga0065714_10115703
385 Ga0065714_10127929
386 Ga0065704_10070178
387 Ga0065704_10071298
388 Ga0065704_10090471
389 Ga0065715_10096529
390 Ga0065715_10156609
391 Ga0065715_10181132
392 Ga0070658_10086032
393 Ga0070683_100002964
394 Ga0070683_100220389
395 Ga0070680_100099728
396 Ga0070680_100202701
397 Ga0070682_100000079
398 Ga0070682_100014099
399 Ga0070682_100081260
400 Ga0068868_100005618
401 Ga0070660_100180598
402 Ga0070689_100002657
403 Ga0070691_10012668
404 Ga0070661_100035350
405 Ga0070661_100060198
406 Ga0070673_100177867
407 Ga0070673_100259080
408 Ga0070659_100127699
409 Ga0070714_100010710
410 Ga0070714_100013815
411 Ga0070681_10002112
412 Ga0070681_10101741
413 Ga0070681_10165021
414 Ga0068867_100147387
415 Ga0070679_100057778
416 Ga0070679_100078142
417 Ga0070679_100147143
418 Ga0070684_100009730
419 Ga0068853_100316043
420 Ga0070672_100000368
421 Ga0070672_100020062
422 Ga0070696_100009598
423 Ga0070665_100004307
424 Ga0068855_100010993
425 Ga0068855_100193682
426 Ga0068855_100297848
427 Ga0068857_100191871
428 Ga0068854_100036275
429 Ga0068852_100043467
430 Ga0068852_100269415
431 Ga0068852_100281585
432 Ga0068859_100142821
433 Ga0068864_100000001
434 Ga0068858_100000467
435 Ga0070716_100037908
436 Ga0075436_100008633
437 Ga0097620_100142817
438 Ga0099824_1005289
439 Ga0079104_1000057
440 Ga0099826_10004737
441 Ga0105244_10000002
442 Ga0105240_10011725
443 Ga0105240_10121483
444 Ga0105240_10184782
445 Ga0111539_10226270
446 Ga0111539_10273649
447 Ga0105245_10000957
448 Ga0105241_10090822
449 Ga0105237_10046294
450 Ga0105237_10048551
451 Ga0105237_10061982
452 Ga0105239_10045378
453 Ga0105239_10066188
454 Ga0105239_10097867
455 Ga0105239_10243607
456 Ga0157373_10000001
457 Ga0157373_10001719
458 Ga0157371_10001958
459 Ga0157371_10018808
460 Ga0157371_10038631
461 Ga0157371_10056953
462 Ga0157371_10140107
463 Ga0157370_10000225
464 Ga0157370_10001396
465 Ga0157370_10004519
466 Ga0157370_10004619
467 Ga0157370_10004859
468 Ga0157370_10023531
469 Ga0157370_10035381
470 Ga0157370_10091110
471 Ga0157370_10143329
472 Ga0157370_10155376
473 Ga0157369_10006877
474 Ga0157378_10000891
475 Ga0157378_10015971
476 Ga0163162_10142436
477 Ga0157372_10006599
478 Ga0157372_10020253
479 Ga0157372_10036980
480 Ga0157372_10137382
481 Ga0157372_10159685
482 Ga0157372_10202809
483 Ga0157372_10311034
484 Ga0157372_10411161
485 Ga0157375_10000077
486 Ga0157375_10324524
487 Ga0182006_1004757
488 Ga0182005_1000100
489 Ga0163161_10000061
490 Ga0163161_10013706
491 Ga0163161_10063687
492 Ga0163161_10175932
493 Ga0213876_10013716
494 Ga0209258_100032
495 Ga0209148_1000223
496 Ga0209676_1000106
497 Ga0209564_1004857
498 Ga0209050_1000174
499 Ga0207426_1000059
500 Ga0209257_1000128
501 Ga0207655_1000012
502 Ga0207707_10000742
503 Ga0207707_10011628
504 Ga0207707_10080427
505 Ga0207695_10005977
506 Ga0207695_10006385
507 Ga0207695_10062724
508 Ga0207671_10000198
509 Ga0207671_10069786
510 Ga0207649_10011090
511 Ga0207652_10002728
512 Ga0207652_10134720
513 Ga0207652_10271991
514 Ga0207687_10007205
515 Ga0207690_10112619
516 Ga0207670_10000577
517 Ga0207665_10160150
518 Ga0207665_10231901
519 Ga0207691_10000966
520 Ga0207689_10096886
521 Ga0207661_10017233
522 Ga0207661_10048970
523 Ga0207667_10060577
524 Ga0207667_10196238
525 Ga0207667_10410623
526 Ga0207640_10007048
527 Ga0207677_10000003
528 Ga0207703_10000085
529 Ga0207678_10262971
530 Ga0207702_10295393
531 Ga0207676_10000002
532 Ga0207674_10124524
533 Ga0207674_10139697
534 Ga0209281_1000276
535 Ga0209489_115417
536 Ga0209968_1000889
537 Ga0268266_10002462
538 Ga0265334_10044199
539 Ga0265318_10043084
540 Ga0307515_10282317
541 Ga0265328_10024899
542 Ga0265325_10003729
543 Ga0265331_10027598
544 Ga0265327_10000197
545 Ga0265327_10022045
546 Ga0265327_10064222
547 Ga0307408_100015004
548 Ga0265314_10017746
549 Ga0265314_10101414
550 Ga0265314_10179247
551 Ga0307405_10000007
552 Ga0307413_10000933
553 Ga0307413_10031990
554 Ga0307410_10000070
555 Ga0307410_10033819
556 Ga0307406_10000036
557 Ga0307407_10002764
558 Ga0307414_10000008
559 Ga0307414_10008289
560 Ga0307414_10024963
561 Ga0307414_10039400
562 Ga0307414_10040075
563 Ga0307414_10052865
564 Ga0307414_10150450
565 Ga0307411_10000012
566 Ga0307510_10061899
567 Ga0373950_0000003
568 Ga0316584_0100884
569 Ga0395899_0000088
570 Ga0395905_0000003
571 Ga0395905_0077441
572 Ga0436365_0784550
573 Ga0436365_1143821
574 Ga0439436_0026883
575 Ga0439447_001615
576 Ga0439466_0012224
577 Ga0439446_0027916
578 Ga0439434_0019563
579 Ga0451577_0000161
580 Ga0451577_0003932
581 Ga0451577_0016846
582 Ga0466969_0044868
583 Ga0453683_0000718
584 Ga0453684_0012324
585 Ga0453684_0125157
586 Ga0453684_0344188
587 Ga0466968_0038868
588 Ga0466959_0023668
589 Ga0451576_0012426
590 Ga0495627_001180
591 Ga0495627_003064
592 Ga0495592_0000045
593 Ga0495592_0089547
594 Ga0495662_0021760
595 Ga0495662_0032855
596 Ga0495664_0015106
597 Ga0495594_0011590
598 Ga0495607_0012594
599 Ga0495606_0094501
600 Ga0495616_0020888
601 Ga0495618_0000362
602 Ga0495628_0000028
603 Ga0495630_0009365
604 Ga0495643_0000392
605 Ga0495652_0016125
606 Ga0495652_0281772
607 Ga0495640_0020559
608 Ga0495586_0000312
609 Ga0495587_0011683
610 Ga0495645_0027361
611 Ga0495645_0079773
612 Ga0495645_0084771
613 Ga0495633_0001243
614 Ga0495667_0090352
615 Ga0495668_0000595
616 Ga0495634_0069474
617 Ga0495625_0057611
618 Ga0495599_0005059
619 Ga0495624_0010466
620 Ga0495670_0051886
621 Ga0495600_0056597
622 Ga0495581_0005163
623 Ga0495636_0000012
624 Ga0495674_0035795
625 Ga0495680_0017737
626 Ga0495686_0000542
627 Ga0495602_0060635
628 Ga0496114_0001571
629 Ga0496115_0019035
630 Ga0496116_0000004
631 Ga0496117_0042497
632 Ga0496121_0000051
633 Ga0496123_0111678
634 Ga0496124_0009014
635 Ga0496125_0000012
636 Ga0496125_0000185
637 Ga0496126_0026493
638 Ga0496126_0027497
639 Ga0496126_0049183
640 Ga0501033_0116033
641 Ga0501034_0000789
642 Ga0501034_0044790
643 Ga0501036_0047485
644 Ga0501046_0028873
645 Ga0501047_0000014
646 Ga0501047_0019130
647 Ga0501067_0000169
648 Ga0501067_0023809
649 Ga0501069_0037528
650 Ga0501070_0000154
651 Ga0501070_0119859
652 Ga0501073_0000470
653 Ga0501073_0007983
654 Ga0501073_0162634
655 Ga0501074_0043479
656 Ga0501249_000006
657 Ga0501080_0046890
658 Ga0501081_0037185
659 Ga0501266_000017
660 Ga0501269_002994
661 Ga0501280_000509
662 Ga0501035_0380239
663 Ga0501044_0143428
664 nmdc:mga08y16_112234_c1
665 nmdc:mga08x19_7824_c1
666 Ga0500644_0000032
667 Ga0500644_0005731
668 Ga0500646_0007567
669 Ga0500651_0025696
670 Ga0500651_0046193
671 Ga0500641_0000009
672 Ga0500641_0000160
673 Ga0500641_0007950
674 Ga0500569_003978
675 Ga0500594_0027783
676 Ga0500607_054900
677 Ga0500658_0000035
678 Ga0500559_0010154
679 Ga0500577_0000683
680 Ga0500616_0000008
681 Ga0500616_0001739
682 Ga0500622_0000109
683 Ga0500627_0005333
684 Ga0500633_0007440
685 Ga0500634_0074673
686 Ga0500636_0005236
687 Ga0500584_006030
688 Ga0501084_0130709
689 Ga0501082_0004782
690 Ga0501082_0014929
691 2513233158
692 2520882251
693 2644010210
694 2644373562
695 2644640254
696 2644683372
697 2738736721
698 2738769177
699 2739218303
700 2740001714
701 2740006530
702 2802652745
703 2817417059
704 2819577297
705 2821140600
706 2840678290
707 2857616185
708 2857622647
709 2881249767
710 2881360365
711 2881957621
712 2883071215
713 2890805310
714 2896086107
715 2903896469
716 2904423530
717 2904473019
718 2904560331
719 2919191669
720 2919511028
721 2919688165
722 2929154336
723 2929240518
724 2958459436
725 2958515326
726 2965320992
727 2977271155
728 8036738320
729 8054308422
730 8055422651
731 8055595501
732 8056443716

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00534

Glycos_transf_1

Glycosyl transferases group 1

211

377

0.97

PF13439

Glyco_transf_4

Glycosyltransferase Family 4

38

206

0.96

PF13692

Glyco_trans_1_4

Glycosyl transferases group 1

224

363

0.94

PF13579

Glyco_trans_4_4

Glycosyl transferase 4-like domain

39

200

0.84

PF13477

Glyco_trans_4_2

Glycosyl transferase 4-like

33

178

0.81

PF20706

GT4-conflict

Family 4 Glycosyltransferase in conflict systems

173

384

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mbo-assembly2.cif.gz_C crystal structure of the glycosyltransferase babsha bound with udp and l-malate 0.9521 2 373
2jjm-assembly1.cif.gz_B crystal structure of a family gt4 glycosyltransferase from bacillus anthracis orf ba1558. 0.952 2 370
5d00-assembly1.cif.gz_A crystal structure of bsha from b. subtilis complexed with n-acetylglucosaminyl-malate and ump 0.9512 2 370
5d01-assembly1.cif.gz_B crystal structure of bsha from b. subtilis complexed with n-acetylglucosaminyl-malate 0.9501 2 370
5d00-assembly1.cif.gz_B crystal structure of bsha from b. subtilis complexed with n-acetylglucosaminyl-malate and ump 0.9474 2 370
ID Description Score Start End Superfamily
af_Q2G255_3_172_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.971 4 174 3.40.50.2000
af_Q2G0L3_321_481_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9703 202 357 3.40.50.2000
af_Q2G0L2_318_480_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9625 195 354 3.40.50.2000
5d00A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9624 184 352 3.40.50.2000
5d00B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.96 2 174 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A2S7SSF2-F1-model_v4 N-acetyl-alpha-D-glucosaminyl L-malate synthase BshA 0.9931 1 375 GO:0016757
GO:0071793
AF-A0A2S7SSF2-F1-model_v4 N-acetyl-alpha-D-glucosaminyl L-malate synthase BshA 0.9827 1 375 GO:0016757
GO:0071793
AF-A0A3C2AM11-F1-model_v4 N-acetyl-alpha-D-glucosaminyl L-malate synthase BshA 0.9772 144 375 GO:0016757
GO:0071793
AF-A0A7C6ETM0-F1-model_v4 N-acetyl-alpha-D-glucosaminyl L-malate synthase BshA 0.9762 1 373 GO:0016757
GO:0071793
AF-A0A2S8A4P3-F1-model_v4 N-acetyl-alpha-D-glucosaminyl L-malate synthase BshA 0.9759 1 371 GO:0016757
GO:0071793

Map