F423743

General Info

Members Datasets Scaffolds Average Seq Length
365 246 730 322

Family's Representative Sequence

Representative Sequence 3300036712|Ga0316584_0049150|Ga0316584_0049150_926_1987
Length 353
Sequence MQAPPADVAKLELGGEDQPAPTRPPMPETSPPNQEALAAAAAGLTALETEIGRAVLGQRQVVRELIVALIAAGHVLLEGLPGVGKTLLVRALARAVGGRYGRIQFTPDLMPADVTGHALFDMKLEEFRIRRGPIFCNLLLGDEINRAPAKTQSAMLEAMQEQQVTIEGKAMPLEPPFLVYATQNPIEQEGTYPLPQAQLDRFLVKVFIDYPAADDEAAVVRQVTTGAAGDQLDLSRVGEVLSPTQVLALQAAATTLIIDDEVLNYAVRLVRATRDWVGIELGAGPRATIALVRAARGQALIDGRGYVLPDDVKTMAPAVLRHRIKLGADLEIEGVAPDDVLAELLASVPAPRG

Samples

Sample ID Description Type Environment
1 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
6 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
76 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
77 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
80 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
82 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
83 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
85 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
115 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
116 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
119 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
120 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
121 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
122 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
136 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
137 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
138 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
139 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
146 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
147 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
148 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
149 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
150 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
151 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
152 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
153 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
154 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
155 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
156 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
157 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
158 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
159 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
160 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
161 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
162 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
163 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
164 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
165 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
166 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
167 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
168 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
169 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
170 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
171 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
172 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
175 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
176 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
177 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
178 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
179 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
180 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
181 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
182 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
183 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
184 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
185 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
186 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
187 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
188 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
189 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
190 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
193 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
224 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
225 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
226 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
227 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
228 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
229 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
230 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
231 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
232 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
233 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
234 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
235 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
236 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
237 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
238 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
239 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
240 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
241 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
242 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
243 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
244 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
245 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
246 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.38
Nodule 0
Rhizoplane 9.86
Rhizosphere 77.81
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316584_0049150 3300036712 Bacteria 3152
2 JGI25156J39149_1000459 3300002705 Bacteria 24817
3 JGI25154J39366_1002135 3300002738 Bacteria 5531
4 JGI25157J39369_1000021 3300002741 Bacteria 163907
5 Ga0055539_1000588 3300003752 Bacteria 10143
6 Ga0055539_1000994 3300003752 Bacteria 6180
7 Ga0055533_1000033 3300003756 Bacteria 265716
8 Ga0070658_10003240 3300005327 Bacteria 13443
9 Ga0070658_10027568 3300005327 Bacteria 4556
10 Ga0070658_10154567 3300005327 Bacteria 1922
11 Ga0070676_10023215 3300005328 Bacteria 3485
12 Ga0070690_100039685 3300005330 Bacteria 2975
13 Ga0070677_10018207 3300005333 Bacteria 2527
14 Ga0068869_100088609 3300005334 Bacteria 2323
15 Ga0070660_100039293 3300005339 Bacteria 3596
16 Ga0070660_100200264 3300005339 Bacteria 1619
17 Ga0070674_100081622 3300005356 Bacteria 2311
18 Ga0070673_100032257 3300005364 Bacteria 3942
19 Ga0070688_100098029 3300005365 Bacteria 1927
20 Ga0070667_100016738 3300005367 Bacteria 6068
21 Ga0070709_10173113 3300005434 Bacteria 1510
22 Ga0070714_100010300 3300005435 Bacteria 7386
23 Ga0070714_100012161 3300005435 Bacteria 6859
24 Ga0070713_100327006 3300005436 Bacteria 1417
25 Ga0070701_10176087 3300005438 Bacteria 1249
26 Ga0070705_100075413 3300005440 Bacteria 2053
27 Ga0070700_100357345 3300005441 Bacteria 1085
28 Ga0070708_100006721 3300005445 Bacteria 9158
29 Ga0070662_100061006 3300005457 Bacteria 2752
30 Ga0068867_100010019 3300005459 Bacteria 6680
31 Ga0070706_100044502 3300005467 Bacteria 4101
32 Ga0070707_100001447 3300005468 Bacteria 23241
33 Ga0070707_100025501 3300005468 Bacteria 5608
34 Ga0070698_100506962 3300005471 Bacteria 1145
35 Ga0070699_100038399 3300005518 Bacteria 4146
36 Ga0070679_100007164 3300005530 Bacteria 10410
37 Ga0070684_100122914 3300005535 Bacteria 2336
38 Ga0070697_100018133 3300005536 Bacteria 5547
39 Ga0068853_100000321 3300005539 Bacteria 33450
40 Ga0070672_100004791 3300005543 Bacteria 8879
41 Ga0070672_100272719 3300005543 Bacteria 1429
42 Ga0070696_100004547 3300005546 Bacteria 9265
43 Ga0070696_100020422 3300005546 Bacteria 4489
44 Ga0070665_100014189 3300005548 Bacteria 8005
45 Ga0070704_100075750 3300005549 Bacteria 2459
46 Ga0068855_100169570 3300005563 Bacteria 2472
47 Ga0070664_100053868 3300005564 Bacteria 3411
48 Ga0068857_100005113 3300005577 Bacteria 11156
49 Ga0068854_100013303 3300005578 Bacteria 5397
50 Ga0068854_100202877 3300005578 Bacteria 1560
51 Ga0068856_100000887 3300005614 Bacteria 32039
52 Ga0068852_100016406 3300005616 Bacteria 5775
53 Ga0068852_100058794 3300005616 Bacteria 3332
54 Ga0068859_100076709 3300005617 Bacteria 3383
55 Ga0068866_10057259 3300005718 Bacteria 2008
56 Ga0081538_10083408 3300005981 Bacteria 1689
57 Ga0070717_10017832 3300006028 Bacteria 5533
58 Ga0075366_10013680 3300006195 Bacteria 4626
59 Ga0075370_10047691 3300006353 Bacteria 2426
60 Ga0075428_100008315 3300006844 Bacteria 11501
61 Ga0075428_100104589 3300006844 Bacteria 3087
62 Ga0075431_100019389 3300006847 Bacteria 6933
63 Ga0075431_100064854 3300006847 Bacteria 3771
64 Ga0075433_10005244 3300006852 Bacteria 10159
65 Ga0075433_10017064 3300006852 Bacteria 6003
66 Ga0075433_10021765 3300006852 Bacteria 5379
67 Ga0075433_10087046 3300006852 Bacteria 2759
68 Ga0075434_100445535 3300006871 Bacteria 1316
69 Ga0068865_100009864 3300006881 Bacteria 5932
70 Ga0097620_100076708 3300006931 Bacteria 3383
71 Ga0075435_100002574 3300007076 Bacteria 12099
72 Ga0075435_100064810 3300007076 Bacteria 2970
73 Ga0075435_100124730 3300007076 Bacteria 2152
74 Ga0075435_100144778 3300007076 Bacteria 1995
75 Ga0075435_100240339 3300007076 Bacteria 1540
76 Ga0075435_100264118 3300007076 Bacteria 1467
77 Ga0105240_10000859 3300009093 Bacteria 54758
78 Ga0111539_10003396 3300009094 Bacteria 20968
79 Ga0111539_10489802 3300009094 Bacteria 1432
80 Ga0114129_10000435 3300009147 Bacteria 49624
81 Ga0114129_10020007 3300009147 Bacteria 9527
82 Ga0114129_10103613 3300009147 Bacteria 3934
83 Ga0114129_10164430 3300009147 Bacteria 3029
84 Ga0114129_10350168 3300009147 Bacteria 1957
85 Ga0114129_10461316 3300009147 Bacteria 1665
86 Ga0114129_10901674 3300009147 Bacteria 1120
87 Ga0105243_10149402 3300009148 Bacteria 2003
88 Ga0105242_10013814 3300009176 Bacteria 6248
89 Ga0105248_10123450 3300009177 Bacteria 2921
90 Ga0105237_10296261 3300009545 Bacteria 1620
91 Ga0105238_10071954 3300009551 Bacteria 3455
92 Ga0105239_10024610 3300010375 Bacteria 6632
93 Ga0105239_10062145 3300010375 Bacteria 4099
94 Ga0105239_10128767 3300010375 Bacteria 2814
95 Ga0105246_10041642 3300011119 Bacteria 3106
96 Ga0157371_10018112 3300013102 Bacteria 5214
97 Ga0157369_10018857 3300013105 Bacteria 7731
98 Ga0157378_10222614 3300013297 Bacteria 1794
99 Ga0163162_10434065 3300013306 Bacteria 1446
100 Ga0157372_10005220 3300013307 Bacteria 13806
101 Ga0163163_10018201 3300014325 Bacteria 6570
102 Ga0157379_10063964 3300014968 Bacteria 3288
103 Ga0206353_11418429 3300020082 Bacteria 1637
104 Ga0213872_10008160 3300021361 Bacteria 5081
105 Ga0213875_10025720 3300021388 Bacteria 2803
106 Ga0209674_100064 3300025226 Bacteria 265769
107 Ga0209563_100126 3300025230 Bacteria 113122
108 Ga0207427_100197 3300025231 Bacteria 57629
109 Ga0209258_100905 3300025242 Bacteria 15234
110 Ga0209646_1000060 3300025246 Bacteria 256386
111 Ga0209026_1000049 3300025250 Bacteria 255273
112 Ga0209677_100411 3300025253 Bacteria 25661
113 Ga0209677_100792 3300025253 Bacteria 15906
114 Ga0209677_101222 3300025253 Bacteria 11674
115 Ga0209759_1000069 3300025256 Bacteria 182437
116 Ga0209759_1001428 3300025256 Bacteria 13546
117 Ga0209051_1040790 3300025303 Bacteria 1659
118 Ga0207642_10067065 3300025899 Bacteria 1692
119 Ga0207645_10053163 3300025907 Bacteria 2588
120 Ga0207705_10008643 3300025909 Bacteria 7422
121 Ga0207705_10040272 3300025909 Bacteria 3351
122 Ga0207695_10001410 3300025913 Bacteria 40494
123 Ga0207695_10045326 3300025913 Bacteria 4669
124 Ga0207671_10135410 3300025914 Bacteria 1894
125 Ga0207652_10213268 3300025921 Bacteria 1739
126 Ga0207646_10001726 3300025922 Bacteria 26574
127 Ga0207646_10070097 3300025922 Bacteria 3131
128 Ga0207646_10488699 3300025922 Bacteria 1110
129 Ga0207694_10053878 3300025924 Bacteria 3120
130 Ga0207700_10262770 3300025928 Bacteria 1479
131 Ga0207664_10007264 3300025929 Bacteria 7682
132 Ga0207706_10175449 3300025933 Bacteria 1883
133 Ga0207686_10184933 3300025934 Bacteria 1480
134 Ga0207669_10088348 3300025937 Bacteria 2010
135 Ga0207669_10285533 3300025937 Bacteria 1247
136 Ga0207711_10079110 3300025941 Bacteria 2869
137 Ga0207689_10014953 3300025942 Bacteria 6585
138 Ga0207667_10001779 3300025949 Bacteria 27124
139 Ga0207651_10021780 3300025960 Bacteria 3903
140 Ga0207668_10015318 3300025972 Bacteria 4761
141 Ga0207658_10064796 3300025986 Bacteria 2742
142 Ga0207703_10128257 3300026035 Bacteria 2187
143 Ga0207639_10000322 3300026041 Bacteria 33462
144 Ga0207639_10047897 3300026041 Bacteria 3233
145 Ga0207708_10107030 3300026075 Bacteria 2168
146 Ga0207702_10002045 3300026078 Bacteria 19536
147 Ga0207641_10310066 3300026088 Bacteria 1493
148 Ga0207648_10013245 3300026089 Bacteria 7683
149 Ga0207675_100349836 3300026118 Bacteria 1448
150 Ga0207698_10040107 3300026142 Bacteria 3475
151 Ga0207698_10204637 3300026142 Bacteria 1771
152 Ga0268264_10044256 3300028381 Bacteria 3692
153 Ga0268264_10649384 3300028381 Bacteria 1044
154 Ga0265336_10000123 3300028666 Bacteria 57956
155 Ga0265324_10000932 3300029957 Bacteria 18361
156 Ga0307509_10133088 3300031507 Bacteria 2438
157 Ga0307509_10155475 3300031507 Bacteria 2194
158 Ga0307408_100064077 3300031548 Bacteria 2691
159 Ga0316575_10013955 3300031665 Bacteria 3010
160 Ga0316579_10009168 3300031691 Bacteria 4154
161 Ga0316579_10011137 3300031691 Bacteria 3817
162 Ga0316579_10036991 3300031691 Bacteria 2253
163 Ga0316576_10000969 3300031727 Bacteria 14721
164 Ga0316576_10010468 3300031727 Bacteria 6027
165 Ga0316576_10019760 3300031727 Bacteria 4620
166 Ga0316576_10101332 3300031727 Bacteria 2152
167 Ga0316576_10117989 3300031727 Bacteria 1991
168 Ga0316578_10000504 3300031728 Bacteria 13230
169 Ga0316578_10004350 3300031728 Bacteria 6673
170 Ga0316578_10009079 3300031728 Bacteria 5094
171 Ga0316578_10029223 3300031728 Bacteria 3127
172 Ga0316578_10032769 3300031728 Bacteria 2971
173 Ga0316578_10043502 3300031728 Bacteria 2609
174 Ga0316578_10143776 3300031728 Bacteria 1436
175 Ga0307516_10061998 3300031730 Bacteria 3625
176 Ga0307405_10039514 3300031731 Bacteria 2852
177 Ga0307405_10079408 3300031731 Bacteria 2139
178 Ga0316577_10014398 3300031733 Bacteria 4341
179 Ga0316577_10095612 3300031733 Bacteria 1664
180 Ga0307413_10077656 3300031824 Bacteria 2115
181 Ga0307410_10222958 3300031852 Bacteria 1451
182 Ga0307406_10011858 3300031901 Bacteria 4953
183 Ga0307406_10104252 3300031901 Bacteria 1938
184 Ga0307406_10150836 3300031901 Bacteria 1658
185 Ga0307407_10034368 3300031903 Bacteria 2775
186 Ga0307407_10059676 3300031903 Bacteria 2222
187 Ga0307407_10076921 3300031903 Bacteria 2005
188 Ga0307407_10112451 3300031903 Bacteria 1712
189 Ga0307412_10263989 3300031911 Bacteria 1344
190 Ga0307409_100053536 3300031995 Bacteria 3101
191 Ga0307416_100265963 3300032002 Bacteria 1680
192 Ga0307414_10013233 3300032004 Bacteria 4907
193 Ga0307414_10094698 3300032004 Bacteria 2230
194 Ga0307414_10269130 3300032004 Bacteria 1426
195 Ga0307411_10012499 3300032005 Bacteria 4636
196 Ga0307411_10019776 3300032005 Bacteria 3898
197 Ga0307415_100048428 3300032126 Bacteria 2868
198 Ga0307415_100342835 3300032126 Bacteria 1255
199 Ga0307415_100404672 3300032126 Bacteria 1166
200 Ga0316585_10011328 3300032137 Bacteria 2629
201 Ga0316585_10032866 3300032137 Bacteria 1635
202 Ga0316580_10000920 3300032139 Bacteria 7278
203 Ga0316580_10014011 3300032139 Bacteria 2445
204 Ga0373959_0007841 3300034820 Bacteria 1802
205 Ga0373934_0058990 3300035086 Bacteria 1527
206 Ga0316574_0001444 3300035398 Bacteria 11280
207 Ga0316574_0002059 3300035398 Bacteria 9941
208 Ga0373931_0003056 3300035691 Bacteria 7481
209 Ga0373931_0059165 3300035691 Bacteria 2060
210 Ga0373931_0084979 3300035691 Bacteria 1753
211 Ga0316582_0033880 3300036647 Bacteria 3141
212 Ga0316582_0147284 3300036647 Bacteria 1590
213 Ga0316584_0004099 3300036712 Bacteria 9608
214 Ga0316584_0018166 3300036712 Bacteria 5071
215 Ga0316584_0041042 3300036712 Bacteria 3449
216 Ga0316584_0134913 3300036712 Bacteria 1843
217 Ga0373925_0181367 3300037068 Bacteria 1667
218 Ga0395898_0149279 3300037466 Bacteria 2237
219 Ga0395905_0038059 3300037471 Bacteria 4513
220 Ga0316581_0045428 3300037588 Bacteria 1341
221 Ga0436364_0903801 3300037853 Bacteria 9680
222 Ga0400484_19561 3300038725 Bacteria 6120
223 Ga0400490_02805 3300038726 Bacteria 6901
224 Ga0400490_06023 3300038726 Bacteria 36740
225 Ga0400490_52347 3300038726 Bacteria 19647
226 Ga0400491_09219 3300038727 Bacteria 2544
227 Ga0400485_05324 3300038735 Bacteria 2290
228 Ga0400485_08298 3300038735 Bacteria 1841
229 Ga0400488_41083 3300038741 Bacteria 13543
230 Ga0400488_56971 3300038741 Bacteria 6826
231 Ga0400486_17763 3300038742 Bacteria 12835
232 Ga0242420_002863 3300038996 Bacteria 2502
233 Ga0400483_015569 3300039062 Bacteria 4586
234 Ga0400483_050988 3300039062 Bacteria 17885
235 Ga0400483_064034 3300039062 Bacteria 2444
236 Ga0400483_184269 3300039062 Bacteria 13757
237 Ga0400489_08233 3300039093 Bacteria 5023
238 Ga0400487_45086 3300039110 Bacteria 5437
239 Ga0400487_62361 3300039110 Bacteria 7426
240 Ga0436361_0147149 3300039447 Bacteria 5290
241 Ga0439446_0084296 3300042156 Bacteria 988
242 Ga0451577_0121747 3300042876 Bacteria 2337
243 Ga0466969_0054637 3300044656 Bacteria 1955
244 Ga0466972_0006078 3300044658 Bacteria 6064
245 Ga0453683_0013564 3300044673 Bacteria 5314
246 Ga0466965_0015929 3300044683 Bacteria 3571
247 Ga0466966_0002819 3300044684 Bacteria 11437
248 Ga0466961_0037077 3300044693 Bacteria 3128
249 Ga0466963_0079767 3300044694 Bacteria 2215
250 Ga0466963_0173656 3300044694 Bacteria 1503
251 Ga0466964_0001494 3300044706 Bacteria 8019
252 Ga0453684_0002361 3300044712 Bacteria 46138
253 Ga0453684_0007022 3300044712 Bacteria 21037
254 Ga0453684_0033440 3300044712 Bacteria 7169
255 Ga0466971_0028787 3300044719 Bacteria 2484
256 Ga0466968_0008438 3300044735 Bacteria 3946
257 Ga0466957_0003346 3300044842 Bacteria 8788
258 Ga0466960_0004992 3300044901 Bacteria 5230
259 Ga0451576_0000336 3300045051 Bacteria 113581
260 Ga0451576_0001014 3300045051 Bacteria 51909
261 Ga0466958_0238198 3300045836 Bacteria 1162
262 Ga0495641_0018355 3300046461 Bacteria 3612
263 Ga0495650_0011619 3300046471 Bacteria 4807
264 Ga0495580_0044732 3300046472 Bacteria 3148
265 Ga0495664_0200565 3300046477 Bacteria 1209
266 Ga0495583_0000046 3300046506 Bacteria 218059
267 Ga0495606_0001300 3300046507 Bacteria 34419
268 Ga0495608_0323945 3300046511 Bacteria 952
269 Ga0495656_0070650 3300046615 Bacteria 1550
270 Ga0495625_0016534 3300046660 Bacteria 5802
271 Ga0495588_0082191 3300046674 Bacteria 1682
272 Ga0495623_0033342 3300046679 Bacteria 3305
273 Ga0495669_0050257 3300046684 Bacteria 1869
274 Ga0495613_0021817 3300046689 Bacteria 4773
275 Ga0495649_0000638 3300046694 Bacteria 28526
276 Ga0495589_0018543 3300046794 Bacteria 3567
277 Ga0495581_0038327 3300047315 Bacteria 2774
278 Ga0495604_0145519 3300047317 Bacteria 1689
279 Ga0495677_0134008 3300047445 Bacteria 949
280 Ga0495686_0004315 3300047472 Bacteria 11761
281 Ga0496100_0192059 3300048903 Bacteria 1483
282 Ga0496100_0229200 3300048903 Bacteria 1366
283 Ga0496101_0130836 3300048904 Bacteria 1906
284 Ga0496102_0032258 3300048905 Bacteria 4706
285 Ga0496102_0043527 3300048905 Bacteria 4072
286 Ga0496102_0102242 3300048905 Bacteria 2664
287 Ga0496103_0035191 3300048906 Bacteria 3066
288 Ga0496104_0046836 3300048907 Bacteria 4074
289 Ga0496105_0165599 3300048908 Bacteria 1814
290 Ga0496105_0283655 3300048908 Bacteria 1335
291 Ga0496105_0540038 3300048908 Bacteria 911
292 Ga0496106_0055430 3300048909 Bacteria 2996
293 Ga0496107_0068760 3300048910 Bacteria 2570
294 Ga0496108_0000706 3300048911 Bacteria 25921
295 Ga0496108_0002744 3300048911 Bacteria 14087
296 Ga0496108_0005867 3300048911 Bacteria 9956
297 Ga0496108_0092648 3300048911 Bacteria 2570
298 Ga0496108_0378427 3300048911 Bacteria 1236
299 Ga0496109_0004021 3300048912 Bacteria 12278
300 Ga0496109_0013289 3300048912 Bacteria 7133
301 Ga0496109_0031134 3300048912 Bacteria 4785
302 Ga0496109_0138549 3300048912 Bacteria 2275
303 Ga0496110_0006014 3300048913 Bacteria 9556
304 Ga0496110_0020183 3300048913 Bacteria 5623
305 Ga0496110_0025690 3300048913 Bacteria 5036
306 Ga0496110_0042109 3300048913 Bacteria 3986
307 Ga0496110_0106313 3300048913 Bacteria 2518
308 Ga0496110_0109311 3300048913 Bacteria 2483
309 Ga0496111_0104066 3300048914 Bacteria 2088
310 Ga0496111_0396922 3300048914 Bacteria 1019
311 Ga0496112_0002310 3300048915 Bacteria 15288
312 Ga0496112_0002874 3300048915 Bacteria 14003
313 Ga0496112_0280054 3300048915 Bacteria 1615
314 Ga0496113_0009838 3300048916 Bacteria 6294
315 Ga0496114_0577712 3300048917 Bacteria 992
316 Ga0496115_0150491 3300048918 Bacteria 1922
317 Ga0501031_0074334 3300049568 Bacteria 2213
318 Ga0501033_0068003 3300049570 Bacteria 2620
319 Ga0501034_0104422 3300049571 Bacteria 2827
320 Ga0501036_0117969 3300049572 Bacteria 2241
321 Ga0501037_0040981 3300049573 Bacteria 3407
322 Ga0501038_0052538 3300049574 Bacteria 3513
323 Ga0501039_0043668 3300049575 Bacteria 3462
324 Ga0501040_0114625 3300049576 Bacteria 1887
325 Ga0501041_0008178 3300049577 Bacteria 6156
326 Ga0501043_0128178 3300049579 Bacteria 1989
327 Ga0501043_0178451 3300049579 Bacteria 1655
328 Ga0501046_0058433 3300049580 Bacteria 3023
329 Ga0501047_0167118 3300049581 Bacteria 2070
330 Ga0501048_0014762 3300049582 Bacteria 5780
331 Ga0501048_0164190 3300049582 Bacteria 1572
332 Ga0501068_0086355 3300049584 Bacteria 1931
333 Ga0501069_0162312 3300049585 Bacteria 1287
334 Ga0501071_0332174 3300049587 Bacteria 1155
335 Ga0501072_0007533 3300049588 Bacteria 8261
336 Ga0501074_0051713 3300049590 Bacteria 2965
337 Ga0501075_0009458 3300049591 Bacteria 6819
338 Ga0501076_0009844 3300049592 Bacteria 7066
339 Ga0501077_0005573 3300049593 Bacteria 7665
340 Ga0501079_0068637 3300049741 Bacteria 2736
341 Ga0501080_0012370 3300049742 Bacteria 7822
342 Ga0501081_0004023 3300049743 Bacteria 9429
343 Ga0501045_0017543 3300049824 Bacteria 5083
344 nmdc:mga0k408_39104_c1 3300050493 Bacteria 2724
345 nmdc:mga07m45_7860_c1 3300050496 Bacteria 3829
346 nmdc:mga05p37_14681_c1 3300050507 Bacteria 9410
347 nmdc:mga05p37_454698_c1 3300050507 Bacteria 1481
348 nmdc:mga05p37_45859_c2 3300050507 Bacteria 3928
349 nmdc:mga05p37_527353_c1 3300050507 Bacteria 1349
350 nmdc:mga0qj67_77274_c1 3300050509 Bacteria 2663
351 nmdc:mga06r32_134448_c1 3300050510 Bacteria 2447
352 nmdc:mga06r32_213936_c1 3300050510 Bacteria 1915
353 nmdc:mga06r32_26455_c1 3300050510 Bacteria 5409
354 nmdc:mga08y16_5894_c1 3300050511 Bacteria 12842
355 nmdc:mga0n895_320601_c1 3300050512 Bacteria 1570
356 nmdc:mga0rr50_218689_c1 3300050513 Bacteria 1572
357 nmdc:mga0rr50_67246_c1 3300050513 Bacteria 2721
358 nmdc:mga0rr50_79712_c1 3300050513 Bacteria 2522
359 nmdc:mga0a205_148879_c1 3300050515 Bacteria 2241
360 nmdc:mga0a205_20956_c1 3300050515 Bacteria 6177
361 nmdc:mga0a205_30800_c1 3300050515 Bacteria 5138
362 nmdc:mga0a205_3857_c1 3300050515 Bacteria 8471
363 Ga0500635_0000005 3300053080 Bacteria 187821
364 Ga0501084_0004475 3300054114 Bacteria 11413
365 Ga0501082_0061595 3300060353 Bacteria 3230
366 Ga0316584_0049150
367 JGI25156J39149_1000459
368 JGI25154J39366_1002135
369 JGI25157J39369_1000021
370 Ga0055539_1000588
371 Ga0055539_1000994
372 Ga0055533_1000033
373 Ga0070658_10003240
374 Ga0070658_10027568
375 Ga0070658_10154567
376 Ga0070676_10023215
377 Ga0070690_100039685
378 Ga0070677_10018207
379 Ga0068869_100088609
380 Ga0070660_100039293
381 Ga0070660_100200264
382 Ga0070674_100081622
383 Ga0070673_100032257
384 Ga0070688_100098029
385 Ga0070667_100016738
386 Ga0070709_10173113
387 Ga0070714_100010300
388 Ga0070714_100012161
389 Ga0070713_100327006
390 Ga0070701_10176087
391 Ga0070705_100075413
392 Ga0070700_100357345
393 Ga0070708_100006721
394 Ga0070662_100061006
395 Ga0068867_100010019
396 Ga0070706_100044502
397 Ga0070707_100001447
398 Ga0070707_100025501
399 Ga0070698_100506962
400 Ga0070699_100038399
401 Ga0070679_100007164
402 Ga0070684_100122914
403 Ga0070697_100018133
404 Ga0068853_100000321
405 Ga0070672_100004791
406 Ga0070672_100272719
407 Ga0070696_100004547
408 Ga0070696_100020422
409 Ga0070665_100014189
410 Ga0070704_100075750
411 Ga0068855_100169570
412 Ga0070664_100053868
413 Ga0068857_100005113
414 Ga0068854_100013303
415 Ga0068854_100202877
416 Ga0068856_100000887
417 Ga0068852_100016406
418 Ga0068852_100058794
419 Ga0068859_100076709
420 Ga0068866_10057259
421 Ga0081538_10083408
422 Ga0070717_10017832
423 Ga0075366_10013680
424 Ga0075370_10047691
425 Ga0075428_100008315
426 Ga0075428_100104589
427 Ga0075431_100019389
428 Ga0075431_100064854
429 Ga0075433_10005244
430 Ga0075433_10017064
431 Ga0075433_10021765
432 Ga0075433_10087046
433 Ga0075434_100445535
434 Ga0068865_100009864
435 Ga0097620_100076708
436 Ga0075435_100002574
437 Ga0075435_100064810
438 Ga0075435_100124730
439 Ga0075435_100144778
440 Ga0075435_100240339
441 Ga0075435_100264118
442 Ga0105240_10000859
443 Ga0111539_10003396
444 Ga0111539_10489802
445 Ga0114129_10000435
446 Ga0114129_10020007
447 Ga0114129_10103613
448 Ga0114129_10164430
449 Ga0114129_10350168
450 Ga0114129_10461316
451 Ga0114129_10901674
452 Ga0105243_10149402
453 Ga0105242_10013814
454 Ga0105248_10123450
455 Ga0105237_10296261
456 Ga0105238_10071954
457 Ga0105239_10024610
458 Ga0105239_10062145
459 Ga0105239_10128767
460 Ga0105246_10041642
461 Ga0157371_10018112
462 Ga0157369_10018857
463 Ga0157378_10222614
464 Ga0163162_10434065
465 Ga0157372_10005220
466 Ga0163163_10018201
467 Ga0157379_10063964
468 Ga0206353_11418429
469 Ga0213872_10008160
470 Ga0213875_10025720
471 Ga0209674_100064
472 Ga0209563_100126
473 Ga0207427_100197
474 Ga0209258_100905
475 Ga0209646_1000060
476 Ga0209026_1000049
477 Ga0209677_100411
478 Ga0209677_100792
479 Ga0209677_101222
480 Ga0209759_1000069
481 Ga0209759_1001428
482 Ga0209051_1040790
483 Ga0207642_10067065
484 Ga0207645_10053163
485 Ga0207705_10008643
486 Ga0207705_10040272
487 Ga0207695_10001410
488 Ga0207695_10045326
489 Ga0207671_10135410
490 Ga0207652_10213268
491 Ga0207646_10001726
492 Ga0207646_10070097
493 Ga0207646_10488699
494 Ga0207694_10053878
495 Ga0207700_10262770
496 Ga0207664_10007264
497 Ga0207706_10175449
498 Ga0207686_10184933
499 Ga0207669_10088348
500 Ga0207669_10285533
501 Ga0207711_10079110
502 Ga0207689_10014953
503 Ga0207667_10001779
504 Ga0207651_10021780
505 Ga0207668_10015318
506 Ga0207658_10064796
507 Ga0207703_10128257
508 Ga0207639_10000322
509 Ga0207639_10047897
510 Ga0207708_10107030
511 Ga0207702_10002045
512 Ga0207641_10310066
513 Ga0207648_10013245
514 Ga0207675_100349836
515 Ga0207698_10040107
516 Ga0207698_10204637
517 Ga0268264_10044256
518 Ga0268264_10649384
519 Ga0265336_10000123
520 Ga0265324_10000932
521 Ga0307509_10133088
522 Ga0307509_10155475
523 Ga0307408_100064077
524 Ga0316575_10013955
525 Ga0316579_10009168
526 Ga0316579_10011137
527 Ga0316579_10036991
528 Ga0316576_10000969
529 Ga0316576_10010468
530 Ga0316576_10019760
531 Ga0316576_10101332
532 Ga0316576_10117989
533 Ga0316578_10000504
534 Ga0316578_10004350
535 Ga0316578_10009079
536 Ga0316578_10029223
537 Ga0316578_10032769
538 Ga0316578_10043502
539 Ga0316578_10143776
540 Ga0307516_10061998
541 Ga0307405_10039514
542 Ga0307405_10079408
543 Ga0316577_10014398
544 Ga0316577_10095612
545 Ga0307413_10077656
546 Ga0307410_10222958
547 Ga0307406_10011858
548 Ga0307406_10104252
549 Ga0307406_10150836
550 Ga0307407_10034368
551 Ga0307407_10059676
552 Ga0307407_10076921
553 Ga0307407_10112451
554 Ga0307412_10263989
555 Ga0307409_100053536
556 Ga0307416_100265963
557 Ga0307414_10013233
558 Ga0307414_10094698
559 Ga0307414_10269130
560 Ga0307411_10012499
561 Ga0307411_10019776
562 Ga0307415_100048428
563 Ga0307415_100342835
564 Ga0307415_100404672
565 Ga0316585_10011328
566 Ga0316585_10032866
567 Ga0316580_10000920
568 Ga0316580_10014011
569 Ga0373959_0007841
570 Ga0373934_0058990
571 Ga0316574_0001444
572 Ga0316574_0002059
573 Ga0373931_0003056
574 Ga0373931_0059165
575 Ga0373931_0084979
576 Ga0316582_0033880
577 Ga0316582_0147284
578 Ga0316584_0004099
579 Ga0316584_0018166
580 Ga0316584_0041042
581 Ga0316584_0134913
582 Ga0373925_0181367
583 Ga0395898_0149279
584 Ga0395905_0038059
585 Ga0316581_0045428
586 Ga0436364_0903801
587 Ga0400484_19561
588 Ga0400490_02805
589 Ga0400490_06023
590 Ga0400490_52347
591 Ga0400491_09219
592 Ga0400485_05324
593 Ga0400485_08298
594 Ga0400488_41083
595 Ga0400488_56971
596 Ga0400486_17763
597 Ga0242420_002863
598 Ga0400483_015569
599 Ga0400483_050988
600 Ga0400483_064034
601 Ga0400483_184269
602 Ga0400489_08233
603 Ga0400487_45086
604 Ga0400487_62361
605 Ga0436361_0147149
606 Ga0439446_0084296
607 Ga0451577_0121747
608 Ga0466969_0054637
609 Ga0466972_0006078
610 Ga0453683_0013564
611 Ga0466965_0015929
612 Ga0466966_0002819
613 Ga0466961_0037077
614 Ga0466963_0079767
615 Ga0466963_0173656
616 Ga0466964_0001494
617 Ga0453684_0002361
618 Ga0453684_0007022
619 Ga0453684_0033440
620 Ga0466971_0028787
621 Ga0466968_0008438
622 Ga0466957_0003346
623 Ga0466960_0004992
624 Ga0451576_0000336
625 Ga0451576_0001014
626 Ga0466958_0238198
627 Ga0495641_0018355
628 Ga0495650_0011619
629 Ga0495580_0044732
630 Ga0495664_0200565
631 Ga0495583_0000046
632 Ga0495606_0001300
633 Ga0495608_0323945
634 Ga0495656_0070650
635 Ga0495625_0016534
636 Ga0495588_0082191
637 Ga0495623_0033342
638 Ga0495669_0050257
639 Ga0495613_0021817
640 Ga0495649_0000638
641 Ga0495589_0018543
642 Ga0495581_0038327
643 Ga0495604_0145519
644 Ga0495677_0134008
645 Ga0495686_0004315
646 Ga0496100_0192059
647 Ga0496100_0229200
648 Ga0496101_0130836
649 Ga0496102_0032258
650 Ga0496102_0043527
651 Ga0496102_0102242
652 Ga0496103_0035191
653 Ga0496104_0046836
654 Ga0496105_0165599
655 Ga0496105_0283655
656 Ga0496105_0540038
657 Ga0496106_0055430
658 Ga0496107_0068760
659 Ga0496108_0000706
660 Ga0496108_0002744
661 Ga0496108_0005867
662 Ga0496108_0092648
663 Ga0496108_0378427
664 Ga0496109_0004021
665 Ga0496109_0013289
666 Ga0496109_0031134
667 Ga0496109_0138549
668 Ga0496110_0006014
669 Ga0496110_0020183
670 Ga0496110_0025690
671 Ga0496110_0042109
672 Ga0496110_0106313
673 Ga0496110_0109311
674 Ga0496111_0104066
675 Ga0496111_0396922
676 Ga0496112_0002310
677 Ga0496112_0002874
678 Ga0496112_0280054
679 Ga0496113_0009838
680 Ga0496114_0577712
681 Ga0496115_0150491
682 Ga0501031_0074334
683 Ga0501033_0068003
684 Ga0501034_0104422
685 Ga0501036_0117969
686 Ga0501037_0040981
687 Ga0501038_0052538
688 Ga0501039_0043668
689 Ga0501040_0114625
690 Ga0501041_0008178
691 Ga0501043_0128178
692 Ga0501043_0178451
693 Ga0501046_0058433
694 Ga0501047_0167118
695 Ga0501048_0014762
696 Ga0501048_0164190
697 Ga0501068_0086355
698 Ga0501069_0162312
699 Ga0501071_0332174
700 Ga0501072_0007533
701 Ga0501074_0051713
702 Ga0501075_0009458
703 Ga0501076_0009844
704 Ga0501077_0005573
705 Ga0501079_0068637
706 Ga0501080_0012370
707 Ga0501081_0004023
708 Ga0501045_0017543
709 nmdc:mga0k408_39104_c1
710 nmdc:mga07m45_7860_c1
711 nmdc:mga05p37_14681_c1
712 nmdc:mga05p37_454698_c1
713 nmdc:mga05p37_45859_c2
714 nmdc:mga05p37_527353_c1
715 nmdc:mga0qj67_77274_c1
716 nmdc:mga06r32_134448_c1
717 nmdc:mga06r32_213936_c1
718 nmdc:mga06r32_26455_c1
719 nmdc:mga08y16_5894_c1
720 nmdc:mga0n895_320601_c1
721 nmdc:mga0rr50_218689_c1
722 nmdc:mga0rr50_67246_c1
723 nmdc:mga0rr50_79712_c1
724 nmdc:mga0a205_148879_c1
725 nmdc:mga0a205_20956_c1
726 nmdc:mga0a205_30800_c1
727 nmdc:mga0a205_3857_c1
728 Ga0500635_0000005
729 Ga0501084_0004475
730 Ga0501082_0061595

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07726

AAA_3

ATPase family associated with various cellular activities (AAA)

74

204

0.99

PF17863

AAA_lid_2

AAA lid domain

271

344

0.94

PF07728

AAA_5

AAA domain (dynein-related subfamily)

74

202

0.85

PF20030

bpMoxR

MoxR domain in the MoxR-vWA-beta-propeller ternary systems

42

251

0.83

PF00004

AAA

ATPase family associated with various cellular activities (AAA)

75

210

0.64

Structural Annotation

Top 5 Hits

ID Description Score Start End
2r44-assembly1.cif.gz_A crystal structure of a putative atpase (chu_0153) from cytophaga hutchinsonii atcc 33406 at 2.00 a resolution 0.8966 6 327
2r44-assembly1.cif.gz_A crystal structure of a putative atpase (chu_0153) from cytophaga hutchinsonii atcc 33406 at 2.00 a resolution 0.8782 6 327
3nbx-assembly1.cif.gz_X crystal structure of e. coli rava (regulatory atpase variant a) in complex with adp 0.7853 8 319
4upb-assembly1.cif.gz_E electron cryo-microscopy of the complex formed between the hexameric atpase rava and the decameric inducible decarboxylase ldci 0.7797 8 319
6q7m-assembly1.cif.gz_Z spiral structure of e. coli rava in the rava-ldci cage-like complex 0.7765 8 319
ID Description Score Start End Superfamily
af_I6YGX9_248_354_1.10.8.80 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Magnesium chelatase subunit I, C-Terminal domain 0.9794 219 323 1.10.8.80
af_O53314_205_312_1.10.8.80 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Magnesium chelatase subunit I, C-Terminal domain 0.9714 226 322 1.10.8.80
af_Q79FN7_233_349_1.10.8.80 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Magnesium chelatase subunit I, C-Terminal domain 0.9597 216 323 1.10.8.80
af_Q79FN7_37_232_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9578 13 200 3.40.50.300
af_I6YGX9_248_354_1.10.8.80 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Magnesium chelatase subunit I, C-Terminal domain 0.9527 219 323 1.10.8.80
ID Description Score Start End GO Terms
AF-A0A840MJR8-F1-model_v4 MoxR-like ATPase (EC 3.6.3.-) 0.9853 5 328 GO:0005524
GO:0016887
AF-A0A1V5NTA5-F1-model_v4 ChlI/MoxR AAA lid domain-containing protein 0.9824 239 327
AF-A0A3M0WR89-F1-model_v4 MoxR family ATPase 0.9823 219 326
AF-A0A3D4QUL6-F1-model_v4 Magnesium chelatase 0.9817 232 327
AF-A0A660ZG47-F1-model_v4 AAA family ATPase 0.9804 13 190 GO:0005524
GO:0016887

Map