F423765

General Info

Members Datasets Scaffolds Average Seq Length
365 202 730 239

Family's Representative Sequence

Representative Sequence 3300042010|Ga0439452_000037|Ga0439452_000037_96511_97350
Length 279
Sequence MSWRFIYAVWHLRFKTCIYDCRVISPHRNLEQTSMRVHFIVHESFEAPGAYESWAQQRGYQVSHSRLYAGDALPATAEAFDLLIIMGGPQDPDTTQAECPHFDARAEQALIAAAIAGGKAVIGICLGSQLIGEALGAAFAHSPEKEIGKFPITLTTAGKNHPLFAHFPETLAVGHWHNDMPGLTADAQVLAFSEGCPRQIVAYSDRVFGFQCHMELTPEVVEQLIAHSEADLSRAAQFRFVETAEALRAHDYREMNDILCQFLDKLTAYYQDATQALRH

Samples

Sample ID Description Type Environment
1 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
19 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
20 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
21 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
22 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
23 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
24 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
25 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
26 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
27 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
28 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
29 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
30 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
33 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
34 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
35 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
38 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
39 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
40 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
41 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
42 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
43 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
44 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
45 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
46 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
57 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
60 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
61 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
62 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
63 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
64 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
65 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
66 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
67 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
68 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
69 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
70 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
71 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
72 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
73 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
74 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
75 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
76 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
77 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
78 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
79 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
80 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
81 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
82 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
83 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
84 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
85 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
86 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
87 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
88 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
89 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
90 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
91 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
92 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
93 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
94 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
95 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
96 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
97 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
98 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
99 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
100 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
101 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
102 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
106 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
107 2511231011 Pseudomonas sp. GM30 Isolate Nodule
108 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
109 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
110 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
111 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
112 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
113 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
114 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
115 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
116 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
117 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
118 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
119 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
120 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
121 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
122 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
123 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
124 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
125 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
126 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
127 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
128 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
129 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
130 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
131 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
132 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
133 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
134 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
135 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
136 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
137 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
138 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
139 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
140 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
141 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
142 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
143 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
144 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
145 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
146 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
147 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
148 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
149 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
150 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
151 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
152 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
153 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
154 2636415599 Klebsiella variicola DX120E Isolate Unclassified
155 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
156 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
157 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
158 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
159 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
160 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
161 2751185917 Enterobacter sp. HK169 Isolate Unclassified
162 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
163 2775507074 Klebsiella sp. D5A Isolate Unclassified
164 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
165 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
166 2821118458 Enterobacter asburiae 609 Isolate Unclassified
167 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
168 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
169 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
170 2847085930 Erwinia persicina B64 Isolate Bulb
171 2865014394 Pantoea sp. R-71966 Isolate Unclassified
172 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
173 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
174 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
175 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
176 2916178963 Pseudoalteromonas rhizosphaerae RA15 Isolate Rhizosphere
177 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
178 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
179 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
180 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
181 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
182 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
183 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
184 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
185 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
186 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
187 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
188 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
189 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
190 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
191 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
192 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
193 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
194 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
195 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
196 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
197 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
198 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
199 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
200 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
201 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
202 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 73.7
Metatranscriptomes 0
Isolates 26.3

Biome Distribution

Category Percentage (%)
Aerial Root 0.55
Bulb 0.27
Endosphere 6.3
Nodule 2.74
Rhizoplane 12.33
Rhizosphere 45.75
Stem 0
Stem Tuber 0
Unclassified 1.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439452_000037 3300042010 Bacteria 150659
2 SwRhRL2b_contig_45605 2162886007 Bacteria 4788
3 JGI25152J39213_1004754 3300002773 Bacteria 4180
4 rootH2_10008161 3300003320 Bacteria 23559
5 Ga0055526_1000827 3300003771 Bacteria 23107
6 Ga0055537_1000035 3300003773 Bacteria 96274
7 Ga0055537_1000111 3300003773 Bacteria 61884
8 Ga0055524_1026068 3300003775 Bacteria 1817
9 Ga0055534_1000268 3300003784 Bacteria 35791
10 Ga0055528_1000178 3300003790 Bacteria 53709
11 Ga0055531_10000139 3300003794 Bacteria 82993
12 Ga0058692_1000001 3300003856 Bacteria 834230
13 Ga0058692_1000728 3300003856 Bacteria 13378
14 Ga0058692_1001769 3300003856 Bacteria 7653
15 Ga0058692_1003838 3300003856 Bacteria 4567
16 Ga0058692_1006117 3300003856 Bacteria 3342
17 Ga0065714_10065231 3300005288 Bacteria 11549
18 Ga0065714_10181164 3300005288 Bacteria 962
19 Ga0065704_10003561 3300005289 Bacteria 9011
20 Ga0065704_10003739 3300005289 Bacteria 4988
21 Ga0065704_10080398 3300005289 Bacteria 3954
22 Ga0070668_100024312 3300005347 Bacteria 4588
23 Ga0070665_100108306 3300005548 Bacteria 2781
24 Ga0070665_100837026 3300005548 Bacteria 933
25 Ga0068855_100001624 3300005563 Bacteria 28194
26 Ga0068857_100000333 3300005577 Bacteria 32544
27 Ga0068851_10097069 3300005834 Bacteria 1559
28 Ga0075366_10098557 3300006195 Bacteria 1753
29 Ga0079104_1000258 3300006946 Bacteria 70651
30 Ga0079104_1003423 3300006946 Bacteria 7391
31 Ga0079104_1004931 3300006946 Bacteria 5508
32 Ga0105251_10000800 3300009011 Bacteria 28497
33 Ga0105251_10001495 3300009011 Bacteria 20074
34 Ga0105251_10005825 3300009011 Bacteria 7986
35 Ga0105251_10018142 3300009011 Bacteria 3751
36 Ga0105251_10022148 3300009011 Bacteria 3306
37 Ga0105251_10188876 3300009011 Bacteria 928
38 Ga0105251_10190530 3300009011 Bacteria 924
39 Ga0105244_10000090 3300009036 Bacteria 97171
40 Ga0105244_10001926 3300009036 Bacteria 16136
41 Ga0105244_10007690 3300009036 Bacteria 6828
42 Ga0105244_10008894 3300009036 Bacteria 6225
43 Ga0105244_10018316 3300009036 Bacteria 3931
44 Ga0105244_10025275 3300009036 Bacteria 3229
45 Ga0105250_10001458 3300009092 Bacteria 12775
46 Ga0105250_10027636 3300009092 Bacteria 2287
47 Ga0105250_10074284 3300009092 Bacteria 1375
48 Ga0105250_10126551 3300009092 Bacteria 1053
49 Ga0105243_10000002 3300009148 Bacteria 856281
50 Ga0105243_10004216 3300009148 Bacteria 11391
51 Ga0105237_10122474 3300009545 Bacteria 2595
52 Ga0105246_10098624 3300011119 Bacteria 2123
53 Ga0157373_10189598 3300013100 Bacteria 1449
54 Ga0157371_10003088 3300013102 Bacteria 15429
55 Ga0157371_10008092 3300013102 Bacteria 8407
56 Ga0157371_10010301 3300013102 Bacteria 7294
57 Ga0157371_10131570 3300013102 Bacteria 1780
58 Ga0157371_10132561 3300013102 Bacteria 1773
59 Ga0157369_10005828 3300013105 Bacteria 14327
60 Ga0157369_10006742 3300013105 Bacteria 13253
61 Ga0157369_10126687 3300013105 Bacteria 2707
62 Ga0157369_10337929 3300013105 Bacteria 1564
63 Ga0163162_10190364 3300013306 Bacteria 2179
64 Ga0157372_10000207 3300013307 Bacteria 65483
65 Ga0157372_10383761 3300013307 Bacteria 1637
66 Ga0182005_1016327 3300015265 Bacteria 2066
67 Ga0163161_10093892 3300017792 Bacteria 2223
68 Ga0163161_10102872 3300017792 Bacteria 2128
69 Ga0213872_10041713 3300021361 Bacteria 2093
70 Ga0209566_105327 3300025225 Bacteria 1630
71 Ga0209563_100671 3300025230 Bacteria 10840
72 Ga0209129_1000037 3300025258 Bacteria 326534
73 Ga0209129_1002099 3300025258 Bacteria 10201
74 Ga0209565_1000009 3300025263 Bacteria 751701
75 Ga0209673_1000036 3300025273 Bacteria 323162
76 Ga0209130_1003682 3300025284 Bacteria 6326
77 Ga0209675_1000013 3300025291 Bacteria 448220
78 Ga0209025_1005473 3300025294 Bacteria 10336
79 Ga0209564_1000122 3300025295 Bacteria 203709
80 Ga0209758_1011850 3300025297 Bacteria 4975
81 Ga0209256_1000106 3300025299 Bacteria 187258
82 Ga0209257_1000025 3300025304 Bacteria 724838
83 Ga0207656_10064116 3300025321 Bacteria 1619
84 Ga0207696_1000532 3300025711 Bacteria 31151
85 Ga0207655_1000004 3300025728 Bacteria 1021221
86 Ga0207655_1000414 3300025728 Bacteria 58652
87 Ga0207655_1002982 3300025728 Bacteria 12980
88 Ga0207655_1018145 3300025728 Bacteria 3752
89 Ga0207655_1040479 3300025728 Bacteria 2010
90 Ga0207713_1000052 3300025735 Bacteria 222663
91 Ga0207713_1000084 3300025735 Bacteria 160822
92 Ga0207713_1000911 3300025735 Bacteria 26641
93 Ga0207713_1001772 3300025735 Bacteria 16539
94 Ga0207713_1024914 3300025735 Bacteria 2775
95 Ga0207713_1025688 3300025735 Bacteria 2713
96 Ga0207713_1027517 3300025735 Bacteria 2581
97 Ga0207713_1075548 3300025735 Bacteria 1229
98 Ga0207706_10290103 3300025933 Bacteria 1426
99 Ga0207709_10000003 3300025935 Bacteria 1050072
100 Ga0207709_10037916 3300025935 Bacteria 2867
101 Ga0207709_10059499 3300025935 Bacteria 2378
102 Ga0207667_10013911 3300025949 Bacteria 9192
103 Ga0207668_10039926 3300025972 Bacteria 3163
104 Ga0207674_10000573 3300026116 Bacteria 48332
105 Ga0209281_1000014 3300027111 Bacteria 643021
106 Ga0209281_1000694 3300027111 Bacteria 34337
107 Ga0209281_1000749 3300027111 Bacteria 31356
108 Ga0209371_1000001 3300027312 Bacteria 2771503
109 Ga0209371_1000008 3300027312 Bacteria 1024606
110 Ga0209371_1000015 3300027312 Bacteria 659640
111 Ga0209371_1000206 3300027312 Bacteria 84144
112 Ga0209371_1001282 3300027312 Bacteria 17695
113 Ga0209371_1001555 3300027312 Bacteria 15130
114 Ga0209371_1015048 3300027312 Bacteria 2096
115 Ga0209371_1025945 3300027312 Bacteria 1340
116 Ga0268266_10230715 3300028379 Bacteria 1705
117 Ga0268266_10754289 3300028379 Bacteria 939
118 Ga0268256_1000001 3300030500 Bacteria 2771065
119 Ga0268256_1000009 3300030500 Bacteria 1022625
120 Ga0268256_1000018 3300030500 Bacteria 594572
121 Ga0268256_1000241 3300030500 Bacteria 57706
122 Ga0268256_1000572 3300030500 Bacteria 29655
123 Ga0268256_1001329 3300030500 Bacteria 15134
124 Ga0268256_1016663 3300030500 Bacteria 2096
125 Ga0268256_1033340 3300030500 Bacteria 1217
126 Ga0307507_10033000 3300033179 Bacteria 5386
127 Ga0316584_0056435 3300036712 Unclassified 2940
128 Ga0395900_0019439 3300037418 Bacteria 6925
129 Ga0395905_0222105 3300037471 Unclassified 1768
130 Ga0436361_0257013 3300039447 Bacteria 9304
131 Ga0439438_000075 3300041405 Bacteria 46559
132 Ga0439438_000279 3300041405 Bacteria 22963
133 Ga0439438_003733 3300041405 Bacteria 6045
134 Ga0439438_008230 3300041405 Bacteria 3481
135 Ga0439447_000370 3300041407 Bacteria 16339
136 Ga0439466_0001766 3300041411 Bacteria 8455
137 Ga0439432_009716 3300042006 Bacteria 3345
138 Ga0439432_034315 3300042006 Bacteria 1629
139 Ga0439464_0008035 3300042439 Bacteria 2767
140 Ga0466981_0000003 3300044669 Bacteria 248458
141 Ga0453684_0218252 3300044712 Bacteria 2211
142 Ga0495590_0000715 3300046457 Bacteria 15153
143 Ga0495590_0001370 3300046457 Bacteria 10593
144 Ga0495638_0003671 3300046460 Bacteria 11955
145 Ga0495650_0004533 3300046471 Bacteria 9487
146 Ga0495584_0016819 3300046491 Bacteria 3728
147 Ga0495607_0000259 3300046501 Bacteria 56558
148 Ga0495607_0000686 3300046501 Bacteria 32666
149 Ga0495606_0025332 3300046507 Bacteria 4251
150 Ga0495610_0000437 3300046512 Bacteria 42948
151 Ga0495616_0000156 3300046513 Bacteria 59558
152 Ga0495637_0001229 3300046520 Bacteria 15531
153 Ga0495654_0002777 3300046530 Bacteria 11034
154 Ga0495654_0007160 3300046530 Bacteria 6262
155 Ga0495654_0019684 3300046530 Bacteria 3528
156 Ga0495597_0001721 3300046542 Bacteria 15108
157 Ga0495671_0004862 3300046692 Bacteria 7947
158 Ga0495660_0007494 3300046810 Bacteria 6406
159 Ga0495660_0008905 3300046810 Bacteria 5866
160 Ga0495672_0000009 3300047320 Bacteria 557755
161 Ga0495672_0000037 3300047320 Bacteria 278588
162 Ga0495679_027137 3300047446 Bacteria 1894
163 Ga0495679_032251 3300047446 Bacteria 1682
164 Ga0495681_0000109 3300047470 Bacteria 71558
165 Ga0496104_0000385 3300048907 Bacteria 38635
166 Ga0496105_0015233 3300048908 Bacteria 6123
167 Ga0496105_0033175 3300048908 Bacteria 4239
168 Ga0496116_0000073 3300048919 Bacteria 237590
169 Ga0496116_0002044 3300048919 Bacteria 21624
170 Ga0496116_0012729 3300048919 Bacteria 6842
171 Ga0496116_0066349 3300048919 Bacteria 2309
172 Ga0496116_0085731 3300048919 Bacteria 1935
173 Ga0496117_0000624 3300048920 Bacteria 57349
174 Ga0496117_0001145 3300048920 Bacteria 39906
175 Ga0496117_0012245 3300048920 Bacteria 7585
176 Ga0496117_0012974 3300048920 Bacteria 7298
177 Ga0496117_0025021 3300048920 Bacteria 4702
178 Ga0496117_0071438 3300048920 Bacteria 2325
179 Ga0496117_0116980 3300048920 Bacteria 1646
180 Ga0496117_0120114 3300048920 Bacteria 1616
181 Ga0496118_0001021 3300048921 Bacteria 43537
182 Ga0496118_0005871 3300048921 Bacteria 13756
183 Ga0496118_0013305 3300048921 Bacteria 7795
184 Ga0496118_0073552 3300048921 Bacteria 2447
185 Ga0496118_0083986 3300048921 Bacteria 2224
186 Ga0496118_0109948 3300048921 Bacteria 1832
187 Ga0496118_0279695 3300048921 Bacteria 929
188 Ga0496118_0283588 3300048921 Bacteria 920
189 Ga0496119_0000013 3300048922 Bacteria 323820
190 Ga0496119_0004545 3300048922 Bacteria 13747
191 Ga0496119_0011998 3300048922 Bacteria 7093
192 Ga0496119_0031020 3300048922 Bacteria 3591
193 Ga0496119_0034563 3300048922 Bacteria 3325
194 Ga0496119_0086401 3300048922 Bacteria 1792
195 Ga0496120_0000026 3300048923 Bacteria 235131
196 Ga0496120_0001499 3300048923 Bacteria 27638
197 Ga0496120_0005227 3300048923 Bacteria 10438
198 Ga0496120_0005709 3300048923 Bacteria 9818
199 Ga0496120_0016028 3300048923 Bacteria 4913
200 Ga0496120_0018001 3300048923 Bacteria 4564
201 Ga0496120_0029137 3300048923 Bacteria 3372
202 Ga0496120_0207152 3300048923 Bacteria 945
203 Ga0496120_0223405 3300048923 Bacteria 898
204 Ga0496121_0000055 3300048924 Bacteria 304572
205 Ga0496121_0012570 3300048924 Bacteria 9209
206 Ga0496121_0013774 3300048924 Bacteria 8656
207 Ga0496121_0027839 3300048924 Bacteria 5278
208 Ga0496121_0056126 3300048924 Bacteria 3274
209 Ga0496121_0097149 3300048924 Unclassified 2283
210 Ga0496121_0195286 3300048924 Unclassified 1447
211 Ga0496122_0000409 3300048925 Bacteria 91249
212 Ga0496122_0007744 3300048925 Bacteria 11817
213 Ga0496122_0014459 3300048925 Bacteria 7628
214 Ga0496122_0015209 3300048925 Bacteria 7365
215 Ga0496122_0016996 3300048925 Bacteria 6833
216 Ga0496122_0022061 3300048925 Bacteria 5672
217 Ga0496122_0030077 3300048925 Bacteria 4560
218 Ga0496122_0030898 3300048925 Bacteria 4474
219 Ga0496122_0047998 3300048925 Bacteria 3289
220 Ga0496122_0106195 3300048925 Bacteria 1859
221 Ga0496122_0196889 3300048925 Bacteria 1182
222 Ga0496122_0351289 3300048925 Bacteria 769
223 Ga0496123_0000334 3300048926 Bacteria 89471
224 Ga0496123_0002199 3300048926 Bacteria 24807
225 Ga0496123_0004052 3300048926 Bacteria 15790
226 Ga0496123_0008144 3300048926 Bacteria 9677
227 Ga0496123_0024064 3300048926 Bacteria 4640
228 Ga0496123_0068856 3300048926 Bacteria 2226
229 Ga0496123_0087247 3300048926 Bacteria 1867
230 Ga0496123_0154506 3300048926 Bacteria 1232
231 Ga0496123_0190235 3300048926 Bacteria 1062
232 Ga0496123_0210563 3300048926 Bacteria 988
233 Ga0496124_0000060 3300048927 Bacteria 239933
234 Ga0496124_0000611 3300048927 Bacteria 60081
235 Ga0496124_0006982 3300048927 Bacteria 12112
236 Ga0496124_0034364 3300048927 Bacteria 4451
237 Ga0496124_0039674 3300048927 Bacteria 4078
238 Ga0496124_0129347 3300048927 Bacteria 2008
239 Ga0496124_0133705 3300048927 Bacteria 1966
240 Ga0496124_0169281 3300048927 Bacteria 1694
241 Ga0496124_0190108 3300048927 Bacteria 1572
242 Ga0496124_0398829 3300048927 Bacteria 955
243 Ga0496124_0494892 3300048927 Bacteria 821
244 Ga0496125_0000253 3300048928 Bacteria 109929
245 Ga0496125_0002641 3300048928 Bacteria 22925
246 Ga0496125_0002762 3300048928 Bacteria 22212
247 Ga0496125_0013114 3300048928 Bacteria 8171
248 Ga0496125_0034259 3300048928 Bacteria 4478
249 Ga0496125_0034491 3300048928 Bacteria 4460
250 Ga0496125_0125140 3300048928 Bacteria 1823
251 Ga0496125_0224869 3300048928 Bacteria 1205
252 Ga0496126_0000313 3300048929 Bacteria 103014
253 Ga0496126_0004089 3300048929 Bacteria 17673
254 Ga0496126_0012235 3300048929 Bacteria 8802
255 Ga0496126_0014195 3300048929 Bacteria 8061
256 Ga0496126_0038825 3300048929 Bacteria 4426
257 Ga0496126_0053862 3300048929 Bacteria 3647
258 Ga0496126_0090174 3300048929 Bacteria 2697
259 Ga0496126_0138644 3300048929 Bacteria 2095
260 Ga0496126_0259819 3300048929 Bacteria 1444
261 Ga0496126_0583716 3300048929 Bacteria 882
262 Ga0495682_0000427 3300049460 Bacteria 29525
263 Ga0501031_0146152 3300049568 Bacteria 1545
264 Ga0501031_0224514 3300049568 Bacteria 1223
265 Ga0501034_0300847 3300049571 Bacteria 1541
266 Ga0501034_0334160 3300049571 Bacteria 1446
267 Ga0501037_0026522 3300049573 Bacteria 4283
268 Ga0501035_0597134 3300049822 Bacteria 900
269 nmdc:mga0k408_4824_c1 3300050493 Bacteria 7152
270 2511293170 2511231011 Bacteria 6149768
271 2523470675 2523231067 Bacteria 5230452
272 2548649455 2547132416 Bacteria 4633861
273 2552746967 2551306352 Bacteria 3873115
274 2555259956 2554235234 Bacteria 5762085
275 2585829253 2585427591 Bacteria 5482980
276 2585834035 2585427592 Bacteria 5370892
277 2595452191 2593339239 Bacteria 4124669
278 2599409286 2599185169 Bacteria 5441380
279 2601522205 2600255254 Bacteria 5281859
280 2601527230 2600255255 Bacteria 5282785
281 2601614060 2600255280 Bacteria 5292309
282 2601618783 2600255281 Bacteria 5288753
283 2601642612 2600255287 Bacteria 5210468
284 2601647460 2600255288 Bacteria 5282738
285 2601652208 2600255289 Bacteria 5281907
286 2601657535 2600255290 Bacteria 5282218
287 2601662433 2600255291 Bacteria 5217298
288 2601672260 2600255292 Bacteria 6300551
289 2601695390 2600255298 Bacteria 5215185
290 2601700066 2600255299 Bacteria 5218662
291 2601705332 2600255300 Bacteria 5287774
292 2601710361 2600255301 Bacteria 5280532
293 2601715373 2600255302 Bacteria 5288235
294 2601720417 2600255303 Bacteria 5219315
295 2601725779 2600255304 Bacteria 5283973
296 2601730321 2600255305 Bacteria 5282329
297 2601735338 2600255306 Bacteria 5281613
298 2601740038 2600255307 Bacteria 5439064
299 2601750527 2600255309 Bacteria 5431045
300 2602017780 2600255392 Bacteria 5437392
301 2603644943 2602042047 Bacteria 4697674
302 2603659803 2602042052 Bacteria 5215873
303 2603665079 2602042053 Bacteria 5214361
304 2603705275 2602042067 Bacteria 4863713
305 2603837709 2602042103 Bacteria 5284714
306 2603842785 2602042104 Bacteria 5281639
307 2603847858 2602042105 Bacteria 5282303
308 2603852929 2602042106 Bacteria 5282744
309 2603867778 2602042109 Bacteria 5152801
310 2603870982 2602042110 Bacteria 5283285
311 2603875896 2602042111 Bacteria 5212080
312 2606048173 2603880178 Bacteria 5283018
313 2606069509 2603880184 Bacteria 5217896
314 2606145321 2603880202 Bacteria 5284684
315 2606175575 2603880211 Bacteria 5284226
316 2609913537 2609459761 Bacteria 5513740
317 2637225188 2636415599 Bacteria 5718434
318 2676406430 2675903046 Bacteria 5451247
319 2681996315 2681812866 Bacteria 4552357
320 2722730018 2721755487 Bacteria 6357185
321 2739199837 2738543004 Bacteria 6381073
322 2739351992 2738543031 Bacteria 5769731
323 2753808440 2751185905 Bacteria 6142767
324 2753856823 2751185917 Bacteria 4551186
325 2775541400 2775506706 Bacteria 4873073
326 2777022805 2775507074 Bacteria 5532402
327 2808848385 2808606359 Bacteria 9866990
328 2819657916 2818991456 Bacteria 6123676
329 2821120947 2821118458 Bacteria 4714306
330 2826584400 2826581358 Bacteria 5963467
331 2842849412 2842849001 Bacteria 5924277
332 2844529541 2844528606 Bacteria 4733806
333 2847088751 2847085930 Bacteria 5070450
334 2865014617 2865014394 Bacteria 4764573
335 2881360118 2881359912 Bacteria 4935907
336 2884087740 2884086401 Bacteria 5005459
337 2904513925 2904513164 Bacteria 5476410
338 2908673721 2908669403 Bacteria 5740494
339 2916182054 2916178963 Bacteria 5265078
340 2919111072 2919108558 Bacteria 5897419
341 2919498070 2919497567 Bacteria 4408621
342 2927837766 2927833300 Bacteria 4923934
343 2932416346 2932410948 Bacteria 6312192
344 2932422261 2932416698 Bacteria 6315112
345 2935625694 2935625433 Bacteria 5042964
346 2939575479 2939573065 Bacteria 4926053
347 2939603536 2939602548 Bacteria 4950493
348 2939618562 2939617950 Bacteria 4820956
349 2945877629 2945874760 Bacteria 5527237
350 2961175820 2961170736 Bacteria 7072258
351 2968560926 2968558590 Bacteria 6956864
352 2969082182 2969079654 Bacteria 5439582
353 2970508485 2970503327 Bacteria 7099517
354 2971822394 2971820967 Bacteria 5823634
355 2974439362 2974435778 Bacteria 4876478
356 2979811866 2979808191 Bacteria 7179355
357 2984564626 2984559226 Bacteria 5683096
358 2984597355 2984595703 Bacteria 5682994
359 3007397028 3007395558 Bacteria 6755444
360 3007421742 3007419365 Bacteria 7026924
361 8019505100 8019504834 Bacteria 4819156
362 8055100921 8055097453 Bacteria 4865496
363 8055595301 8055592153 Bacteria 5961247
364 8056134937 8056131705 Bacteria 6107031
365 8056139651 8056137416 Bacteria 6147080
366 Ga0439452_000037
367 SwRhRL2b_contig_45605
368 JGI25152J39213_1004754
369 rootH2_10008161
370 Ga0055526_1000827
371 Ga0055537_1000035
372 Ga0055537_1000111
373 Ga0055524_1026068
374 Ga0055534_1000268
375 Ga0055528_1000178
376 Ga0055531_10000139
377 Ga0058692_1000001
378 Ga0058692_1000728
379 Ga0058692_1001769
380 Ga0058692_1003838
381 Ga0058692_1006117
382 Ga0065714_10065231
383 Ga0065714_10181164
384 Ga0065704_10003561
385 Ga0065704_10003739
386 Ga0065704_10080398
387 Ga0070668_100024312
388 Ga0070665_100108306
389 Ga0070665_100837026
390 Ga0068855_100001624
391 Ga0068857_100000333
392 Ga0068851_10097069
393 Ga0075366_10098557
394 Ga0079104_1000258
395 Ga0079104_1003423
396 Ga0079104_1004931
397 Ga0105251_10000800
398 Ga0105251_10001495
399 Ga0105251_10005825
400 Ga0105251_10018142
401 Ga0105251_10022148
402 Ga0105251_10188876
403 Ga0105251_10190530
404 Ga0105244_10000090
405 Ga0105244_10001926
406 Ga0105244_10007690
407 Ga0105244_10008894
408 Ga0105244_10018316
409 Ga0105244_10025275
410 Ga0105250_10001458
411 Ga0105250_10027636
412 Ga0105250_10074284
413 Ga0105250_10126551
414 Ga0105243_10000002
415 Ga0105243_10004216
416 Ga0105237_10122474
417 Ga0105246_10098624
418 Ga0157373_10189598
419 Ga0157371_10003088
420 Ga0157371_10008092
421 Ga0157371_10010301
422 Ga0157371_10131570
423 Ga0157371_10132561
424 Ga0157369_10005828
425 Ga0157369_10006742
426 Ga0157369_10126687
427 Ga0157369_10337929
428 Ga0163162_10190364
429 Ga0157372_10000207
430 Ga0157372_10383761
431 Ga0182005_1016327
432 Ga0163161_10093892
433 Ga0163161_10102872
434 Ga0213872_10041713
435 Ga0209566_105327
436 Ga0209563_100671
437 Ga0209129_1000037
438 Ga0209129_1002099
439 Ga0209565_1000009
440 Ga0209673_1000036
441 Ga0209130_1003682
442 Ga0209675_1000013
443 Ga0209025_1005473
444 Ga0209564_1000122
445 Ga0209758_1011850
446 Ga0209256_1000106
447 Ga0209257_1000025
448 Ga0207656_10064116
449 Ga0207696_1000532
450 Ga0207655_1000004
451 Ga0207655_1000414
452 Ga0207655_1002982
453 Ga0207655_1018145
454 Ga0207655_1040479
455 Ga0207713_1000052
456 Ga0207713_1000084
457 Ga0207713_1000911
458 Ga0207713_1001772
459 Ga0207713_1024914
460 Ga0207713_1025688
461 Ga0207713_1027517
462 Ga0207713_1075548
463 Ga0207706_10290103
464 Ga0207709_10000003
465 Ga0207709_10037916
466 Ga0207709_10059499
467 Ga0207667_10013911
468 Ga0207668_10039926
469 Ga0207674_10000573
470 Ga0209281_1000014
471 Ga0209281_1000694
472 Ga0209281_1000749
473 Ga0209371_1000001
474 Ga0209371_1000008
475 Ga0209371_1000015
476 Ga0209371_1000206
477 Ga0209371_1001282
478 Ga0209371_1001555
479 Ga0209371_1015048
480 Ga0209371_1025945
481 Ga0268266_10230715
482 Ga0268266_10754289
483 Ga0268256_1000001
484 Ga0268256_1000009
485 Ga0268256_1000018
486 Ga0268256_1000241
487 Ga0268256_1000572
488 Ga0268256_1001329
489 Ga0268256_1016663
490 Ga0268256_1033340
491 Ga0307507_10033000
492 Ga0316584_0056435
493 Ga0395900_0019439
494 Ga0395905_0222105
495 Ga0436361_0257013
496 Ga0439438_000075
497 Ga0439438_000279
498 Ga0439438_003733
499 Ga0439438_008230
500 Ga0439447_000370
501 Ga0439466_0001766
502 Ga0439432_009716
503 Ga0439432_034315
504 Ga0439464_0008035
505 Ga0466981_0000003
506 Ga0453684_0218252
507 Ga0495590_0000715
508 Ga0495590_0001370
509 Ga0495638_0003671
510 Ga0495650_0004533
511 Ga0495584_0016819
512 Ga0495607_0000259
513 Ga0495607_0000686
514 Ga0495606_0025332
515 Ga0495610_0000437
516 Ga0495616_0000156
517 Ga0495637_0001229
518 Ga0495654_0002777
519 Ga0495654_0007160
520 Ga0495654_0019684
521 Ga0495597_0001721
522 Ga0495671_0004862
523 Ga0495660_0007494
524 Ga0495660_0008905
525 Ga0495672_0000009
526 Ga0495672_0000037
527 Ga0495679_027137
528 Ga0495679_032251
529 Ga0495681_0000109
530 Ga0496104_0000385
531 Ga0496105_0015233
532 Ga0496105_0033175
533 Ga0496116_0000073
534 Ga0496116_0002044
535 Ga0496116_0012729
536 Ga0496116_0066349
537 Ga0496116_0085731
538 Ga0496117_0000624
539 Ga0496117_0001145
540 Ga0496117_0012245
541 Ga0496117_0012974
542 Ga0496117_0025021
543 Ga0496117_0071438
544 Ga0496117_0116980
545 Ga0496117_0120114
546 Ga0496118_0001021
547 Ga0496118_0005871
548 Ga0496118_0013305
549 Ga0496118_0073552
550 Ga0496118_0083986
551 Ga0496118_0109948
552 Ga0496118_0279695
553 Ga0496118_0283588
554 Ga0496119_0000013
555 Ga0496119_0004545
556 Ga0496119_0011998
557 Ga0496119_0031020
558 Ga0496119_0034563
559 Ga0496119_0086401
560 Ga0496120_0000026
561 Ga0496120_0001499
562 Ga0496120_0005227
563 Ga0496120_0005709
564 Ga0496120_0016028
565 Ga0496120_0018001
566 Ga0496120_0029137
567 Ga0496120_0207152
568 Ga0496120_0223405
569 Ga0496121_0000055
570 Ga0496121_0012570
571 Ga0496121_0013774
572 Ga0496121_0027839
573 Ga0496121_0056126
574 Ga0496121_0097149
575 Ga0496121_0195286
576 Ga0496122_0000409
577 Ga0496122_0007744
578 Ga0496122_0014459
579 Ga0496122_0015209
580 Ga0496122_0016996
581 Ga0496122_0022061
582 Ga0496122_0030077
583 Ga0496122_0030898
584 Ga0496122_0047998
585 Ga0496122_0106195
586 Ga0496122_0196889
587 Ga0496122_0351289
588 Ga0496123_0000334
589 Ga0496123_0002199
590 Ga0496123_0004052
591 Ga0496123_0008144
592 Ga0496123_0024064
593 Ga0496123_0068856
594 Ga0496123_0087247
595 Ga0496123_0154506
596 Ga0496123_0190235
597 Ga0496123_0210563
598 Ga0496124_0000060
599 Ga0496124_0000611
600 Ga0496124_0006982
601 Ga0496124_0034364
602 Ga0496124_0039674
603 Ga0496124_0129347
604 Ga0496124_0133705
605 Ga0496124_0169281
606 Ga0496124_0190108
607 Ga0496124_0398829
608 Ga0496124_0494892
609 Ga0496125_0000253
610 Ga0496125_0002641
611 Ga0496125_0002762
612 Ga0496125_0013114
613 Ga0496125_0034259
614 Ga0496125_0034491
615 Ga0496125_0125140
616 Ga0496125_0224869
617 Ga0496126_0000313
618 Ga0496126_0004089
619 Ga0496126_0012235
620 Ga0496126_0014195
621 Ga0496126_0038825
622 Ga0496126_0053862
623 Ga0496126_0090174
624 Ga0496126_0138644
625 Ga0496126_0259819
626 Ga0496126_0583716
627 Ga0495682_0000427
628 Ga0501031_0146152
629 Ga0501031_0224514
630 Ga0501034_0300847
631 Ga0501034_0334160
632 Ga0501037_0026522
633 Ga0501035_0597134
634 nmdc:mga0k408_4824_c1
635 2511293170
636 2523470675
637 2548649455
638 2552746967
639 2555259956
640 2585829253
641 2585834035
642 2595452191
643 2599409286
644 2601522205
645 2601527230
646 2601614060
647 2601618783
648 2601642612
649 2601647460
650 2601652208
651 2601657535
652 2601662433
653 2601672260
654 2601695390
655 2601700066
656 2601705332
657 2601710361
658 2601715373
659 2601720417
660 2601725779
661 2601730321
662 2601735338
663 2601740038
664 2601750527
665 2602017780
666 2603644943
667 2603659803
668 2603665079
669 2603705275
670 2603837709
671 2603842785
672 2603847858
673 2603852929
674 2603867778
675 2603870982
676 2603875896
677 2606048173
678 2606069509
679 2606145321
680 2606175575
681 2609913537
682 2637225188
683 2676406430
684 2681996315
685 2722730018
686 2739199837
687 2739351992
688 2753808440
689 2753856823
690 2775541400
691 2777022805
692 2808848385
693 2819657916
694 2821120947
695 2826584400
696 2842849412
697 2844529541
698 2847088751
699 2865014617
700 2881360118
701 2884087740
702 2904513925
703 2908673721
704 2916182054
705 2919111072
706 2919498070
707 2927837766
708 2932416346
709 2932422261
710 2935625694
711 2939575479
712 2939603536
713 2939618562
714 2945877629
715 2961175820
716 2968560926
717 2969082182
718 2970508485
719 2971822394
720 2974439362
721 2979811866
722 2984564626
723 2984597355
724 3007397028
725 3007421742
726 8019505100
727 8055100921
728 8055595301
729 8056134937
730 8056139651

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07722

Peptidase_C26

Peptidase C26

33

162

0.85

PF00117

GATase

Glutamine amidotransferase class-I

51

230

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3l7n-assembly1.cif.gz_A crystal structure of smu.1228c 0.9917 12 244
3l7n-assembly1.cif.gz_A crystal structure of smu.1228c 0.9833 12 244
1o1y-assembly1.cif.gz_A crystal structure of a glutamine amidotransferase (tm1158) from thermotoga maritima at 1.70 a resolution 0.8983 10 243
3m3p-assembly1.cif.gz_A crystal structure of glutamine amido transferase from methylobacillus flagellatus 0.8935 10 245
1o1y-assembly1.cif.gz_A crystal structure of a glutamine amidotransferase (tm1158) from thermotoga maritima at 1.70 a resolution 0.8799 10 243
ID Description Score Start End Superfamily
3l7nA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9917 12 244 3.40.50.880
3l7nA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9833 12 244 3.40.50.880
1o1yA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8918 10 243 3.40.50.880
1o1yA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.877 10 243 3.40.50.880
3l83A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8402 14 247 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A7W7IZH6-F1-model_v4 GMP synthase (Glutamine-hydrolyzing) (EC 6.3.5.2) 0.9974 12 248 GO:0003922
GO:0005829
GO:0006541
AF-A0A7H8WDY2-F1-model_v4 Type 1 glutamine amidotransferase 0.9974 12 248 GO:0005829
GO:0006541
GO:0016740
AF-A0A379VMW0-F1-model_v4 Glutamine amidotransferase (EC 6.3.5.2) 0.9947 12 197 GO:0003922
GO:0005829
GO:0006541
GO:0016740
AF-A0A359YGI2-F1-model_v4 deleted 0.9944 58 244
AF-A0A154UDN3-F1-model_v4 deleted 0.9941 11 243

Map