F423765
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 365 | 202 | 730 | 239 |
Family's Representative Sequence
| Representative Sequence | 3300042010|Ga0439452_000037|Ga0439452_000037_96511_97350 |
| Length | 279 |
| Sequence | MSWRFIYAVWHLRFKTCIYDCRVISPHRNLEQTSMRVHFIVHESFEAPGAYESWAQQRGYQVSHSRLYAGDALPATAEAFDLLIIMGGPQDPDTTQAECPHFDARAEQALIAAAIAGGKAVIGICLGSQLIGEALGAAFAHSPEKEIGKFPITLTTAGKNHPLFAHFPETLAVGHWHNDMPGLTADAQVLAFSEGCPRQIVAYSDRVFGFQCHMELTPEVVEQLIAHSEADLSRAAQFRFVETAEALRAHDYREMNDILCQFLDKLTAYYQDATQALRH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 6 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 7 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 12 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 17 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 18 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 19 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 20 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 21 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 22 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 23 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 24 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 25 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 26 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 28 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 29 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 30 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 31 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 32 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 33 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 35 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 36 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 37 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 38 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 39 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 40 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 41 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 42 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 43 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 44 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 45 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 46 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 47 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 57 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 60 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 61 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 62 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 63 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 64 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 65 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 66 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 67 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 68 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 69 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 70 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 71 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 72 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 73 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 74 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 75 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 89 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 90 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 91 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 92 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 93 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 94 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 95 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 96 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 97 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 98 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 99 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 100 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 101 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 103 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 104 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 105 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 106 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 107 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 108 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 109 | 2547132416 | Enterobacter sp. MR1 | Isolate | Rhizoplane |
| 110 | 2551306352 | Acinetobacter sp. GG2 | Isolate | Rhizosphere |
| 111 | 2554235234 | Klebsiella michiganensis SA2 | Isolate | Unclassified |
| 112 | 2585427591 | Rahnella aquatilis OV744 | Isolate | Rhizosphere |
| 113 | 2585427592 | Rahnella aquatilis OV588 | Isolate | Rhizosphere |
| 114 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 115 | 2599185169 | Klebsiella quasipneumoniae NFPP35 | Isolate | Rhizoplane |
| 116 | 2600255254 | Klebsiella quasipneumoniae NFIX15 | Isolate | Rhizoplane |
| 117 | 2600255255 | Klebsiella quasipneumoniae NFIX23 | Isolate | Rhizoplane |
| 118 | 2600255280 | Klebsiella quasipneumoniae NFIX42 | Isolate | Rhizoplane |
| 119 | 2600255281 | Klebsiella quasipneumoniae NFIX43 | Isolate | Rhizoplane |
| 120 | 2600255287 | Klebsiella quasipneumoniae NFIX11 | Isolate | Rhizoplane |
| 121 | 2600255288 | Klebsiella quasipneumoniae NFIX14 | Isolate | Rhizoplane |
| 122 | 2600255289 | Klebsiella quasipneumoniae NFIX16 | Isolate | Rhizoplane |
| 123 | 2600255290 | Klebsiella quasipneumoniae NFIX17 | Isolate | Rhizoplane |
| 124 | 2600255291 | Klebsiella quasipneumoniae NFIX19 | Isolate | Rhizoplane |
| 125 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 126 | 2600255298 | Klebsiella quasipneumoniae NFIX21 | Isolate | Rhizoplane |
| 127 | 2600255299 | Klebsiella quasipneumoniae NFIX22 | Isolate | Rhizoplane |
| 128 | 2600255300 | Klebsiella quasipneumoniae NFIX30 | Isolate | Rhizoplane |
| 129 | 2600255301 | Klebsiella quasipneumoniae NFIX33 | Isolate | Rhizoplane |
| 130 | 2600255302 | Klebsiella quasipneumoniae NFIX35 | Isolate | Rhizoplane |
| 131 | 2600255303 | Klebsiella quasipneumoniae NFIX36 | Isolate | Rhizoplane |
| 132 | 2600255304 | Klebsiella quasipneumoniae NFIX37 | Isolate | Rhizoplane |
| 133 | 2600255305 | Klebsiella quasipneumoniae NFIX41 | Isolate | Rhizoplane |
| 134 | 2600255306 | Klebsiella quasipneumoniae NFIX44 | Isolate | Rhizoplane |
| 135 | 2600255307 | Klebsiella quasipneumoniae NFIX56 | Isolate | Rhizoplane |
| 136 | 2600255309 | Klebsiella sp. NFIX53 | Isolate | Rhizoplane |
| 137 | 2600255392 | Klebsiella quasipneumoniae NFIX54 | Isolate | Rhizoplane |
| 138 | 2602042047 | Enterobacter sp. NFIX59 | Isolate | Rhizoplane |
| 139 | 2602042052 | Klebsiella quasipneumoniae NFIX18 | Isolate | Rhizoplane |
| 140 | 2602042053 | Klebsiella quasipneumoniae NFIX12 | Isolate | Rhizoplane |
| 141 | 2602042067 | Enterobacter sp. NFIX58 | Isolate | Rhizoplane |
| 142 | 2602042103 | Klebsiella quasipneumoniae NFIX29 | Isolate | Rhizoplane |
| 143 | 2602042104 | Klebsiella quasipneumoniae NFIX26 | Isolate | Rhizoplane |
| 144 | 2602042105 | Klebsiella quasipneumoniae NFIX25 | Isolate | Rhizoplane |
| 145 | 2602042106 | Klebsiella quasipneumoniae NFIX13 | Isolate | Rhizoplane |
| 146 | 2602042109 | Klebsiella aerogenes NFIX39 | Isolate | Rhizoplane |
| 147 | 2602042110 | Klebsiella quasipneumoniae NFIX40 | Isolate | Rhizoplane |
| 148 | 2602042111 | Klebsiella quasipneumoniae NFIX20 | Isolate | Rhizoplane |
| 149 | 2603880178 | Klebsiella quasipneumoniae NFIX34 | Isolate | Rhizoplane |
| 150 | 2603880184 | Klebsiella quasipneumoniae NFIX27 | Isolate | Rhizoplane |
| 151 | 2603880202 | Klebsiella quasipneumoniae NFIX38 | Isolate | Rhizoplane |
| 152 | 2603880211 | Klebsiella quasipneumoniae NFIX24 | Isolate | Rhizoplane |
| 153 | 2609459761 | Enterobacter sp. NFR05 | Isolate | Rhizoplane |
| 154 | 2636415599 | Klebsiella variicola DX120E | Isolate | Unclassified |
| 155 | 2675903046 | Klebsiella quasipneumoniae NFIX52 | Isolate | Rhizoplane |
| 156 | 2681812866 | Enterobacter asburiae NFIX55 | Isolate | Rhizoplane |
| 157 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 158 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 159 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 160 | 2751185905 | Paenibacillus kribbensis 6hRe76 | Isolate | Unclassified |
| 161 | 2751185917 | Enterobacter sp. HK169 | Isolate | Unclassified |
| 162 | 2775506706 | Enterobacter asburiae 1216 | Isolate | Unclassified |
| 163 | 2775507074 | Klebsiella sp. D5A | Isolate | Unclassified |
| 164 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 165 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 166 | 2821118458 | Enterobacter asburiae 609 | Isolate | Unclassified |
| 167 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 168 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 169 | 2844528606 | Pantoea sp. R-72498 v. 2 | Isolate | Unclassified |
| 170 | 2847085930 | Erwinia persicina B64 | Isolate | Bulb |
| 171 | 2865014394 | Pantoea sp. R-71966 | Isolate | Unclassified |
| 172 | 2881359912 | Flavobacterium ustbae T13 | Isolate | Rhizosphere |
| 173 | 2884086401 | Kluyvera sp. PO2S7 | Isolate | Rhizosphere |
| 174 | 2904513164 | Klebsiella variicola 1431 | Isolate | Rhizosphere |
| 175 | 2908669403 | Pantoea coffeiphila 1480 | Isolate | Rhizosphere |
| 176 | 2916178963 | Pseudoalteromonas rhizosphaerae RA15 | Isolate | Rhizosphere |
| 177 | 2919108558 | Klebsiella sp. 1400 | Isolate | Rhizosphere |
| 178 | 2919497567 | Shewanella putrefaciens 3469 | Isolate | Unclassified |
| 179 | 2927833300 | Enterobacter sp. SLBN-59 | Isolate | Rhizosphere |
| 180 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 181 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 182 | 2935625433 | Kosakonia sp. 1610 | Isolate | Rhizosphere |
| 183 | 2939573065 | Citrobacter sp. 506 | Isolate | Rhizosphere |
| 184 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 185 | 2939617950 | Kosakonia cowanii 2056 | Isolate | Rhizosphere |
| 186 | 2945874760 | Phytobacter diazotrophicus UAEU22 | Isolate | Rhizosphere |
| 187 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 188 | 2968558590 | Paenibacillus sp. P3E | Isolate | Rhizosphere |
| 189 | 2969079654 | Klebsiella variicola E57-7 | Isolate | Unclassified |
| 190 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 191 | 2971820967 | Klebsiella sp. MPUS7 | Isolate | Rhizosphere |
| 192 | 2974435778 | Kosakonia cowanii SORGH_AS 304 | Isolate | Unclassified |
| 193 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 194 | 2984559226 | Klebsiella variicola SORGH_AS834 | Isolate | Aerial Root |
| 195 | 2984595703 | Klebsiella variicola SORGH_AS1070 | Isolate | Aerial Root |
| 196 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 197 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 198 | 8019504834 | Atlantibacter hermannii 1903 | Isolate | Rhizosphere |
| 199 | 8055097453 | Leclercia tamurae H6W5 | Isolate | Rhizosphere |
| 200 | 8055592153 | Flavobacterium panacis DCY106 | Isolate | Rhizosphere |
| 201 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 202 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 73.7 |
| Metatranscriptomes | 0 |
| Isolates | 26.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.55 |
| Bulb | 0.27 |
| Endosphere | 6.3 |
| Nodule | 2.74 |
| Rhizoplane | 12.33 |
| Rhizosphere | 45.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0439452_000037 | 3300042010 | Bacteria | 150659 |
| 2 | SwRhRL2b_contig_45605 | 2162886007 | Bacteria | 4788 |
| 3 | JGI25152J39213_1004754 | 3300002773 | Bacteria | 4180 |
| 4 | rootH2_10008161 | 3300003320 | Bacteria | 23559 |
| 5 | Ga0055526_1000827 | 3300003771 | Bacteria | 23107 |
| 6 | Ga0055537_1000035 | 3300003773 | Bacteria | 96274 |
| 7 | Ga0055537_1000111 | 3300003773 | Bacteria | 61884 |
| 8 | Ga0055524_1026068 | 3300003775 | Bacteria | 1817 |
| 9 | Ga0055534_1000268 | 3300003784 | Bacteria | 35791 |
| 10 | Ga0055528_1000178 | 3300003790 | Bacteria | 53709 |
| 11 | Ga0055531_10000139 | 3300003794 | Bacteria | 82993 |
| 12 | Ga0058692_1000001 | 3300003856 | Bacteria | 834230 |
| 13 | Ga0058692_1000728 | 3300003856 | Bacteria | 13378 |
| 14 | Ga0058692_1001769 | 3300003856 | Bacteria | 7653 |
| 15 | Ga0058692_1003838 | 3300003856 | Bacteria | 4567 |
| 16 | Ga0058692_1006117 | 3300003856 | Bacteria | 3342 |
| 17 | Ga0065714_10065231 | 3300005288 | Bacteria | 11549 |
| 18 | Ga0065714_10181164 | 3300005288 | Bacteria | 962 |
| 19 | Ga0065704_10003561 | 3300005289 | Bacteria | 9011 |
| 20 | Ga0065704_10003739 | 3300005289 | Bacteria | 4988 |
| 21 | Ga0065704_10080398 | 3300005289 | Bacteria | 3954 |
| 22 | Ga0070668_100024312 | 3300005347 | Bacteria | 4588 |
| 23 | Ga0070665_100108306 | 3300005548 | Bacteria | 2781 |
| 24 | Ga0070665_100837026 | 3300005548 | Bacteria | 933 |
| 25 | Ga0068855_100001624 | 3300005563 | Bacteria | 28194 |
| 26 | Ga0068857_100000333 | 3300005577 | Bacteria | 32544 |
| 27 | Ga0068851_10097069 | 3300005834 | Bacteria | 1559 |
| 28 | Ga0075366_10098557 | 3300006195 | Bacteria | 1753 |
| 29 | Ga0079104_1000258 | 3300006946 | Bacteria | 70651 |
| 30 | Ga0079104_1003423 | 3300006946 | Bacteria | 7391 |
| 31 | Ga0079104_1004931 | 3300006946 | Bacteria | 5508 |
| 32 | Ga0105251_10000800 | 3300009011 | Bacteria | 28497 |
| 33 | Ga0105251_10001495 | 3300009011 | Bacteria | 20074 |
| 34 | Ga0105251_10005825 | 3300009011 | Bacteria | 7986 |
| 35 | Ga0105251_10018142 | 3300009011 | Bacteria | 3751 |
| 36 | Ga0105251_10022148 | 3300009011 | Bacteria | 3306 |
| 37 | Ga0105251_10188876 | 3300009011 | Bacteria | 928 |
| 38 | Ga0105251_10190530 | 3300009011 | Bacteria | 924 |
| 39 | Ga0105244_10000090 | 3300009036 | Bacteria | 97171 |
| 40 | Ga0105244_10001926 | 3300009036 | Bacteria | 16136 |
| 41 | Ga0105244_10007690 | 3300009036 | Bacteria | 6828 |
| 42 | Ga0105244_10008894 | 3300009036 | Bacteria | 6225 |
| 43 | Ga0105244_10018316 | 3300009036 | Bacteria | 3931 |
| 44 | Ga0105244_10025275 | 3300009036 | Bacteria | 3229 |
| 45 | Ga0105250_10001458 | 3300009092 | Bacteria | 12775 |
| 46 | Ga0105250_10027636 | 3300009092 | Bacteria | 2287 |
| 47 | Ga0105250_10074284 | 3300009092 | Bacteria | 1375 |
| 48 | Ga0105250_10126551 | 3300009092 | Bacteria | 1053 |
| 49 | Ga0105243_10000002 | 3300009148 | Bacteria | 856281 |
| 50 | Ga0105243_10004216 | 3300009148 | Bacteria | 11391 |
| 51 | Ga0105237_10122474 | 3300009545 | Bacteria | 2595 |
| 52 | Ga0105246_10098624 | 3300011119 | Bacteria | 2123 |
| 53 | Ga0157373_10189598 | 3300013100 | Bacteria | 1449 |
| 54 | Ga0157371_10003088 | 3300013102 | Bacteria | 15429 |
| 55 | Ga0157371_10008092 | 3300013102 | Bacteria | 8407 |
| 56 | Ga0157371_10010301 | 3300013102 | Bacteria | 7294 |
| 57 | Ga0157371_10131570 | 3300013102 | Bacteria | 1780 |
| 58 | Ga0157371_10132561 | 3300013102 | Bacteria | 1773 |
| 59 | Ga0157369_10005828 | 3300013105 | Bacteria | 14327 |
| 60 | Ga0157369_10006742 | 3300013105 | Bacteria | 13253 |
| 61 | Ga0157369_10126687 | 3300013105 | Bacteria | 2707 |
| 62 | Ga0157369_10337929 | 3300013105 | Bacteria | 1564 |
| 63 | Ga0163162_10190364 | 3300013306 | Bacteria | 2179 |
| 64 | Ga0157372_10000207 | 3300013307 | Bacteria | 65483 |
| 65 | Ga0157372_10383761 | 3300013307 | Bacteria | 1637 |
| 66 | Ga0182005_1016327 | 3300015265 | Bacteria | 2066 |
| 67 | Ga0163161_10093892 | 3300017792 | Bacteria | 2223 |
| 68 | Ga0163161_10102872 | 3300017792 | Bacteria | 2128 |
| 69 | Ga0213872_10041713 | 3300021361 | Bacteria | 2093 |
| 70 | Ga0209566_105327 | 3300025225 | Bacteria | 1630 |
| 71 | Ga0209563_100671 | 3300025230 | Bacteria | 10840 |
| 72 | Ga0209129_1000037 | 3300025258 | Bacteria | 326534 |
| 73 | Ga0209129_1002099 | 3300025258 | Bacteria | 10201 |
| 74 | Ga0209565_1000009 | 3300025263 | Bacteria | 751701 |
| 75 | Ga0209673_1000036 | 3300025273 | Bacteria | 323162 |
| 76 | Ga0209130_1003682 | 3300025284 | Bacteria | 6326 |
| 77 | Ga0209675_1000013 | 3300025291 | Bacteria | 448220 |
| 78 | Ga0209025_1005473 | 3300025294 | Bacteria | 10336 |
| 79 | Ga0209564_1000122 | 3300025295 | Bacteria | 203709 |
| 80 | Ga0209758_1011850 | 3300025297 | Bacteria | 4975 |
| 81 | Ga0209256_1000106 | 3300025299 | Bacteria | 187258 |
| 82 | Ga0209257_1000025 | 3300025304 | Bacteria | 724838 |
| 83 | Ga0207656_10064116 | 3300025321 | Bacteria | 1619 |
| 84 | Ga0207696_1000532 | 3300025711 | Bacteria | 31151 |
| 85 | Ga0207655_1000004 | 3300025728 | Bacteria | 1021221 |
| 86 | Ga0207655_1000414 | 3300025728 | Bacteria | 58652 |
| 87 | Ga0207655_1002982 | 3300025728 | Bacteria | 12980 |
| 88 | Ga0207655_1018145 | 3300025728 | Bacteria | 3752 |
| 89 | Ga0207655_1040479 | 3300025728 | Bacteria | 2010 |
| 90 | Ga0207713_1000052 | 3300025735 | Bacteria | 222663 |
| 91 | Ga0207713_1000084 | 3300025735 | Bacteria | 160822 |
| 92 | Ga0207713_1000911 | 3300025735 | Bacteria | 26641 |
| 93 | Ga0207713_1001772 | 3300025735 | Bacteria | 16539 |
| 94 | Ga0207713_1024914 | 3300025735 | Bacteria | 2775 |
| 95 | Ga0207713_1025688 | 3300025735 | Bacteria | 2713 |
| 96 | Ga0207713_1027517 | 3300025735 | Bacteria | 2581 |
| 97 | Ga0207713_1075548 | 3300025735 | Bacteria | 1229 |
| 98 | Ga0207706_10290103 | 3300025933 | Bacteria | 1426 |
| 99 | Ga0207709_10000003 | 3300025935 | Bacteria | 1050072 |
| 100 | Ga0207709_10037916 | 3300025935 | Bacteria | 2867 |
| 101 | Ga0207709_10059499 | 3300025935 | Bacteria | 2378 |
| 102 | Ga0207667_10013911 | 3300025949 | Bacteria | 9192 |
| 103 | Ga0207668_10039926 | 3300025972 | Bacteria | 3163 |
| 104 | Ga0207674_10000573 | 3300026116 | Bacteria | 48332 |
| 105 | Ga0209281_1000014 | 3300027111 | Bacteria | 643021 |
| 106 | Ga0209281_1000694 | 3300027111 | Bacteria | 34337 |
| 107 | Ga0209281_1000749 | 3300027111 | Bacteria | 31356 |
| 108 | Ga0209371_1000001 | 3300027312 | Bacteria | 2771503 |
| 109 | Ga0209371_1000008 | 3300027312 | Bacteria | 1024606 |
| 110 | Ga0209371_1000015 | 3300027312 | Bacteria | 659640 |
| 111 | Ga0209371_1000206 | 3300027312 | Bacteria | 84144 |
| 112 | Ga0209371_1001282 | 3300027312 | Bacteria | 17695 |
| 113 | Ga0209371_1001555 | 3300027312 | Bacteria | 15130 |
| 114 | Ga0209371_1015048 | 3300027312 | Bacteria | 2096 |
| 115 | Ga0209371_1025945 | 3300027312 | Bacteria | 1340 |
| 116 | Ga0268266_10230715 | 3300028379 | Bacteria | 1705 |
| 117 | Ga0268266_10754289 | 3300028379 | Bacteria | 939 |
| 118 | Ga0268256_1000001 | 3300030500 | Bacteria | 2771065 |
| 119 | Ga0268256_1000009 | 3300030500 | Bacteria | 1022625 |
| 120 | Ga0268256_1000018 | 3300030500 | Bacteria | 594572 |
| 121 | Ga0268256_1000241 | 3300030500 | Bacteria | 57706 |
| 122 | Ga0268256_1000572 | 3300030500 | Bacteria | 29655 |
| 123 | Ga0268256_1001329 | 3300030500 | Bacteria | 15134 |
| 124 | Ga0268256_1016663 | 3300030500 | Bacteria | 2096 |
| 125 | Ga0268256_1033340 | 3300030500 | Bacteria | 1217 |
| 126 | Ga0307507_10033000 | 3300033179 | Bacteria | 5386 |
| 127 | Ga0316584_0056435 | 3300036712 | Unclassified | 2940 |
| 128 | Ga0395900_0019439 | 3300037418 | Bacteria | 6925 |
| 129 | Ga0395905_0222105 | 3300037471 | Unclassified | 1768 |
| 130 | Ga0436361_0257013 | 3300039447 | Bacteria | 9304 |
| 131 | Ga0439438_000075 | 3300041405 | Bacteria | 46559 |
| 132 | Ga0439438_000279 | 3300041405 | Bacteria | 22963 |
| 133 | Ga0439438_003733 | 3300041405 | Bacteria | 6045 |
| 134 | Ga0439438_008230 | 3300041405 | Bacteria | 3481 |
| 135 | Ga0439447_000370 | 3300041407 | Bacteria | 16339 |
| 136 | Ga0439466_0001766 | 3300041411 | Bacteria | 8455 |
| 137 | Ga0439432_009716 | 3300042006 | Bacteria | 3345 |
| 138 | Ga0439432_034315 | 3300042006 | Bacteria | 1629 |
| 139 | Ga0439464_0008035 | 3300042439 | Bacteria | 2767 |
| 140 | Ga0466981_0000003 | 3300044669 | Bacteria | 248458 |
| 141 | Ga0453684_0218252 | 3300044712 | Bacteria | 2211 |
| 142 | Ga0495590_0000715 | 3300046457 | Bacteria | 15153 |
| 143 | Ga0495590_0001370 | 3300046457 | Bacteria | 10593 |
| 144 | Ga0495638_0003671 | 3300046460 | Bacteria | 11955 |
| 145 | Ga0495650_0004533 | 3300046471 | Bacteria | 9487 |
| 146 | Ga0495584_0016819 | 3300046491 | Bacteria | 3728 |
| 147 | Ga0495607_0000259 | 3300046501 | Bacteria | 56558 |
| 148 | Ga0495607_0000686 | 3300046501 | Bacteria | 32666 |
| 149 | Ga0495606_0025332 | 3300046507 | Bacteria | 4251 |
| 150 | Ga0495610_0000437 | 3300046512 | Bacteria | 42948 |
| 151 | Ga0495616_0000156 | 3300046513 | Bacteria | 59558 |
| 152 | Ga0495637_0001229 | 3300046520 | Bacteria | 15531 |
| 153 | Ga0495654_0002777 | 3300046530 | Bacteria | 11034 |
| 154 | Ga0495654_0007160 | 3300046530 | Bacteria | 6262 |
| 155 | Ga0495654_0019684 | 3300046530 | Bacteria | 3528 |
| 156 | Ga0495597_0001721 | 3300046542 | Bacteria | 15108 |
| 157 | Ga0495671_0004862 | 3300046692 | Bacteria | 7947 |
| 158 | Ga0495660_0007494 | 3300046810 | Bacteria | 6406 |
| 159 | Ga0495660_0008905 | 3300046810 | Bacteria | 5866 |
| 160 | Ga0495672_0000009 | 3300047320 | Bacteria | 557755 |
| 161 | Ga0495672_0000037 | 3300047320 | Bacteria | 278588 |
| 162 | Ga0495679_027137 | 3300047446 | Bacteria | 1894 |
| 163 | Ga0495679_032251 | 3300047446 | Bacteria | 1682 |
| 164 | Ga0495681_0000109 | 3300047470 | Bacteria | 71558 |
| 165 | Ga0496104_0000385 | 3300048907 | Bacteria | 38635 |
| 166 | Ga0496105_0015233 | 3300048908 | Bacteria | 6123 |
| 167 | Ga0496105_0033175 | 3300048908 | Bacteria | 4239 |
| 168 | Ga0496116_0000073 | 3300048919 | Bacteria | 237590 |
| 169 | Ga0496116_0002044 | 3300048919 | Bacteria | 21624 |
| 170 | Ga0496116_0012729 | 3300048919 | Bacteria | 6842 |
| 171 | Ga0496116_0066349 | 3300048919 | Bacteria | 2309 |
| 172 | Ga0496116_0085731 | 3300048919 | Bacteria | 1935 |
| 173 | Ga0496117_0000624 | 3300048920 | Bacteria | 57349 |
| 174 | Ga0496117_0001145 | 3300048920 | Bacteria | 39906 |
| 175 | Ga0496117_0012245 | 3300048920 | Bacteria | 7585 |
| 176 | Ga0496117_0012974 | 3300048920 | Bacteria | 7298 |
| 177 | Ga0496117_0025021 | 3300048920 | Bacteria | 4702 |
| 178 | Ga0496117_0071438 | 3300048920 | Bacteria | 2325 |
| 179 | Ga0496117_0116980 | 3300048920 | Bacteria | 1646 |
| 180 | Ga0496117_0120114 | 3300048920 | Bacteria | 1616 |
| 181 | Ga0496118_0001021 | 3300048921 | Bacteria | 43537 |
| 182 | Ga0496118_0005871 | 3300048921 | Bacteria | 13756 |
| 183 | Ga0496118_0013305 | 3300048921 | Bacteria | 7795 |
| 184 | Ga0496118_0073552 | 3300048921 | Bacteria | 2447 |
| 185 | Ga0496118_0083986 | 3300048921 | Bacteria | 2224 |
| 186 | Ga0496118_0109948 | 3300048921 | Bacteria | 1832 |
| 187 | Ga0496118_0279695 | 3300048921 | Bacteria | 929 |
| 188 | Ga0496118_0283588 | 3300048921 | Bacteria | 920 |
| 189 | Ga0496119_0000013 | 3300048922 | Bacteria | 323820 |
| 190 | Ga0496119_0004545 | 3300048922 | Bacteria | 13747 |
| 191 | Ga0496119_0011998 | 3300048922 | Bacteria | 7093 |
| 192 | Ga0496119_0031020 | 3300048922 | Bacteria | 3591 |
| 193 | Ga0496119_0034563 | 3300048922 | Bacteria | 3325 |
| 194 | Ga0496119_0086401 | 3300048922 | Bacteria | 1792 |
| 195 | Ga0496120_0000026 | 3300048923 | Bacteria | 235131 |
| 196 | Ga0496120_0001499 | 3300048923 | Bacteria | 27638 |
| 197 | Ga0496120_0005227 | 3300048923 | Bacteria | 10438 |
| 198 | Ga0496120_0005709 | 3300048923 | Bacteria | 9818 |
| 199 | Ga0496120_0016028 | 3300048923 | Bacteria | 4913 |
| 200 | Ga0496120_0018001 | 3300048923 | Bacteria | 4564 |
| 201 | Ga0496120_0029137 | 3300048923 | Bacteria | 3372 |
| 202 | Ga0496120_0207152 | 3300048923 | Bacteria | 945 |
| 203 | Ga0496120_0223405 | 3300048923 | Bacteria | 898 |
| 204 | Ga0496121_0000055 | 3300048924 | Bacteria | 304572 |
| 205 | Ga0496121_0012570 | 3300048924 | Bacteria | 9209 |
| 206 | Ga0496121_0013774 | 3300048924 | Bacteria | 8656 |
| 207 | Ga0496121_0027839 | 3300048924 | Bacteria | 5278 |
| 208 | Ga0496121_0056126 | 3300048924 | Bacteria | 3274 |
| 209 | Ga0496121_0097149 | 3300048924 | Unclassified | 2283 |
| 210 | Ga0496121_0195286 | 3300048924 | Unclassified | 1447 |
| 211 | Ga0496122_0000409 | 3300048925 | Bacteria | 91249 |
| 212 | Ga0496122_0007744 | 3300048925 | Bacteria | 11817 |
| 213 | Ga0496122_0014459 | 3300048925 | Bacteria | 7628 |
| 214 | Ga0496122_0015209 | 3300048925 | Bacteria | 7365 |
| 215 | Ga0496122_0016996 | 3300048925 | Bacteria | 6833 |
| 216 | Ga0496122_0022061 | 3300048925 | Bacteria | 5672 |
| 217 | Ga0496122_0030077 | 3300048925 | Bacteria | 4560 |
| 218 | Ga0496122_0030898 | 3300048925 | Bacteria | 4474 |
| 219 | Ga0496122_0047998 | 3300048925 | Bacteria | 3289 |
| 220 | Ga0496122_0106195 | 3300048925 | Bacteria | 1859 |
| 221 | Ga0496122_0196889 | 3300048925 | Bacteria | 1182 |
| 222 | Ga0496122_0351289 | 3300048925 | Bacteria | 769 |
| 223 | Ga0496123_0000334 | 3300048926 | Bacteria | 89471 |
| 224 | Ga0496123_0002199 | 3300048926 | Bacteria | 24807 |
| 225 | Ga0496123_0004052 | 3300048926 | Bacteria | 15790 |
| 226 | Ga0496123_0008144 | 3300048926 | Bacteria | 9677 |
| 227 | Ga0496123_0024064 | 3300048926 | Bacteria | 4640 |
| 228 | Ga0496123_0068856 | 3300048926 | Bacteria | 2226 |
| 229 | Ga0496123_0087247 | 3300048926 | Bacteria | 1867 |
| 230 | Ga0496123_0154506 | 3300048926 | Bacteria | 1232 |
| 231 | Ga0496123_0190235 | 3300048926 | Bacteria | 1062 |
| 232 | Ga0496123_0210563 | 3300048926 | Bacteria | 988 |
| 233 | Ga0496124_0000060 | 3300048927 | Bacteria | 239933 |
| 234 | Ga0496124_0000611 | 3300048927 | Bacteria | 60081 |
| 235 | Ga0496124_0006982 | 3300048927 | Bacteria | 12112 |
| 236 | Ga0496124_0034364 | 3300048927 | Bacteria | 4451 |
| 237 | Ga0496124_0039674 | 3300048927 | Bacteria | 4078 |
| 238 | Ga0496124_0129347 | 3300048927 | Bacteria | 2008 |
| 239 | Ga0496124_0133705 | 3300048927 | Bacteria | 1966 |
| 240 | Ga0496124_0169281 | 3300048927 | Bacteria | 1694 |
| 241 | Ga0496124_0190108 | 3300048927 | Bacteria | 1572 |
| 242 | Ga0496124_0398829 | 3300048927 | Bacteria | 955 |
| 243 | Ga0496124_0494892 | 3300048927 | Bacteria | 821 |
| 244 | Ga0496125_0000253 | 3300048928 | Bacteria | 109929 |
| 245 | Ga0496125_0002641 | 3300048928 | Bacteria | 22925 |
| 246 | Ga0496125_0002762 | 3300048928 | Bacteria | 22212 |
| 247 | Ga0496125_0013114 | 3300048928 | Bacteria | 8171 |
| 248 | Ga0496125_0034259 | 3300048928 | Bacteria | 4478 |
| 249 | Ga0496125_0034491 | 3300048928 | Bacteria | 4460 |
| 250 | Ga0496125_0125140 | 3300048928 | Bacteria | 1823 |
| 251 | Ga0496125_0224869 | 3300048928 | Bacteria | 1205 |
| 252 | Ga0496126_0000313 | 3300048929 | Bacteria | 103014 |
| 253 | Ga0496126_0004089 | 3300048929 | Bacteria | 17673 |
| 254 | Ga0496126_0012235 | 3300048929 | Bacteria | 8802 |
| 255 | Ga0496126_0014195 | 3300048929 | Bacteria | 8061 |
| 256 | Ga0496126_0038825 | 3300048929 | Bacteria | 4426 |
| 257 | Ga0496126_0053862 | 3300048929 | Bacteria | 3647 |
| 258 | Ga0496126_0090174 | 3300048929 | Bacteria | 2697 |
| 259 | Ga0496126_0138644 | 3300048929 | Bacteria | 2095 |
| 260 | Ga0496126_0259819 | 3300048929 | Bacteria | 1444 |
| 261 | Ga0496126_0583716 | 3300048929 | Bacteria | 882 |
| 262 | Ga0495682_0000427 | 3300049460 | Bacteria | 29525 |
| 263 | Ga0501031_0146152 | 3300049568 | Bacteria | 1545 |
| 264 | Ga0501031_0224514 | 3300049568 | Bacteria | 1223 |
| 265 | Ga0501034_0300847 | 3300049571 | Bacteria | 1541 |
| 266 | Ga0501034_0334160 | 3300049571 | Bacteria | 1446 |
| 267 | Ga0501037_0026522 | 3300049573 | Bacteria | 4283 |
| 268 | Ga0501035_0597134 | 3300049822 | Bacteria | 900 |
| 269 | nmdc:mga0k408_4824_c1 | 3300050493 | Bacteria | 7152 |
| 270 | 2511293170 | 2511231011 | Bacteria | 6149768 |
| 271 | 2523470675 | 2523231067 | Bacteria | 5230452 |
| 272 | 2548649455 | 2547132416 | Bacteria | 4633861 |
| 273 | 2552746967 | 2551306352 | Bacteria | 3873115 |
| 274 | 2555259956 | 2554235234 | Bacteria | 5762085 |
| 275 | 2585829253 | 2585427591 | Bacteria | 5482980 |
| 276 | 2585834035 | 2585427592 | Bacteria | 5370892 |
| 277 | 2595452191 | 2593339239 | Bacteria | 4124669 |
| 278 | 2599409286 | 2599185169 | Bacteria | 5441380 |
| 279 | 2601522205 | 2600255254 | Bacteria | 5281859 |
| 280 | 2601527230 | 2600255255 | Bacteria | 5282785 |
| 281 | 2601614060 | 2600255280 | Bacteria | 5292309 |
| 282 | 2601618783 | 2600255281 | Bacteria | 5288753 |
| 283 | 2601642612 | 2600255287 | Bacteria | 5210468 |
| 284 | 2601647460 | 2600255288 | Bacteria | 5282738 |
| 285 | 2601652208 | 2600255289 | Bacteria | 5281907 |
| 286 | 2601657535 | 2600255290 | Bacteria | 5282218 |
| 287 | 2601662433 | 2600255291 | Bacteria | 5217298 |
| 288 | 2601672260 | 2600255292 | Bacteria | 6300551 |
| 289 | 2601695390 | 2600255298 | Bacteria | 5215185 |
| 290 | 2601700066 | 2600255299 | Bacteria | 5218662 |
| 291 | 2601705332 | 2600255300 | Bacteria | 5287774 |
| 292 | 2601710361 | 2600255301 | Bacteria | 5280532 |
| 293 | 2601715373 | 2600255302 | Bacteria | 5288235 |
| 294 | 2601720417 | 2600255303 | Bacteria | 5219315 |
| 295 | 2601725779 | 2600255304 | Bacteria | 5283973 |
| 296 | 2601730321 | 2600255305 | Bacteria | 5282329 |
| 297 | 2601735338 | 2600255306 | Bacteria | 5281613 |
| 298 | 2601740038 | 2600255307 | Bacteria | 5439064 |
| 299 | 2601750527 | 2600255309 | Bacteria | 5431045 |
| 300 | 2602017780 | 2600255392 | Bacteria | 5437392 |
| 301 | 2603644943 | 2602042047 | Bacteria | 4697674 |
| 302 | 2603659803 | 2602042052 | Bacteria | 5215873 |
| 303 | 2603665079 | 2602042053 | Bacteria | 5214361 |
| 304 | 2603705275 | 2602042067 | Bacteria | 4863713 |
| 305 | 2603837709 | 2602042103 | Bacteria | 5284714 |
| 306 | 2603842785 | 2602042104 | Bacteria | 5281639 |
| 307 | 2603847858 | 2602042105 | Bacteria | 5282303 |
| 308 | 2603852929 | 2602042106 | Bacteria | 5282744 |
| 309 | 2603867778 | 2602042109 | Bacteria | 5152801 |
| 310 | 2603870982 | 2602042110 | Bacteria | 5283285 |
| 311 | 2603875896 | 2602042111 | Bacteria | 5212080 |
| 312 | 2606048173 | 2603880178 | Bacteria | 5283018 |
| 313 | 2606069509 | 2603880184 | Bacteria | 5217896 |
| 314 | 2606145321 | 2603880202 | Bacteria | 5284684 |
| 315 | 2606175575 | 2603880211 | Bacteria | 5284226 |
| 316 | 2609913537 | 2609459761 | Bacteria | 5513740 |
| 317 | 2637225188 | 2636415599 | Bacteria | 5718434 |
| 318 | 2676406430 | 2675903046 | Bacteria | 5451247 |
| 319 | 2681996315 | 2681812866 | Bacteria | 4552357 |
| 320 | 2722730018 | 2721755487 | Bacteria | 6357185 |
| 321 | 2739199837 | 2738543004 | Bacteria | 6381073 |
| 322 | 2739351992 | 2738543031 | Bacteria | 5769731 |
| 323 | 2753808440 | 2751185905 | Bacteria | 6142767 |
| 324 | 2753856823 | 2751185917 | Bacteria | 4551186 |
| 325 | 2775541400 | 2775506706 | Bacteria | 4873073 |
| 326 | 2777022805 | 2775507074 | Bacteria | 5532402 |
| 327 | 2808848385 | 2808606359 | Bacteria | 9866990 |
| 328 | 2819657916 | 2818991456 | Bacteria | 6123676 |
| 329 | 2821120947 | 2821118458 | Bacteria | 4714306 |
| 330 | 2826584400 | 2826581358 | Bacteria | 5963467 |
| 331 | 2842849412 | 2842849001 | Bacteria | 5924277 |
| 332 | 2844529541 | 2844528606 | Bacteria | 4733806 |
| 333 | 2847088751 | 2847085930 | Bacteria | 5070450 |
| 334 | 2865014617 | 2865014394 | Bacteria | 4764573 |
| 335 | 2881360118 | 2881359912 | Bacteria | 4935907 |
| 336 | 2884087740 | 2884086401 | Bacteria | 5005459 |
| 337 | 2904513925 | 2904513164 | Bacteria | 5476410 |
| 338 | 2908673721 | 2908669403 | Bacteria | 5740494 |
| 339 | 2916182054 | 2916178963 | Bacteria | 5265078 |
| 340 | 2919111072 | 2919108558 | Bacteria | 5897419 |
| 341 | 2919498070 | 2919497567 | Bacteria | 4408621 |
| 342 | 2927837766 | 2927833300 | Bacteria | 4923934 |
| 343 | 2932416346 | 2932410948 | Bacteria | 6312192 |
| 344 | 2932422261 | 2932416698 | Bacteria | 6315112 |
| 345 | 2935625694 | 2935625433 | Bacteria | 5042964 |
| 346 | 2939575479 | 2939573065 | Bacteria | 4926053 |
| 347 | 2939603536 | 2939602548 | Bacteria | 4950493 |
| 348 | 2939618562 | 2939617950 | Bacteria | 4820956 |
| 349 | 2945877629 | 2945874760 | Bacteria | 5527237 |
| 350 | 2961175820 | 2961170736 | Bacteria | 7072258 |
| 351 | 2968560926 | 2968558590 | Bacteria | 6956864 |
| 352 | 2969082182 | 2969079654 | Bacteria | 5439582 |
| 353 | 2970508485 | 2970503327 | Bacteria | 7099517 |
| 354 | 2971822394 | 2971820967 | Bacteria | 5823634 |
| 355 | 2974439362 | 2974435778 | Bacteria | 4876478 |
| 356 | 2979811866 | 2979808191 | Bacteria | 7179355 |
| 357 | 2984564626 | 2984559226 | Bacteria | 5683096 |
| 358 | 2984597355 | 2984595703 | Bacteria | 5682994 |
| 359 | 3007397028 | 3007395558 | Bacteria | 6755444 |
| 360 | 3007421742 | 3007419365 | Bacteria | 7026924 |
| 361 | 8019505100 | 8019504834 | Bacteria | 4819156 |
| 362 | 8055100921 | 8055097453 | Bacteria | 4865496 |
| 363 | 8055595301 | 8055592153 | Bacteria | 5961247 |
| 364 | 8056134937 | 8056131705 | Bacteria | 6107031 |
| 365 | 8056139651 | 8056137416 | Bacteria | 6147080 |
| 366 | Ga0439452_000037 | |||
| 367 | SwRhRL2b_contig_45605 | |||
| 368 | JGI25152J39213_1004754 | |||
| 369 | rootH2_10008161 | |||
| 370 | Ga0055526_1000827 | |||
| 371 | Ga0055537_1000035 | |||
| 372 | Ga0055537_1000111 | |||
| 373 | Ga0055524_1026068 | |||
| 374 | Ga0055534_1000268 | |||
| 375 | Ga0055528_1000178 | |||
| 376 | Ga0055531_10000139 | |||
| 377 | Ga0058692_1000001 | |||
| 378 | Ga0058692_1000728 | |||
| 379 | Ga0058692_1001769 | |||
| 380 | Ga0058692_1003838 | |||
| 381 | Ga0058692_1006117 | |||
| 382 | Ga0065714_10065231 | |||
| 383 | Ga0065714_10181164 | |||
| 384 | Ga0065704_10003561 | |||
| 385 | Ga0065704_10003739 | |||
| 386 | Ga0065704_10080398 | |||
| 387 | Ga0070668_100024312 | |||
| 388 | Ga0070665_100108306 | |||
| 389 | Ga0070665_100837026 | |||
| 390 | Ga0068855_100001624 | |||
| 391 | Ga0068857_100000333 | |||
| 392 | Ga0068851_10097069 | |||
| 393 | Ga0075366_10098557 | |||
| 394 | Ga0079104_1000258 | |||
| 395 | Ga0079104_1003423 | |||
| 396 | Ga0079104_1004931 | |||
| 397 | Ga0105251_10000800 | |||
| 398 | Ga0105251_10001495 | |||
| 399 | Ga0105251_10005825 | |||
| 400 | Ga0105251_10018142 | |||
| 401 | Ga0105251_10022148 | |||
| 402 | Ga0105251_10188876 | |||
| 403 | Ga0105251_10190530 | |||
| 404 | Ga0105244_10000090 | |||
| 405 | Ga0105244_10001926 | |||
| 406 | Ga0105244_10007690 | |||
| 407 | Ga0105244_10008894 | |||
| 408 | Ga0105244_10018316 | |||
| 409 | Ga0105244_10025275 | |||
| 410 | Ga0105250_10001458 | |||
| 411 | Ga0105250_10027636 | |||
| 412 | Ga0105250_10074284 | |||
| 413 | Ga0105250_10126551 | |||
| 414 | Ga0105243_10000002 | |||
| 415 | Ga0105243_10004216 | |||
| 416 | Ga0105237_10122474 | |||
| 417 | Ga0105246_10098624 | |||
| 418 | Ga0157373_10189598 | |||
| 419 | Ga0157371_10003088 | |||
| 420 | Ga0157371_10008092 | |||
| 421 | Ga0157371_10010301 | |||
| 422 | Ga0157371_10131570 | |||
| 423 | Ga0157371_10132561 | |||
| 424 | Ga0157369_10005828 | |||
| 425 | Ga0157369_10006742 | |||
| 426 | Ga0157369_10126687 | |||
| 427 | Ga0157369_10337929 | |||
| 428 | Ga0163162_10190364 | |||
| 429 | Ga0157372_10000207 | |||
| 430 | Ga0157372_10383761 | |||
| 431 | Ga0182005_1016327 | |||
| 432 | Ga0163161_10093892 | |||
| 433 | Ga0163161_10102872 | |||
| 434 | Ga0213872_10041713 | |||
| 435 | Ga0209566_105327 | |||
| 436 | Ga0209563_100671 | |||
| 437 | Ga0209129_1000037 | |||
| 438 | Ga0209129_1002099 | |||
| 439 | Ga0209565_1000009 | |||
| 440 | Ga0209673_1000036 | |||
| 441 | Ga0209130_1003682 | |||
| 442 | Ga0209675_1000013 | |||
| 443 | Ga0209025_1005473 | |||
| 444 | Ga0209564_1000122 | |||
| 445 | Ga0209758_1011850 | |||
| 446 | Ga0209256_1000106 | |||
| 447 | Ga0209257_1000025 | |||
| 448 | Ga0207656_10064116 | |||
| 449 | Ga0207696_1000532 | |||
| 450 | Ga0207655_1000004 | |||
| 451 | Ga0207655_1000414 | |||
| 452 | Ga0207655_1002982 | |||
| 453 | Ga0207655_1018145 | |||
| 454 | Ga0207655_1040479 | |||
| 455 | Ga0207713_1000052 | |||
| 456 | Ga0207713_1000084 | |||
| 457 | Ga0207713_1000911 | |||
| 458 | Ga0207713_1001772 | |||
| 459 | Ga0207713_1024914 | |||
| 460 | Ga0207713_1025688 | |||
| 461 | Ga0207713_1027517 | |||
| 462 | Ga0207713_1075548 | |||
| 463 | Ga0207706_10290103 | |||
| 464 | Ga0207709_10000003 | |||
| 465 | Ga0207709_10037916 | |||
| 466 | Ga0207709_10059499 | |||
| 467 | Ga0207667_10013911 | |||
| 468 | Ga0207668_10039926 | |||
| 469 | Ga0207674_10000573 | |||
| 470 | Ga0209281_1000014 | |||
| 471 | Ga0209281_1000694 | |||
| 472 | Ga0209281_1000749 | |||
| 473 | Ga0209371_1000001 | |||
| 474 | Ga0209371_1000008 | |||
| 475 | Ga0209371_1000015 | |||
| 476 | Ga0209371_1000206 | |||
| 477 | Ga0209371_1001282 | |||
| 478 | Ga0209371_1001555 | |||
| 479 | Ga0209371_1015048 | |||
| 480 | Ga0209371_1025945 | |||
| 481 | Ga0268266_10230715 | |||
| 482 | Ga0268266_10754289 | |||
| 483 | Ga0268256_1000001 | |||
| 484 | Ga0268256_1000009 | |||
| 485 | Ga0268256_1000018 | |||
| 486 | Ga0268256_1000241 | |||
| 487 | Ga0268256_1000572 | |||
| 488 | Ga0268256_1001329 | |||
| 489 | Ga0268256_1016663 | |||
| 490 | Ga0268256_1033340 | |||
| 491 | Ga0307507_10033000 | |||
| 492 | Ga0316584_0056435 | |||
| 493 | Ga0395900_0019439 | |||
| 494 | Ga0395905_0222105 | |||
| 495 | Ga0436361_0257013 | |||
| 496 | Ga0439438_000075 | |||
| 497 | Ga0439438_000279 | |||
| 498 | Ga0439438_003733 | |||
| 499 | Ga0439438_008230 | |||
| 500 | Ga0439447_000370 | |||
| 501 | Ga0439466_0001766 | |||
| 502 | Ga0439432_009716 | |||
| 503 | Ga0439432_034315 | |||
| 504 | Ga0439464_0008035 | |||
| 505 | Ga0466981_0000003 | |||
| 506 | Ga0453684_0218252 | |||
| 507 | Ga0495590_0000715 | |||
| 508 | Ga0495590_0001370 | |||
| 509 | Ga0495638_0003671 | |||
| 510 | Ga0495650_0004533 | |||
| 511 | Ga0495584_0016819 | |||
| 512 | Ga0495607_0000259 | |||
| 513 | Ga0495607_0000686 | |||
| 514 | Ga0495606_0025332 | |||
| 515 | Ga0495610_0000437 | |||
| 516 | Ga0495616_0000156 | |||
| 517 | Ga0495637_0001229 | |||
| 518 | Ga0495654_0002777 | |||
| 519 | Ga0495654_0007160 | |||
| 520 | Ga0495654_0019684 | |||
| 521 | Ga0495597_0001721 | |||
| 522 | Ga0495671_0004862 | |||
| 523 | Ga0495660_0007494 | |||
| 524 | Ga0495660_0008905 | |||
| 525 | Ga0495672_0000009 | |||
| 526 | Ga0495672_0000037 | |||
| 527 | Ga0495679_027137 | |||
| 528 | Ga0495679_032251 | |||
| 529 | Ga0495681_0000109 | |||
| 530 | Ga0496104_0000385 | |||
| 531 | Ga0496105_0015233 | |||
| 532 | Ga0496105_0033175 | |||
| 533 | Ga0496116_0000073 | |||
| 534 | Ga0496116_0002044 | |||
| 535 | Ga0496116_0012729 | |||
| 536 | Ga0496116_0066349 | |||
| 537 | Ga0496116_0085731 | |||
| 538 | Ga0496117_0000624 | |||
| 539 | Ga0496117_0001145 | |||
| 540 | Ga0496117_0012245 | |||
| 541 | Ga0496117_0012974 | |||
| 542 | Ga0496117_0025021 | |||
| 543 | Ga0496117_0071438 | |||
| 544 | Ga0496117_0116980 | |||
| 545 | Ga0496117_0120114 | |||
| 546 | Ga0496118_0001021 | |||
| 547 | Ga0496118_0005871 | |||
| 548 | Ga0496118_0013305 | |||
| 549 | Ga0496118_0073552 | |||
| 550 | Ga0496118_0083986 | |||
| 551 | Ga0496118_0109948 | |||
| 552 | Ga0496118_0279695 | |||
| 553 | Ga0496118_0283588 | |||
| 554 | Ga0496119_0000013 | |||
| 555 | Ga0496119_0004545 | |||
| 556 | Ga0496119_0011998 | |||
| 557 | Ga0496119_0031020 | |||
| 558 | Ga0496119_0034563 | |||
| 559 | Ga0496119_0086401 | |||
| 560 | Ga0496120_0000026 | |||
| 561 | Ga0496120_0001499 | |||
| 562 | Ga0496120_0005227 | |||
| 563 | Ga0496120_0005709 | |||
| 564 | Ga0496120_0016028 | |||
| 565 | Ga0496120_0018001 | |||
| 566 | Ga0496120_0029137 | |||
| 567 | Ga0496120_0207152 | |||
| 568 | Ga0496120_0223405 | |||
| 569 | Ga0496121_0000055 | |||
| 570 | Ga0496121_0012570 | |||
| 571 | Ga0496121_0013774 | |||
| 572 | Ga0496121_0027839 | |||
| 573 | Ga0496121_0056126 | |||
| 574 | Ga0496121_0097149 | |||
| 575 | Ga0496121_0195286 | |||
| 576 | Ga0496122_0000409 | |||
| 577 | Ga0496122_0007744 | |||
| 578 | Ga0496122_0014459 | |||
| 579 | Ga0496122_0015209 | |||
| 580 | Ga0496122_0016996 | |||
| 581 | Ga0496122_0022061 | |||
| 582 | Ga0496122_0030077 | |||
| 583 | Ga0496122_0030898 | |||
| 584 | Ga0496122_0047998 | |||
| 585 | Ga0496122_0106195 | |||
| 586 | Ga0496122_0196889 | |||
| 587 | Ga0496122_0351289 | |||
| 588 | Ga0496123_0000334 | |||
| 589 | Ga0496123_0002199 | |||
| 590 | Ga0496123_0004052 | |||
| 591 | Ga0496123_0008144 | |||
| 592 | Ga0496123_0024064 | |||
| 593 | Ga0496123_0068856 | |||
| 594 | Ga0496123_0087247 | |||
| 595 | Ga0496123_0154506 | |||
| 596 | Ga0496123_0190235 | |||
| 597 | Ga0496123_0210563 | |||
| 598 | Ga0496124_0000060 | |||
| 599 | Ga0496124_0000611 | |||
| 600 | Ga0496124_0006982 | |||
| 601 | Ga0496124_0034364 | |||
| 602 | Ga0496124_0039674 | |||
| 603 | Ga0496124_0129347 | |||
| 604 | Ga0496124_0133705 | |||
| 605 | Ga0496124_0169281 | |||
| 606 | Ga0496124_0190108 | |||
| 607 | Ga0496124_0398829 | |||
| 608 | Ga0496124_0494892 | |||
| 609 | Ga0496125_0000253 | |||
| 610 | Ga0496125_0002641 | |||
| 611 | Ga0496125_0002762 | |||
| 612 | Ga0496125_0013114 | |||
| 613 | Ga0496125_0034259 | |||
| 614 | Ga0496125_0034491 | |||
| 615 | Ga0496125_0125140 | |||
| 616 | Ga0496125_0224869 | |||
| 617 | Ga0496126_0000313 | |||
| 618 | Ga0496126_0004089 | |||
| 619 | Ga0496126_0012235 | |||
| 620 | Ga0496126_0014195 | |||
| 621 | Ga0496126_0038825 | |||
| 622 | Ga0496126_0053862 | |||
| 623 | Ga0496126_0090174 | |||
| 624 | Ga0496126_0138644 | |||
| 625 | Ga0496126_0259819 | |||
| 626 | Ga0496126_0583716 | |||
| 627 | Ga0495682_0000427 | |||
| 628 | Ga0501031_0146152 | |||
| 629 | Ga0501031_0224514 | |||
| 630 | Ga0501034_0300847 | |||
| 631 | Ga0501034_0334160 | |||
| 632 | Ga0501037_0026522 | |||
| 633 | Ga0501035_0597134 | |||
| 634 | nmdc:mga0k408_4824_c1 | |||
| 635 | 2511293170 | |||
| 636 | 2523470675 | |||
| 637 | 2548649455 | |||
| 638 | 2552746967 | |||
| 639 | 2555259956 | |||
| 640 | 2585829253 | |||
| 641 | 2585834035 | |||
| 642 | 2595452191 | |||
| 643 | 2599409286 | |||
| 644 | 2601522205 | |||
| 645 | 2601527230 | |||
| 646 | 2601614060 | |||
| 647 | 2601618783 | |||
| 648 | 2601642612 | |||
| 649 | 2601647460 | |||
| 650 | 2601652208 | |||
| 651 | 2601657535 | |||
| 652 | 2601662433 | |||
| 653 | 2601672260 | |||
| 654 | 2601695390 | |||
| 655 | 2601700066 | |||
| 656 | 2601705332 | |||
| 657 | 2601710361 | |||
| 658 | 2601715373 | |||
| 659 | 2601720417 | |||
| 660 | 2601725779 | |||
| 661 | 2601730321 | |||
| 662 | 2601735338 | |||
| 663 | 2601740038 | |||
| 664 | 2601750527 | |||
| 665 | 2602017780 | |||
| 666 | 2603644943 | |||
| 667 | 2603659803 | |||
| 668 | 2603665079 | |||
| 669 | 2603705275 | |||
| 670 | 2603837709 | |||
| 671 | 2603842785 | |||
| 672 | 2603847858 | |||
| 673 | 2603852929 | |||
| 674 | 2603867778 | |||
| 675 | 2603870982 | |||
| 676 | 2603875896 | |||
| 677 | 2606048173 | |||
| 678 | 2606069509 | |||
| 679 | 2606145321 | |||
| 680 | 2606175575 | |||
| 681 | 2609913537 | |||
| 682 | 2637225188 | |||
| 683 | 2676406430 | |||
| 684 | 2681996315 | |||
| 685 | 2722730018 | |||
| 686 | 2739199837 | |||
| 687 | 2739351992 | |||
| 688 | 2753808440 | |||
| 689 | 2753856823 | |||
| 690 | 2775541400 | |||
| 691 | 2777022805 | |||
| 692 | 2808848385 | |||
| 693 | 2819657916 | |||
| 694 | 2821120947 | |||
| 695 | 2826584400 | |||
| 696 | 2842849412 | |||
| 697 | 2844529541 | |||
| 698 | 2847088751 | |||
| 699 | 2865014617 | |||
| 700 | 2881360118 | |||
| 701 | 2884087740 | |||
| 702 | 2904513925 | |||
| 703 | 2908673721 | |||
| 704 | 2916182054 | |||
| 705 | 2919111072 | |||
| 706 | 2919498070 | |||
| 707 | 2927837766 | |||
| 708 | 2932416346 | |||
| 709 | 2932422261 | |||
| 710 | 2935625694 | |||
| 711 | 2939575479 | |||
| 712 | 2939603536 | |||
| 713 | 2939618562 | |||
| 714 | 2945877629 | |||
| 715 | 2961175820 | |||
| 716 | 2968560926 | |||
| 717 | 2969082182 | |||
| 718 | 2970508485 | |||
| 719 | 2971822394 | |||
| 720 | 2974439362 | |||
| 721 | 2979811866 | |||
| 722 | 2984564626 | |||
| 723 | 2984597355 | |||
| 724 | 3007397028 | |||
| 725 | 3007421742 | |||
| 726 | 8019505100 | |||
| 727 | 8055100921 | |||
| 728 | 8055595301 | |||
| 729 | 8056134937 | |||
| 730 | 8056139651 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3l7n-assembly1.cif.gz_A | crystal structure of smu.1228c | 0.9917 | 12 | 244 |
| 3l7n-assembly1.cif.gz_A | crystal structure of smu.1228c | 0.9833 | 12 | 244 |
| 1o1y-assembly1.cif.gz_A | crystal structure of a glutamine amidotransferase (tm1158) from thermotoga maritima at 1.70 a resolution | 0.8983 | 10 | 243 |
| 3m3p-assembly1.cif.gz_A | crystal structure of glutamine amido transferase from methylobacillus flagellatus | 0.8935 | 10 | 245 |
| 1o1y-assembly1.cif.gz_A | crystal structure of a glutamine amidotransferase (tm1158) from thermotoga maritima at 1.70 a resolution | 0.8799 | 10 | 243 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3l7nA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9917 | 12 | 244 | 3.40.50.880 |
| 3l7nA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9833 | 12 | 244 | 3.40.50.880 |
| 1o1yA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.8918 | 10 | 243 | 3.40.50.880 |
| 1o1yA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.877 | 10 | 243 | 3.40.50.880 |
| 3l83A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.8402 | 14 | 247 | 3.40.50.880 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W7IZH6-F1-model_v4 | GMP synthase (Glutamine-hydrolyzing) (EC 6.3.5.2) | 0.9974 | 12 | 248 |
GO:0003922
GO:0005829 GO:0006541 |
| AF-A0A7H8WDY2-F1-model_v4 | Type 1 glutamine amidotransferase | 0.9974 | 12 | 248 |
GO:0005829
GO:0006541 GO:0016740 |
| AF-A0A379VMW0-F1-model_v4 | Glutamine amidotransferase (EC 6.3.5.2) | 0.9947 | 12 | 197 |
GO:0003922
GO:0005829 GO:0006541 GO:0016740 |
| AF-A0A359YGI2-F1-model_v4 | deleted | 0.9944 | 58 | 244 |
|
| AF-A0A154UDN3-F1-model_v4 | deleted | 0.9941 | 11 | 243 |
|