F423772

General Info

Members Datasets Scaffolds Average Seq Length
365 148 730 260

Family's Representative Sequence

Representative Sequence 3300044658|Ga0466972_0036304|Ga0466972_0036304_814_1602
Length 262
Sequence MRTTKELFDLTGRTALVTGGSRGLGLQIAEAIGELGGKVVLSSRKQEDLDEAVAHLKTRGIEASAIAADLSKETSINPLVDETLKRLGRIDILVNNAGASWGAPAEDYPLEAWDKVMNLNVRSIFLLSQAVGKRSMIPREYGKIINVASIAGLFGNMPDSAMQTVAYNTSKAAVINFTRTLAGEWGKYGITVNAIAPGFFPSKMTKGLMQQVGAENIAKHAPLLRIGDDEDLKGITALFASDASKHITGQVMAVDGGVSAVH

Samples

Sample ID Description Type Environment
1 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
2 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
19 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
20 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
21 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
22 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
23 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
24 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
25 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
26 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
27 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
28 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
29 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
30 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
31 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
32 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
33 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
35 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
36 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
41 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
42 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
43 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
44 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
45 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
46 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
47 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
48 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
49 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
50 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
51 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
52 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
53 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
54 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
55 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
56 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
57 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
58 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
59 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
60 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
61 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
62 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
63 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
64 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
65 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
66 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
67 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
68 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
69 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
70 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
71 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
72 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
73 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
74 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
75 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
76 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
77 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
78 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
79 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
80 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
81 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
82 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
83 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
84 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
85 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
86 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
87 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
88 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
89 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
90 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
91 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
92 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
93 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
94 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
95 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
96 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
97 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
98 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
99 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
100 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
101 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
102 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
103 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
104 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
105 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
106 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
107 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
108 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
109 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
110 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
111 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
112 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
113 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
114 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
115 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
116 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
117 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
118 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
119 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
120 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
121 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
122 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
123 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
124 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
125 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
126 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
127 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
128 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
129 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
130 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
131 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
134 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
135 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
136 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
137 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
138 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
141 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
142 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
143 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
144 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
147 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
148 2643221638 Duganella sp. Root336D2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.63
Metatranscriptomes 0.55
Isolates 0.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.53
Nodule 0
Rhizoplane 3.56
Rhizosphere 76.99
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466972_0036304 3300044658 Bacteria 2412
2 JGI25150J39212_1000549 3300002774 Bacteria 15158
3 JGI25159J45721_1002170 3300002987 Bacteria 7645
4 JGI25159J45721_1025164 3300002987 Bacteria 1048
5 JGI25151J46595_10017026 3300003187 Bacteria 3165
6 JGI25153J46596_10011033 3300003215 Bacteria 4028
7 JGI25160J50197_1022264 3300003354 Bacteria 1861
8 JGI25161J50226_1000266 3300003374 Bacteria 30738
9 JGI25161J50226_1002117 3300003374 Bacteria 5343
10 Ga0055526_1013126 3300003771 Bacteria 3535
11 Ga0055537_1000044 3300003773 Bacteria 90696
12 Ga0055537_1009476 3300003773 Bacteria 2144
13 Ga0055524_1002445 3300003775 Bacteria 9574
14 Ga0055524_1003807 3300003775 Bacteria 7164
15 Ga0055524_1013832 3300003775 Bacteria 3019
16 Ga0055534_1001834 3300003784 Bacteria 7934
17 Ga0055534_1002186 3300003784 Bacteria 6981
18 Ga0055534_1013716 3300003784 Bacteria 1546
19 Ga0055528_1000011 3300003790 Bacteria 218512
20 Ga0055528_1028437 3300003790 Bacteria 1541
21 Ga0055530_10000499 3300003791 Bacteria 34011
22 Ga0055530_10007207 3300003791 Bacteria 4745
23 Ga0055531_10004666 3300003794 Bacteria 8214
24 Ga0055543_1000339 3300004625 Bacteria 31976
25 Ga0055543_1025923 3300004625 Bacteria 1045
26 Ga0065165_1000007 3300005262 Bacteria 337871
27 Ga0065165_1001110 3300005262 Bacteria 31976
28 Ga0070682_100013207 3300005337 Bacteria 4747
29 Ga0070712_100311005 3300006175 Bacteria 1278
30 Ga0105241_10572770 3300009174 Bacteria 1017
31 Ga0157371_10000149 3300013102 Bacteria 101593
32 Ga0182008_10070153 3300014497 Bacteria 1724
33 Ga0182006_1063494 3300015261 Bacteria 1387
34 Ga0209436_100554 3300025208 Bacteria 16204
35 Ga0209436_100859 3300025208 Bacteria 12186
36 Ga0207425_1000001 3300025245 Bacteria 2525432
37 Ga0207425_1000067 3300025245 Bacteria 124459
38 Ga0209129_1000003 3300025258 Bacteria 903689
39 Ga0209129_1001364 3300025258 Bacteria 13741
40 Ga0209565_1000003 3300025263 Bacteria 1099648
41 Ga0209565_1001086 3300025263 Bacteria 13571
42 Ga0209565_1001429 3300025263 Bacteria 10553
43 Ga0209565_1007596 3300025263 Bacteria 2910
44 Ga0209565_1009905 3300025263 Bacteria 2388
45 Ga0209673_1000003 3300025273 Bacteria 980859
46 Ga0209673_1011123 3300025273 Bacteria 3734
47 Ga0209130_1000047 3300025284 Bacteria 234691
48 Ga0209130_1000059 3300025284 Bacteria 204772
49 Ga0209130_1001599 3300025284 Bacteria 14146
50 Ga0209675_1000003 3300025291 Bacteria 1003982
51 Ga0209675_1005797 3300025291 Bacteria 5086
52 Ga0209675_1013798 3300025291 Bacteria 2500
53 Ga0209025_1000718 3300025294 Bacteria 56292
54 Ga0209564_1000012 3300025295 Bacteria 792078
55 Ga0209564_1000142 3300025295 Bacteria 178742
56 Ga0209564_1003831 3300025295 Bacteria 9730
57 Ga0209564_1034530 3300025295 Bacteria 1481
58 Ga0209758_1000098 3300025297 Bacteria 230499
59 Ga0209050_1000058 3300025298 Bacteria 325558
60 Ga0209050_1000654 3300025298 Bacteria 53586
61 Ga0209050_1001112 3300025298 Bacteria 32536
62 Ga0209050_1001305 3300025298 Bacteria 28023
63 Ga0209256_1000029 3300025299 Bacteria 415922
64 Ga0209256_1000186 3300025299 Bacteria 119070
65 Ga0209256_1000875 3300025299 Bacteria 37255
66 Ga0207426_1001774 3300025302 Bacteria 16264
67 Ga0209051_1020891 3300025303 Bacteria 2804
68 Ga0209257_1000003 3300025304 Bacteria 1702593
69 Ga0209257_1002931 3300025304 Bacteria 15718
70 Ga0209257_1003953 3300025304 Bacteria 12031
71 Ga0207693_10303808 3300025915 Bacteria 1250
72 Ga0207698_10022051 3300026142 Bacteria 4418
73 Ga0316182_1246430 3300030745 Bacteria 2023
74 Ga0307509_10400766 3300031507 Bacteria 1079
75 Ga0307408_100000082 3300031548 Bacteria 106847
76 Ga0307408_100058824 3300031548 Bacteria 2795
77 Ga0395899_0001402 3300037312 Bacteria 20666
78 Ga0395899_0004872 3300037312 Bacteria 10454
79 Ga0395899_0007376 3300037312 Bacteria 8500
80 Ga0395899_0197536 3300037312 Bacteria 1404
81 Ga0395899_0249575 3300037312 Bacteria 1218
82 Ga0395900_0018511 3300037418 Bacteria 7103
83 Ga0395900_0217093 3300037418 Bacteria 1929
84 Ga0395898_0229288 3300037466 Bacteria 1771
85 Ga0395898_0336473 3300037466 Bacteria 1439
86 Ga0395905_0003674 3300037471 Bacteria 16267
87 Ga0395905_0022941 3300037471 Bacteria 5898
88 Ga0395905_0114606 3300037471 Bacteria 2532
89 Ga0395905_0696180 3300037471 Bacteria 918
90 Ga0395901_0026078 3300038443 Bacteria 6001
91 Ga0395901_0053884 3300038443 Bacteria 4180
92 Ga0395901_0248548 3300038443 Bacteria 1853
93 Ga0436361_0167113 3300039447 Bacteria 5758
94 Ga0436361_0582900 3300039447 Bacteria 8543
95 Ga0436361_0742159 3300039447 Bacteria 3785
96 Ga0450904_001169 3300042139 Bacteria 3985
97 Ga0450893_0004911 3300042532 Bacteria 2135
98 Ga0466972_0005099 3300044658 Bacteria 6581
99 Ga0466965_0007849 3300044683 Bacteria 4921
100 Ga0466965_0038367 3300044683 Bacteria 2353
101 Ga0466971_0124024 3300044719 Bacteria 1197
102 Ga0466968_0015750 3300044735 Bacteria 3002
103 Ga0451576_0090282 3300045051 Bacteria 3187
104 Ga0466958_0249339 3300045836 Bacteria 1135
105 Ga0466967_0151479 3300045976 Bacteria 2168
106 Ga0495627_003603 3300046453 Bacteria 6752
107 Ga0495603_0089280 3300046455 Bacteria 1803
108 Ga0495590_0009070 3300046457 Bacteria 3778
109 Ga0495590_0038588 3300046457 Bacteria 1666
110 Ga0495638_0022329 3300046460 Bacteria 4155
111 Ga0495638_0101332 3300046460 Bacteria 1722
112 Ga0495653_0013488 3300046463 Bacteria 6659
113 Ga0495650_0000001 3300046471 Bacteria 1085492
114 Ga0495580_0004208 3300046472 Bacteria 12101
115 Ga0495582_0017054 3300046473 Bacteria 3976
116 Ga0495605_0014258 3300046474 Bacteria 4357
117 Ga0495605_0111565 3300046474 Bacteria 1247
118 Ga0495584_0000002 3300046491 Bacteria 512179
119 Ga0495584_0000028 3300046491 Bacteria 111816
120 Ga0495584_0002511 3300046491 Bacteria 10397
121 Ga0495584_0039440 3300046491 Bacteria 2385
122 Ga0495584_0045374 3300046491 Bacteria 2217
123 Ga0495584_0057700 3300046491 Bacteria 1953
124 Ga0495584_0122619 3300046491 Bacteria 1316
125 Ga0495584_0164537 3300046491 Bacteria 1127
126 Ga0495585_0000038 3300046492 Bacteria 131919
127 Ga0495585_0000187 3300046492 Bacteria 66273
128 Ga0495585_0000188 3300046492 Bacteria 66122
129 Ga0495585_0000325 3300046492 Bacteria 46819
130 Ga0495585_0001769 3300046492 Bacteria 16401
131 Ga0495585_0005991 3300046492 Bacteria 7606
132 Ga0495585_0012043 3300046492 Bacteria 5104
133 Ga0495585_0024942 3300046492 Bacteria 3427
134 Ga0495585_0041051 3300046492 Bacteria 2595
135 Ga0495585_0045950 3300046492 Bacteria 2436
136 Ga0495585_0135666 3300046492 Bacteria 1292
137 Ga0495585_0154138 3300046492 Bacteria 1196
138 Ga0495594_0000521 3300046499 Bacteria 19714
139 Ga0495594_0036177 3300046499 Bacteria 2691
140 Ga0495594_0077677 3300046499 Bacteria 1852
141 Ga0495594_0119925 3300046499 Bacteria 1486
142 Ga0495596_0000017 3300046500 Bacteria 114761
143 Ga0495596_0000116 3300046500 Bacteria 55099
144 Ga0495596_0000362 3300046500 Bacteria 29160
145 Ga0495596_0003264 3300046500 Bacteria 8285
146 Ga0495596_0005466 3300046500 Bacteria 5997
147 Ga0495596_0009184 3300046500 Bacteria 4361
148 Ga0495596_0012976 3300046500 Bacteria 3549
149 Ga0495596_0027630 3300046500 Bacteria 2280
150 Ga0495596_0028974 3300046500 Bacteria 2221
151 Ga0495596_0055932 3300046500 Bacteria 1541
152 Ga0495596_0107720 3300046500 Bacteria 1082
153 Ga0495607_0019506 3300046501 Bacteria 4306
154 Ga0495607_0021740 3300046501 Bacteria 4034
155 Ga0495607_0026968 3300046501 Bacteria 3559
156 Ga0495607_0059978 3300046501 Bacteria 2167
157 Ga0495583_0000009 3300046506 Bacteria 372527
158 Ga0495583_0002668 3300046506 Bacteria 14852
159 Ga0495583_0004155 3300046506 Bacteria 10583
160 Ga0495583_0028353 3300046506 Bacteria 2754
161 Ga0495583_0040366 3300046506 Bacteria 2193
162 Ga0495583_0047350 3300046506 Bacteria 1978
163 Ga0495606_0017971 3300046507 Bacteria 5320
164 Ga0495606_0024889 3300046507 Bacteria 4301
165 Ga0495616_0000102 3300046513 Bacteria 73446
166 Ga0495616_0003229 3300046513 Bacteria 10492
167 Ga0495616_0007875 3300046513 Bacteria 6355
168 Ga0495616_0087210 3300046513 Bacteria 1483
169 Ga0495616_0133305 3300046513 Bacteria 1136
170 Ga0495620_0008218 3300046515 Bacteria 5612
171 Ga0495631_0000745 3300046518 Bacteria 20926
172 Ga0495631_0002287 3300046518 Bacteria 10959
173 Ga0495631_0011940 3300046518 Bacteria 4259
174 Ga0495631_0012524 3300046518 Bacteria 4138
175 Ga0495631_0016973 3300046518 Bacteria 3454
176 Ga0495631_0017150 3300046518 Bacteria 3431
177 Ga0495631_0020334 3300046518 Bacteria 3102
178 Ga0495631_0028886 3300046518 Bacteria 2527
179 Ga0495632_0000133 3300046519 Bacteria 75692
180 Ga0495632_0001962 3300046519 Bacteria 16384
181 Ga0495632_0008911 3300046519 Bacteria 6096
182 Ga0495643_0000096 3300046522 Bacteria 146041
183 Ga0495643_0022878 3300046522 Bacteria 3559
184 Ga0495643_0064706 3300046522 Bacteria 1931
185 Ga0495643_0202034 3300046522 Bacteria 953
186 Ga0495644_0006108 3300046523 Bacteria 4682
187 Ga0495644_0009064 3300046523 Bacteria 3830
188 Ga0495644_0043341 3300046523 Bacteria 1693
189 Ga0495644_0049044 3300046523 Bacteria 1586
190 Ga0495644_0075734 3300046523 Bacteria 1267
191 Ga0495644_0135261 3300046523 Bacteria 940
192 Ga0495648_0014838 3300046524 Bacteria 5676
193 Ga0495648_0018553 3300046524 Bacteria 4920
194 Ga0495648_0020626 3300046524 Bacteria 4589
195 Ga0495648_0025220 3300046524 Bacteria 4030
196 Ga0495648_0061084 3300046524 Bacteria 2239
197 Ga0495663_0046191 3300046525 Bacteria 1337
198 Ga0495666_0000577 3300046526 Bacteria 16399
199 Ga0495666_0005743 3300046526 Bacteria 6254
200 Ga0495642_0003439 3300046528 Bacteria 6235
201 Ga0495642_0006524 3300046528 Bacteria 4474
202 Ga0495642_0013874 3300046528 Bacteria 3120
203 Ga0495642_0020186 3300046528 Bacteria 2615
204 Ga0495642_0037842 3300046528 Bacteria 1953
205 Ga0495642_0050856 3300046528 Bacteria 1704
206 Ga0495642_0053601 3300046528 Bacteria 1662
207 Ga0495642_0087975 3300046528 Bacteria 1313
208 Ga0495654_0012892 3300046530 Bacteria 4482
209 Ga0495665_0004255 3300046531 Bacteria 7732
210 Ga0495665_0013689 3300046531 Bacteria 4382
211 Ga0495665_0137903 3300046531 Bacteria 1276
212 Ga0495640_0101214 3300046533 Bacteria 1891
213 Ga0495586_0099545 3300046535 Bacteria 1612
214 Ga0495609_0004306 3300046538 Bacteria 7833
215 Ga0495609_0005293 3300046538 Bacteria 6835
216 Ga0495609_0020957 3300046538 Bacteria 3016
217 Ga0495609_0077350 3300046538 Bacteria 1457
218 Ga0495621_0006593 3300046539 Bacteria 3398
219 Ga0495597_0000650 3300046542 Bacteria 28233
220 Ga0495597_0001181 3300046542 Bacteria 19574
221 Ga0495597_0003417 3300046542 Bacteria 9279
222 Ga0495597_0008638 3300046542 Bacteria 5094
223 Ga0495597_0009282 3300046542 Bacteria 4869
224 Ga0495597_0064907 3300046542 Bacteria 1584
225 Ga0495645_0244754 3300046543 Bacteria 1195
226 Ga0495622_0007801 3300046557 Bacteria 4970
227 Ga0495633_0002027 3300046558 Bacteria 14623
228 Ga0495633_0002874 3300046558 Bacteria 11807
229 Ga0495633_0006564 3300046558 Bacteria 6876
230 Ga0495633_0017549 3300046558 Bacteria 3657
231 Ga0495633_0086529 3300046558 Bacteria 1457
232 Ga0495633_0092248 3300046558 Bacteria 1407
233 Ga0495656_0017083 3300046615 Bacteria 2763
234 Ga0495656_0055359 3300046615 Bacteria 1710
235 Ga0495668_0000020 3300046616 Bacteria 411641
236 Ga0495668_0000052 3300046616 Bacteria 212864
237 Ga0495668_0009891 3300046616 Bacteria 5816
238 Ga0495668_0019710 3300046616 Bacteria 3884
239 Ga0495668_0027286 3300046616 Bacteria 3236
240 Ga0495668_0028822 3300046616 Bacteria 3138
241 Ga0495668_0037360 3300046616 Bacteria 2716
242 Ga0495668_0061973 3300046616 Bacteria 2061
243 Ga0495668_0066495 3300046616 Bacteria 1983
244 Ga0495668_0129240 3300046616 Bacteria 1383
245 Ga0495668_0334393 3300046616 Bacteria 831
246 Ga0495634_0122219 3300046642 Bacteria 1667
247 Ga0495611_0006162 3300046648 Bacteria 5118
248 Ga0495611_0077260 3300046648 Bacteria 1527
249 Ga0495611_0119863 3300046648 Bacteria 1226
250 Ga0495611_0128834 3300046648 Bacteria 1180
251 Ga0495611_0195890 3300046648 Bacteria 943
252 Ga0495625_0067000 3300046660 Bacteria 2528
253 Ga0495625_0070341 3300046660 Bacteria 2457
254 Ga0495625_0117672 3300046660 Bacteria 1811
255 Ga0495635_0072145 3300046663 Bacteria 2366
256 Ga0495659_0029054 3300046664 Bacteria 1917
257 Ga0495659_0096333 3300046664 Bacteria 1142
258 Ga0495661_0001589 3300046665 Bacteria 18719
259 Ga0495661_0005420 3300046665 Bacteria 9063
260 Ga0495661_0021325 3300046665 Bacteria 4225
261 Ga0495661_0024131 3300046665 Bacteria 3938
262 Ga0495661_0076054 3300046665 Bacteria 1949
263 Ga0495661_0145117 3300046665 Bacteria 1287
264 Ga0495588_0019914 3300046674 Bacteria 3292
265 Ga0495588_0037351 3300046674 Bacteria 2467
266 Ga0495588_0044011 3300046674 Bacteria 2285
267 Ga0495588_0069188 3300046674 Bacteria 1834
268 Ga0495588_0091971 3300046674 Bacteria 1589
269 Ga0495646_0123789 3300046680 Bacteria 1461
270 Ga0495669_0000040 3300046684 Bacteria 90851
271 Ga0495669_0001604 3300046684 Bacteria 9283
272 Ga0495624_0103657 3300046690 Bacteria 1750
273 Ga0495670_0000173 3300046691 Bacteria 28767
274 Ga0495670_0000390 3300046691 Bacteria 20896
275 Ga0495670_0001692 3300046691 Bacteria 10834
276 Ga0495670_0011400 3300046691 Bacteria 4372
277 Ga0495670_0033198 3300046691 Bacteria 2568
278 Ga0495670_0035406 3300046691 Bacteria 2488
279 Ga0495670_0113222 3300046691 Bacteria 1405
280 Ga0495670_0129220 3300046691 Bacteria 1316
281 Ga0495671_0000877 3300046692 Bacteria 21472
282 Ga0495671_0091608 3300046692 Bacteria 1488
283 Ga0495649_0207096 3300046694 Bacteria 1017
284 Ga0495589_0000304 3300046794 Bacteria 39263
285 Ga0495589_0076404 3300046794 Bacteria 1633
286 Ga0495589_0093077 3300046794 Bacteria 1463
287 Ga0495589_0101611 3300046794 Bacteria 1391
288 Ga0495589_0137306 3300046794 Bacteria 1172
289 Ga0495660_0047442 3300046810 Bacteria 2352
290 Ga0495660_0088374 3300046810 Bacteria 1614
291 Ga0495604_0004363 3300047317 Bacteria 11202
292 Ga0495604_0430370 3300047317 Bacteria 865
293 Ga0495636_0099837 3300047318 Bacteria 1268
294 Ga0495672_0000445 3300047320 Bacteria 49224
295 Ga0495672_0070174 3300047320 Bacteria 1986
296 Ga0495672_0115317 3300047320 Bacteria 1436
297 Ga0495676_0000007 3300047321 Bacteria 276148
298 Ga0495676_0215424 3300047321 Bacteria 1326
299 Ga0495680_0008586 3300047322 Bacteria 9275
300 Ga0495683_0000133 3300047323 Bacteria 72553
301 Ga0495683_0007510 3300047323 Bacteria 5887
302 Ga0495683_0021530 3300047323 Bacteria 3322
303 Ga0495683_0084087 3300047323 Bacteria 1549
304 Ga0495683_0115429 3300047323 Bacteria 1278
305 Ga0495687_000150 3300047443 Bacteria 105759
306 Ga0495687_000411 3300047443 Bacteria 53055
307 Ga0495687_003977 3300047443 Bacteria 10310
308 Ga0495687_049560 3300047443 Bacteria 1794
309 Ga0495675_0001419 3300047444 Bacteria 14514
310 Ga0495677_0003593 3300047445 Bacteria 6013
311 Ga0495677_0005794 3300047445 Bacteria 4673
312 Ga0495677_0023639 3300047445 Bacteria 2230
313 Ga0495677_0047980 3300047445 Bacteria 1568
314 Ga0495685_018646 3300047447 Bacteria 2382
315 Ga0495673_0037488 3300047469 Bacteria 2213
316 Ga0495681_0000080 3300047470 Bacteria 84770
317 Ga0495681_0000606 3300047470 Bacteria 27406
318 Ga0495681_0011960 3300047470 Bacteria 5127
319 Ga0495686_0000593 3300047472 Bacteria 50448
320 Ga0495686_0075603 3300047472 Bacteria 2065
321 Ga0495593_0004319 3300047673 Bacteria 8454
322 Ga0495593_0077038 3300047673 Bacteria 1727
323 Ga0495614_0008604 3300048089 Bacteria 4537
324 Ga0495614_0012757 3300048089 Bacteria 3687
325 Ga0495615_0025485 3300048090 Bacteria 1373
326 Ga0495626_0000018 3300048091 Bacteria 230153
327 Ga0495626_0006973 3300048091 Bacteria 6359
328 Ga0495626_0010257 3300048091 Bacteria 5014
329 Ga0495626_0015913 3300048091 Bacteria 3837
330 Ga0495626_0020768 3300048091 Bacteria 3268
331 Ga0495626_0023521 3300048091 Bacteria 3033
332 Ga0495626_0027251 3300048091 Bacteria 2779
333 Ga0495626_0058686 3300048091 Bacteria 1757
334 Ga0495626_0068627 3300048091 Bacteria 1598
335 Ga0495626_0149491 3300048091 Bacteria 985
336 Ga0496101_0090801 3300048904 Bacteria 2272
337 Ga0496102_0099267 3300048905 Bacteria 2702
338 Ga0496105_0120636 3300048908 Bacteria 2162
339 Ga0496106_0216103 3300048909 Bacteria 1528
340 Ga0496107_0132046 3300048910 Bacteria 1844
341 Ga0496108_0059338 3300048911 Bacteria 3217
342 Ga0496110_0008250 3300048913 Bacteria 8375
343 Ga0496110_0411717 3300048913 Bacteria 1233
344 Ga0496111_0007192 3300048914 Bacteria 7276
345 Ga0496111_0016990 3300048914 Bacteria 5023
346 Ga0496115_0006409 3300048918 Bacteria 8621
347 Ga0496115_0088920 3300048918 Bacteria 2522
348 Ga0496115_0172307 3300048918 Bacteria 1790
349 Ga0496124_0003287 3300048927 Bacteria 19940
350 Ga0496124_0004757 3300048927 Bacteria 15634
351 Ga0496124_0087142 3300048927 Bacteria 2554
352 Ga0495678_000050 3300049459 Bacteria 160887
353 Ga0495678_000257 3300049459 Bacteria 59306
354 Ga0495678_001385 3300049459 Bacteria 19307
355 Ga0495682_0011052 3300049460 Bacteria 3479
356 Ga0501034_0103008 3300049571 Bacteria 2848
357 Ga0501227_021163 3300049665 Bacteria 1498
358 Ga0501233_027047 3300049668 Bacteria 1271
359 Ga0501279_012853 3300049775 Bacteria 1141
360 Ga0500637_0001382 3300053178 Bacteria 10312
361 Ga0587077_004284 3300059493 Bacteria 1863
362 Ga0587068_001842 3300059641 Bacteria 2473
363 2643791551 2643221554 Bacteria 6603920
364 2644030106 2643221603 Bacteria 6147767
365 2644211192 2643221638 Bacteria 6579467
366 Ga0466972_0036304
367 JGI25150J39212_1000549
368 JGI25159J45721_1002170
369 JGI25159J45721_1025164
370 JGI25151J46595_10017026
371 JGI25153J46596_10011033
372 JGI25160J50197_1022264
373 JGI25161J50226_1000266
374 JGI25161J50226_1002117
375 Ga0055526_1013126
376 Ga0055537_1000044
377 Ga0055537_1009476
378 Ga0055524_1002445
379 Ga0055524_1003807
380 Ga0055524_1013832
381 Ga0055534_1001834
382 Ga0055534_1002186
383 Ga0055534_1013716
384 Ga0055528_1000011
385 Ga0055528_1028437
386 Ga0055530_10000499
387 Ga0055530_10007207
388 Ga0055531_10004666
389 Ga0055543_1000339
390 Ga0055543_1025923
391 Ga0065165_1000007
392 Ga0065165_1001110
393 Ga0070682_100013207
394 Ga0070712_100311005
395 Ga0105241_10572770
396 Ga0157371_10000149
397 Ga0182008_10070153
398 Ga0182006_1063494
399 Ga0209436_100554
400 Ga0209436_100859
401 Ga0207425_1000001
402 Ga0207425_1000067
403 Ga0209129_1000003
404 Ga0209129_1001364
405 Ga0209565_1000003
406 Ga0209565_1001086
407 Ga0209565_1001429
408 Ga0209565_1007596
409 Ga0209565_1009905
410 Ga0209673_1000003
411 Ga0209673_1011123
412 Ga0209130_1000047
413 Ga0209130_1000059
414 Ga0209130_1001599
415 Ga0209675_1000003
416 Ga0209675_1005797
417 Ga0209675_1013798
418 Ga0209025_1000718
419 Ga0209564_1000012
420 Ga0209564_1000142
421 Ga0209564_1003831
422 Ga0209564_1034530
423 Ga0209758_1000098
424 Ga0209050_1000058
425 Ga0209050_1000654
426 Ga0209050_1001112
427 Ga0209050_1001305
428 Ga0209256_1000029
429 Ga0209256_1000186
430 Ga0209256_1000875
431 Ga0207426_1001774
432 Ga0209051_1020891
433 Ga0209257_1000003
434 Ga0209257_1002931
435 Ga0209257_1003953
436 Ga0207693_10303808
437 Ga0207698_10022051
438 Ga0316182_1246430
439 Ga0307509_10400766
440 Ga0307408_100000082
441 Ga0307408_100058824
442 Ga0395899_0001402
443 Ga0395899_0004872
444 Ga0395899_0007376
445 Ga0395899_0197536
446 Ga0395899_0249575
447 Ga0395900_0018511
448 Ga0395900_0217093
449 Ga0395898_0229288
450 Ga0395898_0336473
451 Ga0395905_0003674
452 Ga0395905_0022941
453 Ga0395905_0114606
454 Ga0395905_0696180
455 Ga0395901_0026078
456 Ga0395901_0053884
457 Ga0395901_0248548
458 Ga0436361_0167113
459 Ga0436361_0582900
460 Ga0436361_0742159
461 Ga0450904_001169
462 Ga0450893_0004911
463 Ga0466972_0005099
464 Ga0466965_0007849
465 Ga0466965_0038367
466 Ga0466971_0124024
467 Ga0466968_0015750
468 Ga0451576_0090282
469 Ga0466958_0249339
470 Ga0466967_0151479
471 Ga0495627_003603
472 Ga0495603_0089280
473 Ga0495590_0009070
474 Ga0495590_0038588
475 Ga0495638_0022329
476 Ga0495638_0101332
477 Ga0495653_0013488
478 Ga0495650_0000001
479 Ga0495580_0004208
480 Ga0495582_0017054
481 Ga0495605_0014258
482 Ga0495605_0111565
483 Ga0495584_0000002
484 Ga0495584_0000028
485 Ga0495584_0002511
486 Ga0495584_0039440
487 Ga0495584_0045374
488 Ga0495584_0057700
489 Ga0495584_0122619
490 Ga0495584_0164537
491 Ga0495585_0000038
492 Ga0495585_0000187
493 Ga0495585_0000188
494 Ga0495585_0000325
495 Ga0495585_0001769
496 Ga0495585_0005991
497 Ga0495585_0012043
498 Ga0495585_0024942
499 Ga0495585_0041051
500 Ga0495585_0045950
501 Ga0495585_0135666
502 Ga0495585_0154138
503 Ga0495594_0000521
504 Ga0495594_0036177
505 Ga0495594_0077677
506 Ga0495594_0119925
507 Ga0495596_0000017
508 Ga0495596_0000116
509 Ga0495596_0000362
510 Ga0495596_0003264
511 Ga0495596_0005466
512 Ga0495596_0009184
513 Ga0495596_0012976
514 Ga0495596_0027630
515 Ga0495596_0028974
516 Ga0495596_0055932
517 Ga0495596_0107720
518 Ga0495607_0019506
519 Ga0495607_0021740
520 Ga0495607_0026968
521 Ga0495607_0059978
522 Ga0495583_0000009
523 Ga0495583_0002668
524 Ga0495583_0004155
525 Ga0495583_0028353
526 Ga0495583_0040366
527 Ga0495583_0047350
528 Ga0495606_0017971
529 Ga0495606_0024889
530 Ga0495616_0000102
531 Ga0495616_0003229
532 Ga0495616_0007875
533 Ga0495616_0087210
534 Ga0495616_0133305
535 Ga0495620_0008218
536 Ga0495631_0000745
537 Ga0495631_0002287
538 Ga0495631_0011940
539 Ga0495631_0012524
540 Ga0495631_0016973
541 Ga0495631_0017150
542 Ga0495631_0020334
543 Ga0495631_0028886
544 Ga0495632_0000133
545 Ga0495632_0001962
546 Ga0495632_0008911
547 Ga0495643_0000096
548 Ga0495643_0022878
549 Ga0495643_0064706
550 Ga0495643_0202034
551 Ga0495644_0006108
552 Ga0495644_0009064
553 Ga0495644_0043341
554 Ga0495644_0049044
555 Ga0495644_0075734
556 Ga0495644_0135261
557 Ga0495648_0014838
558 Ga0495648_0018553
559 Ga0495648_0020626
560 Ga0495648_0025220
561 Ga0495648_0061084
562 Ga0495663_0046191
563 Ga0495666_0000577
564 Ga0495666_0005743
565 Ga0495642_0003439
566 Ga0495642_0006524
567 Ga0495642_0013874
568 Ga0495642_0020186
569 Ga0495642_0037842
570 Ga0495642_0050856
571 Ga0495642_0053601
572 Ga0495642_0087975
573 Ga0495654_0012892
574 Ga0495665_0004255
575 Ga0495665_0013689
576 Ga0495665_0137903
577 Ga0495640_0101214
578 Ga0495586_0099545
579 Ga0495609_0004306
580 Ga0495609_0005293
581 Ga0495609_0020957
582 Ga0495609_0077350
583 Ga0495621_0006593
584 Ga0495597_0000650
585 Ga0495597_0001181
586 Ga0495597_0003417
587 Ga0495597_0008638
588 Ga0495597_0009282
589 Ga0495597_0064907
590 Ga0495645_0244754
591 Ga0495622_0007801
592 Ga0495633_0002027
593 Ga0495633_0002874
594 Ga0495633_0006564
595 Ga0495633_0017549
596 Ga0495633_0086529
597 Ga0495633_0092248
598 Ga0495656_0017083
599 Ga0495656_0055359
600 Ga0495668_0000020
601 Ga0495668_0000052
602 Ga0495668_0009891
603 Ga0495668_0019710
604 Ga0495668_0027286
605 Ga0495668_0028822
606 Ga0495668_0037360
607 Ga0495668_0061973
608 Ga0495668_0066495
609 Ga0495668_0129240
610 Ga0495668_0334393
611 Ga0495634_0122219
612 Ga0495611_0006162
613 Ga0495611_0077260
614 Ga0495611_0119863
615 Ga0495611_0128834
616 Ga0495611_0195890
617 Ga0495625_0067000
618 Ga0495625_0070341
619 Ga0495625_0117672
620 Ga0495635_0072145
621 Ga0495659_0029054
622 Ga0495659_0096333
623 Ga0495661_0001589
624 Ga0495661_0005420
625 Ga0495661_0021325
626 Ga0495661_0024131
627 Ga0495661_0076054
628 Ga0495661_0145117
629 Ga0495588_0019914
630 Ga0495588_0037351
631 Ga0495588_0044011
632 Ga0495588_0069188
633 Ga0495588_0091971
634 Ga0495646_0123789
635 Ga0495669_0000040
636 Ga0495669_0001604
637 Ga0495624_0103657
638 Ga0495670_0000173
639 Ga0495670_0000390
640 Ga0495670_0001692
641 Ga0495670_0011400
642 Ga0495670_0033198
643 Ga0495670_0035406
644 Ga0495670_0113222
645 Ga0495670_0129220
646 Ga0495671_0000877
647 Ga0495671_0091608
648 Ga0495649_0207096
649 Ga0495589_0000304
650 Ga0495589_0076404
651 Ga0495589_0093077
652 Ga0495589_0101611
653 Ga0495589_0137306
654 Ga0495660_0047442
655 Ga0495660_0088374
656 Ga0495604_0004363
657 Ga0495604_0430370
658 Ga0495636_0099837
659 Ga0495672_0000445
660 Ga0495672_0070174
661 Ga0495672_0115317
662 Ga0495676_0000007
663 Ga0495676_0215424
664 Ga0495680_0008586
665 Ga0495683_0000133
666 Ga0495683_0007510
667 Ga0495683_0021530
668 Ga0495683_0084087
669 Ga0495683_0115429
670 Ga0495687_000150
671 Ga0495687_000411
672 Ga0495687_003977
673 Ga0495687_049560
674 Ga0495675_0001419
675 Ga0495677_0003593
676 Ga0495677_0005794
677 Ga0495677_0023639
678 Ga0495677_0047980
679 Ga0495685_018646
680 Ga0495673_0037488
681 Ga0495681_0000080
682 Ga0495681_0000606
683 Ga0495681_0011960
684 Ga0495686_0000593
685 Ga0495686_0075603
686 Ga0495593_0004319
687 Ga0495593_0077038
688 Ga0495614_0008604
689 Ga0495614_0012757
690 Ga0495615_0025485
691 Ga0495626_0000018
692 Ga0495626_0006973
693 Ga0495626_0010257
694 Ga0495626_0015913
695 Ga0495626_0020768
696 Ga0495626_0023521
697 Ga0495626_0027251
698 Ga0495626_0058686
699 Ga0495626_0068627
700 Ga0495626_0149491
701 Ga0496101_0090801
702 Ga0496102_0099267
703 Ga0496105_0120636
704 Ga0496106_0216103
705 Ga0496107_0132046
706 Ga0496108_0059338
707 Ga0496110_0008250
708 Ga0496110_0411717
709 Ga0496111_0007192
710 Ga0496111_0016990
711 Ga0496115_0006409
712 Ga0496115_0088920
713 Ga0496115_0172307
714 Ga0496124_0003287
715 Ga0496124_0004757
716 Ga0496124_0087142
717 Ga0495678_000050
718 Ga0495678_000257
719 Ga0495678_001385
720 Ga0495682_0011052
721 Ga0501034_0103008
722 Ga0501227_021163
723 Ga0501233_027047
724 Ga0501279_012853
725 Ga0500637_0001382
726 Ga0587077_004284
727 Ga0587068_001842
728 2643791551
729 2644030106
730 2644211192

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

13

213

0.94

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

19

259

0.94

PF08659

KR

KR domain

13

196

0.91

PF23441

7

261

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cdy-assembly1.cif.gz_C the crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from yersinia pestis at 2.85a resolution 0.9232 9 253
3grp-assembly1.cif.gz_C 2.1 angstrom crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from bartonella henselae 0.9229 7 253
3ftp-assembly1.cif.gz_B crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from burkholderia pseudomallei at 2.05 a resolution 0.9218 10 253
3ftp-assembly1.cif.gz_D crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from burkholderia pseudomallei at 2.05 a resolution 0.9204 10 253
3ftp-assembly1.cif.gz_C crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from burkholderia pseudomallei at 2.05 a resolution 0.92 10 253
ID Description Score Start End Superfamily
3grpC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9229 7 253 3.40.50.720
3ftpC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.92 10 253 3.40.50.720
2et6A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9165 9 253 3.40.50.720
1x1eA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9158 13 257 3.40.50.720
af_P0AET8_1_255_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.914 1 253 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1F4EHM9-F1-model_v4 Gluconate 5-dehydrogenase 0.9456 2 257 GO:0016491
AF-A0A270B903-F1-model_v4 Gluconate 5-dehydrogenase (EC 1.1.1.69) 0.9443 11 257 GO:0008874
GO:0030497
AF-A0A5C6TYX4-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9419 1 257 GO:0004222
GO:0005737
GO:0006508
GO:0006518
GO:0016491
GO:0046872
AF-A0A363TM17-F1-model_v4 Gluconate 5-dehydrogenase (EC 1.1.1.69) 0.9394 1 257 GO:0008874
AF-A0A1F4EHM9-F1-model_v4 Gluconate 5-dehydrogenase 0.9385 2 257 GO:0016491

Map