F423799

General Info

Members Datasets Scaffolds Average Seq Length
365 242 730 232

Family's Representative Sequence

Representative Sequence 3300046690|Ga0495624_0008756|Ga0495624_0008756_5400_6158
Length 252
Sequence LPLCGNNYDITWKNGGVAERDDPVLLITGASSGIGAATARATASKYRLVLAARRLEPLEELVEELGGAERALAVRCDVSEWDEVEAMVAAGIERFERIDAVFANAGFGATRGFLEESPEHWRSMVLTNVYGLALTIRATLPHLLERGDGHVLVTSSVAGRRALPGSLYSATKHAATAIGEALRAELRQMHENRDIRVTLIEPGMTDTPFFDNRPGEWALRDDDIARAVLYALEQRPGVDVNEILIRPTSQPI

Samples

Sample ID Description Type Environment
1 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
121 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
124 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
125 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
126 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
127 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
128 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
129 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
130 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
133 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
151 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
152 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
153 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
154 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
155 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
156 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
157 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
158 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
159 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
164 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
165 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
166 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
167 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
168 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
169 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
170 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
171 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
172 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
173 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
174 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
175 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
176 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
177 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
178 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
179 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
180 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
181 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
182 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
211 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
212 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
213 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
214 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
215 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
219 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
220 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
226 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
227 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
228 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
232 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
233 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
234 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
235 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
236 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
237 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
238 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
239 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
240 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
241 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
242 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.45
Metatranscriptomes 0.55
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.38
Nodule 0
Rhizoplane 8.49
Rhizosphere 86.58
Stem 0
Stem Tuber 0
Unclassified 2.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495624_0008756 3300046690 Bacteria 7039
2 JGI24746J21847_1000158 3300001977 Bacteria 8696
3 Ga0070658_10013036 3300005327 Bacteria 6672
4 Ga0070658_10013240 3300005327 Bacteria 6616
5 Ga0070683_100100934 3300005329 Bacteria 2717
6 Ga0070683_100216610 3300005329 Bacteria 1819
7 Ga0070683_100519848 3300005329 Unclassified 1137
8 Ga0070690_100166946 3300005330 Bacteria 1512
9 Ga0070666_10010018 3300005335 Bacteria 5915
10 Ga0070680_100004075 3300005336 Bacteria 10945
11 Ga0070680_100499893 3300005336 Bacteria 1040
12 Ga0070682_100005880 3300005337 Bacteria 6858
13 Ga0070682_100368980 3300005337 Bacteria 1076
14 Ga0068868_100003415 3300005338 Bacteria 11053
15 Ga0068868_100189640 3300005338 Bacteria 1709
16 Ga0070660_100012090 3300005339 Bacteria 6161
17 Ga0070661_100000023 3300005344 Bacteria 123104
18 Ga0070661_100036157 3300005344 Bacteria 3590
19 Ga0070668_100055205 3300005347 Bacteria 3066
20 Ga0070668_100064648 3300005347 Bacteria 2836
21 Ga0070675_100000111 3300005354 Bacteria 47699
22 Ga0070675_100289448 3300005354 Bacteria 1441
23 Ga0070674_100000064 3300005356 Bacteria 47689
24 Ga0070674_100047314 3300005356 Bacteria 2946
25 Ga0070674_100066158 3300005356 Bacteria 2539
26 Ga0070673_100038478 3300005364 Bacteria 3653
27 Ga0070688_100000068 3300005365 Bacteria 50778
28 Ga0070659_100012260 3300005366 Bacteria 6355
29 Ga0070667_100097536 3300005367 Bacteria 2535
30 Ga0070667_100280505 3300005367 Bacteria 1496
31 Ga0070710_10120246 3300005437 Bacteria 1589
32 Ga0070701_10127902 3300005438 Bacteria 1440
33 Ga0070711_100010077 3300005439 Bacteria 5838
34 Ga0070711_100078971 3300005439 Bacteria 2340
35 Ga0070700_100000366 3300005441 Bacteria 23158
36 Ga0070663_100002635 3300005455 Bacteria 10153
37 Ga0070662_100000004 3300005457 Bacteria 195534
38 Ga0070662_100006680 3300005457 Bacteria 7451
39 Ga0070681_10751512 3300005458 Bacteria 892
40 Ga0068867_100000281 3300005459 Bacteria 33623
41 Ga0070685_10000364 3300005466 Bacteria 27523
42 Ga0070685_10011182 3300005466 Bacteria 4694
43 Ga0070679_100005920 3300005530 Bacteria 11359
44 Ga0070679_100263647 3300005530 Bacteria 1678
45 Ga0070684_100013689 3300005535 Bacteria 6545
46 Ga0070684_100035480 3300005535 Bacteria 4268
47 Ga0070684_100224255 3300005535 Bacteria 1715
48 Ga0070684_100334120 3300005535 Bacteria 1393
49 Ga0068853_100033228 3300005539 Bacteria 4375
50 Ga0068853_100055564 3300005539 Bacteria 3413
51 Ga0070672_100000015 3300005543 Bacteria 72591
52 Ga0070672_100053404 3300005543 Bacteria 3159
53 Ga0070686_100020206 3300005544 Bacteria 3938
54 Ga0070665_100000106 3300005548 Bacteria 157315
55 Ga0070665_100001339 3300005548 Bacteria 29297
56 Ga0070665_100089169 3300005548 Bacteria 3090
57 Ga0070704_100058118 3300005549 Bacteria 2754
58 Ga0070704_100089752 3300005549 Bacteria 2287
59 Ga0070664_100090533 3300005564 Bacteria 2648
60 Ga0070664_100208976 3300005564 Bacteria 1744
61 Ga0068857_100012728 3300005577 Bacteria 7333
62 Ga0068854_100005170 3300005578 Bacteria 8229
63 Ga0068854_100185602 3300005578 Bacteria 1627
64 Ga0068856_100013668 3300005614 Bacteria 7849
65 Ga0068856_100350888 3300005614 Bacteria 1494
66 Ga0068852_100002607 3300005616 Bacteria 12455
67 Ga0068864_100000045 3300005618 Bacteria 154739
68 Ga0068866_10000001 3300005718 Bacteria 519680
69 Ga0068863_100000021 3300005841 Bacteria 198088
70 Ga0068858_100000216 3300005842 Bacteria 62188
71 Ga0068858_100040767 3300005842 Bacteria 4307
72 Ga0068860_100056055 3300005843 Bacteria 3748
73 Ga0068860_100531149 3300005843 Bacteria 1177
74 Ga0081538_10017400 3300005981 Bacteria 5458
75 Ga0075365_10093364 3300006038 Bacteria 2052
76 Ga0075365_10464850 3300006038 Bacteria 894
77 Ga0075368_10168041 3300006042 Bacteria 921
78 Ga0075363_100043883 3300006048 Bacteria 2367
79 Ga0075364_10009320 3300006051 Bacteria 5883
80 Ga0075364_10058111 3300006051 Bacteria 2534
81 Ga0075364_10123280 3300006051 Unclassified 1736
82 Ga0070715_10000001 3300006163 Bacteria 693690
83 Ga0070712_100008219 3300006175 Bacteria 6554
84 Ga0070712_100010232 3300006175 Bacteria 5914
85 Ga0075433_10031937 3300006852 Bacteria 4505
86 Ga0075434_100111975 3300006871 Bacteria 2740
87 Ga0068865_100112666 3300006881 Bacteria 2010
88 Ga0075435_100013269 3300007076 Bacteria 6122
89 Ga0105240_10013241 3300009093 Bacteria 11346
90 Ga0105245_10000454 3300009098 Bacteria 37583
91 Ga0105245_10008108 3300009098 Bacteria 9189
92 Ga0105245_10077147 3300009098 Bacteria 3037
93 Ga0105245_10573677 3300009098 Bacteria 1152
94 Ga0114129_10616288 3300009147 Bacteria 1404
95 Ga0105243_10017722 3300009148 Bacteria 5386
96 Ga0105237_10026561 3300009545 Bacteria 5918
97 Ga0105238_10000011 3300009551 Bacteria 261080
98 Ga0105238_10005199 3300009551 Bacteria 12861
99 Ga0105239_10162179 3300010375 Bacteria 2498
100 Ga0105246_10597925 3300011119 Bacteria 953
101 Ga0157371_10158030 3300013102 Bacteria 1618
102 Ga0157371_10290992 3300013102 Unclassified 1181
103 Ga0157370_10043566 3300013104 Bacteria 4317
104 Ga0157369_10027214 3300013105 Bacteria 6340
105 Ga0157369_10282985 3300013105 Bacteria 1727
106 Ga0157374_10005775 3300013296 Bacteria 10446
107 Ga0157378_10002995 3300013297 Bacteria 15012
108 Ga0157378_10005465 3300013297 Bacteria 11132
109 Ga0163162_10790925 3300013306 Bacteria 1066
110 Ga0157372_10135996 3300013307 Bacteria 2830
111 Ga0157375_10001152 3300013308 Bacteria 22842
112 Ga0157375_10002277 3300013308 Bacteria 16605
113 Ga0157375_10016006 3300013308 Bacteria 6727
114 Ga0157375_10016397 3300013308 Bacteria 6655
115 Ga0163163_10508152 3300014325 Bacteria 1267
116 Ga0157380_10001196 3300014326 Bacteria 16795
117 Ga0157380_10498645 3300014326 Bacteria 1182
118 Ga0157377_10031103 3300014745 Bacteria 2898
119 Ga0163161_10000035 3300017792 Bacteria 155979
120 Ga0163161_10154505 3300017792 Bacteria 1746
121 Ga0206353_11335746 3300020082 Bacteria 4272
122 Ga0224712_10285118 3300022467 Unclassified 770
123 Ga0207692_10118831 3300025898 Bacteria 1477
124 Ga0207642_10000002 3300025899 Bacteria 658166
125 Ga0207688_10042982 3300025901 Bacteria 2516
126 Ga0207680_10014124 3300025903 Bacteria 4122
127 Ga0207680_10101391 3300025903 Bacteria 1850
128 Ga0207699_10239546 3300025906 Bacteria 1246
129 Ga0207705_10033400 3300025909 Bacteria 3675
130 Ga0207705_10034117 3300025909 Bacteria 3638
131 Ga0207705_10149277 3300025909 Bacteria 1750
132 Ga0207654_10210197 3300025911 Bacteria 1285
133 Ga0207693_10006565 3300025915 Bacteria 9624
134 Ga0207693_10013567 3300025915 Bacteria 6567
135 Ga0207662_10071812 3300025918 Bacteria 2096
136 Ga0207657_10000307 3300025919 Bacteria 51966
137 Ga0207649_10000523 3300025920 Bacteria 26930
138 Ga0207649_10290525 3300025920 Bacteria 1192
139 Ga0207652_10003690 3300025921 Bacteria 12586
140 Ga0207694_10000004 3300025924 Bacteria 967075
141 Ga0207659_10000010 3300025926 Bacteria 286639
142 Ga0207659_10024803 3300025926 Bacteria 4023
143 Ga0207687_10004954 3300025927 Bacteria 8836
144 Ga0207687_10052643 3300025927 Bacteria 2842
145 Ga0207690_10022335 3300025932 Bacteria 3934
146 Ga0207706_10000012 3300025933 Bacteria 195475
147 Ga0207706_10012589 3300025933 Bacteria 7701
148 Ga0207686_10010146 3300025934 Bacteria 5122
149 Ga0207709_10009100 3300025935 Bacteria 5475
150 Ga0207709_10107178 3300025935 Bacteria 1860
151 Ga0207670_10412613 3300025936 Bacteria 1082
152 Ga0207669_10000018 3300025937 Bacteria 114254
153 Ga0207669_10486808 3300025937 Bacteria 984
154 Ga0207704_10026638 3300025938 Bacteria 3175
155 Ga0207691_10000044 3300025940 Bacteria 100027
156 Ga0207691_10031048 3300025940 Bacteria 4990
157 Ga0207661_10000224 3300025944 Bacteria 36954
158 Ga0207661_10004878 3300025944 Bacteria 9402
159 Ga0207661_10008084 3300025944 Bacteria 7501
160 Ga0207661_10218218 3300025944 Bacteria 1684
161 Ga0207668_10002989 3300025972 Bacteria 9908
162 Ga0207668_10058307 3300025972 Bacteria 2698
163 Ga0207640_10007209 3300025981 Bacteria 6129
164 Ga0207640_10080946 3300025981 Bacteria 2219
165 Ga0207658_10079501 3300025986 Bacteria 2508
166 Ga0207677_10015101 3300026023 Bacteria 4531
167 Ga0207677_10079551 3300026023 Bacteria 2344
168 Ga0207703_10000023 3300026035 Bacteria 222018
169 Ga0207703_10000152 3300026035 Bacteria 79658
170 Ga0207639_10041767 3300026041 Bacteria 3434
171 Ga0207639_10047985 3300026041 Bacteria 3230
172 Ga0207639_10144895 3300026041 Bacteria 1983
173 Ga0207678_10015271 3300026067 Bacteria 6754
174 Ga0207708_10005179 3300026075 Bacteria 9617
175 Ga0207702_10241831 3300026078 Bacteria 1691
176 Ga0207641_10000151 3300026088 Bacteria 99225
177 Ga0207641_10220983 3300026088 Bacteria 1757
178 Ga0207648_10000872 3300026089 Bacteria 33984
179 Ga0207648_10297931 3300026089 Bacteria 1446
180 Ga0207676_10000016 3300026095 Bacteria 311561
181 Ga0207674_10176191 3300026116 Bacteria 2091
182 Ga0207675_100125937 3300026118 Bacteria 2426
183 Ga0207675_100514189 3300026118 Bacteria 1193
184 Ga0207683_10020098 3300026121 Bacteria 5708
185 Ga0207683_10087288 3300026121 Bacteria 2774
186 Ga0207698_10025249 3300026142 Bacteria 4182
187 Ga0268266_10000047 3300028379 Bacteria 310996
188 Ga0268266_10009487 3300028379 Bacteria 8562
189 Ga0268264_10006655 3300028381 Bacteria 9721
190 Ga0268264_10545646 3300028381 Bacteria 1136
191 Ga0268264_10578985 3300028381 Bacteria 1104
192 Ga0265326_10000102 3300028558 Bacteria 43681
193 Ga0265322_10000001 3300028654 Bacteria 543854
194 Ga0265338_10125844 3300028800 Bacteria 2034
195 Ga0265324_10005914 3300029957 Bacteria 5194
196 Ga0265332_10041483 3300031238 Bacteria 1991
197 Ga0265328_10041256 3300031239 Bacteria 1699
198 Ga0265320_10000002 3300031240 Bacteria 542875
199 Ga0265329_10005229 3300031242 Bacteria 5276
200 Ga0265331_10000751 3300031250 Bacteria 27117
201 Ga0265327_10000011 3300031251 Bacteria 543807
202 Ga0265316_10070161 3300031344 Bacteria 2703
203 Ga0307408_100037001 3300031548 Bacteria 3435
204 Ga0265314_10000062 3300031711 Bacteria 159496
205 Ga0316576_10001940 3300031727 Bacteria 11553
206 Ga0307405_10012861 3300031731 Bacteria 4447
207 Ga0307410_10050145 3300031852 Bacteria 2805
208 Ga0307406_10059172 3300031901 Bacteria 2465
209 Ga0307409_100019635 3300031995 Bacteria 4582
210 Ga0307416_100289933 3300032002 Bacteria 1620
211 Ga0307411_10042988 3300032005 Bacteria 2888
212 Ga0307415_100061447 3300032126 Bacteria 2601
213 Ga0307415_100188490 3300032126 Bacteria 1625
214 Ga0316574_0046665 3300035398 Bacteria 2687
215 Ga0373937_0496596 3300036401 Bacteria 1159
216 Ga0316582_0278737 3300036647 Bacteria 1147
217 Ga0395898_0022204 3300037466 Bacteria 6431
218 Ga0395898_0043389 3300037466 Bacteria 4432
219 Ga0436365_0172502 3300039437 Bacteria 1929
220 Ga0451853_2516419 3300041512 Bacteria 3773
221 Ga0466963_0000001 3300044694 Bacteria 110556
222 Ga0466968_0026964 3300044735 Bacteria 2362
223 Ga0466967_0041876 3300045976 Bacteria 3953
224 Ga0495592_0036400 3300046454 Unclassified 3707
225 Ga0495603_0001695 3300046455 Bacteria 12959
226 Ga0495603_0226533 3300046455 Bacteria 1078
227 Ga0495629_0000272 3300046459 Bacteria 44883
228 Ga0495629_0004323 3300046459 Bacteria 10654
229 Ga0495641_0000044 3300046461 Bacteria 77415
230 Ga0495641_0019025 3300046461 Bacteria 3527
231 Ga0495641_0044663 3300046461 Bacteria 2043
232 Ga0495653_0088082 3300046463 Bacteria 2278
233 Ga0495582_0000011 3300046473 Bacteria 113352
234 Ga0495662_0000061 3300046476 Bacteria 37295
235 Ga0495664_0452671 3300046477 Bacteria 769
236 Ga0495608_0000583 3300046511 Bacteria 25062
237 Ga0495608_0452156 3300046511 Bacteria 781
238 Ga0495618_0000174 3300046514 Bacteria 45942
239 Ga0495628_0008782 3300046516 Bacteria 8648
240 Ga0495628_0092384 3300046516 Bacteria 2341
241 Ga0495630_0000056 3300046517 Bacteria 91477
242 Ga0495652_0485770 3300046529 Bacteria 859
243 Ga0495586_0012117 3300046535 Bacteria 4578
244 Ga0495621_0001829 3300046539 Bacteria 5599
245 Ga0495656_0002145 3300046615 Bacteria 6519
246 Ga0495668_0036089 3300046616 Bacteria 2771
247 Ga0495634_0000018 3300046642 Bacteria 121323
248 Ga0495625_0000587 3300046660 Bacteria 52838
249 Ga0495657_0026832 3300046675 Bacteria 4074
250 Ga0495647_0000008 3300046681 Bacteria 101193
251 Ga0495647_0000352 3300046681 Bacteria 12996
252 Ga0495647_0000631 3300046681 Bacteria 10396
253 Ga0495658_0000005 3300046683 Bacteria 149839
254 Ga0495613_0000203 3300046689 Bacteria 58232
255 Ga0495624_0000008 3300046690 Bacteria 145035
256 Ga0495624_0000267 3300046690 Bacteria 41318
257 Ga0495649_0001624 3300046694 Bacteria 16726
258 Ga0495600_0001684 3300046809 Bacteria 12350
259 Ga0495604_0000019 3300047317 Bacteria 175064
260 Ga0495604_0012279 3300047317 Bacteria 6810
261 Ga0495676_0000299 3300047321 Bacteria 40098
262 Ga0495676_0074173 3300047321 Bacteria 2607
263 Ga0495680_0000773 3300047322 Bacteria 35829
264 Ga0495680_0003005 3300047322 Bacteria 16821
265 Ga0495673_0031620 3300047469 Bacteria 2477
266 Ga0495593_0026947 3300047673 Bacteria 3167
267 Ga0495602_0094124 3300048088 Bacteria 2477
268 Ga0496100_0019348 3300048903 Bacteria 4060
269 Ga0496101_0002935 3300048904 Bacteria 10483
270 Ga0496102_0023083 3300048905 Bacteria 5520
271 Ga0496103_0015756 3300048906 Bacteria 4506
272 Ga0496104_0021896 3300048907 Bacteria 5870
273 Ga0496106_0004435 3300048909 Bacteria 10404
274 Ga0496106_0006160 3300048909 Bacteria 8868
275 Ga0496106_0063106 3300048909 Bacteria 2815
276 Ga0496107_0025303 3300048910 Bacteria 4202
277 Ga0496107_0052079 3300048910 Unclassified 2953
278 Ga0496107_0105665 3300048910 Bacteria 2067
279 Ga0496108_0002109 3300048911 Bacteria 15927
280 Ga0496108_0005678 3300048911 Bacteria 10101
281 Ga0496108_0031506 3300048911 Bacteria 4400
282 Ga0496109_0000129 3300048912 Bacteria 77469
283 Ga0496109_0001311 3300048912 Bacteria 20538
284 Ga0496109_0001392 3300048912 Bacteria 20061
285 Ga0496109_0130575 3300048912 Bacteria 2344
286 Ga0496110_0146204 3300048913 Bacteria 2138
287 Ga0496110_0322518 3300048913 Bacteria 1407
288 Ga0496110_0539364 3300048913 Bacteria 1060
289 Ga0496110_0768864 3300048913 Unclassified 867
290 Ga0496110_0855829 3300048913 Bacteria 815
291 Ga0496111_0033844 3300048914 Bacteria 3645
292 Ga0496112_0123478 3300048915 Bacteria 2560
293 Ga0496113_0033970 3300048916 Bacteria 3718
294 Ga0496113_0035645 3300048916 Bacteria 3639
295 Ga0496114_0058546 3300048917 Bacteria 3217
296 Ga0496114_0064505 3300048917 Bacteria 3067
297 Ga0496115_0002082 3300048918 Bacteria 14330
298 Ga0496115_0003019 3300048918 Bacteria 12078
299 Ga0501031_0101404 3300049568 Bacteria 1878
300 Ga0501033_0033540 3300049570 Bacteria 3854
301 Ga0501034_0008403 3300049571 Bacteria 10910
302 Ga0501034_0231347 3300049571 Bacteria 1797
303 Ga0501036_0050458 3300049572 Bacteria 3523
304 Ga0501037_0031121 3300049573 Bacteria 3940
305 Ga0501038_0024670 3300049574 Bacteria 5361
306 Ga0501039_0003795 3300049575 Bacteria 11351
307 Ga0501040_0061348 3300049576 Bacteria 2586
308 Ga0501041_0222215 3300049577 Bacteria 1185
309 Ga0501042_0052938 3300049578 Bacteria 2896
310 Ga0501042_0177050 3300049578 Bacteria 1538
311 Ga0501043_0028532 3300049579 Bacteria 4381
312 Ga0501046_0463302 3300049580 Bacteria 910
313 Ga0501047_0524859 3300049581 Bacteria 1009
314 Ga0501047_0657076 3300049581 Bacteria 867
315 Ga0501047_0680425 3300049581 Bacteria 847
316 Ga0501048_0359160 3300049582 Bacteria 1039
317 Ga0501067_0025635 3300049583 Bacteria 3268
318 Ga0501067_0227134 3300049583 Bacteria 1039
319 Ga0501068_0064036 3300049584 Bacteria 2237
320 Ga0501069_0032882 3300049585 Bacteria 2855
321 Ga0501069_0229226 3300049585 Bacteria 1081
322 Ga0501070_0024271 3300049586 Bacteria 5085
323 Ga0501070_0170835 3300049586 Bacteria 1791
324 Ga0501070_0700174 3300049586 Bacteria 801
325 Ga0501071_0116137 3300049587 Bacteria 1981
326 Ga0501071_0546959 3300049587 Bacteria 889
327 Ga0501072_0051631 3300049588 Bacteria 3237
328 Ga0501072_0071260 3300049588 Bacteria 2746
329 Ga0501073_0153938 3300049589 Bacteria 1593
330 Ga0501074_0058368 3300049590 Bacteria 2780
331 Ga0501075_0004347 3300049591 Bacteria 9586
332 Ga0501076_0156513 3300049592 Bacteria 1855
333 Ga0501079_0158167 3300049741 Bacteria 1766
334 Ga0501079_0254847 3300049741 Bacteria 1372
335 Ga0501080_0161631 3300049742 Bacteria 2068
336 Ga0501081_0487599 3300049743 Bacteria 918
337 Ga0501035_0008158 3300049822 Bacteria 9760
338 Ga0501035_0364087 3300049822 Bacteria 1208
339 Ga0501044_0057502 3300049823 Bacteria 3991
340 Ga0501044_0166201 3300049823 Bacteria 2180
341 Ga0501045_0077981 3300049824 Bacteria 2442
342 Ga0501045_0115198 3300049824 Bacteria 1994
343 nmdc:mga00v17_139342_c1 3300050491 Unclassified 1554
344 nmdc:mga00v17_30717_c1 3300050491 Bacteria 3162
345 nmdc:mga00v17_55756_c1 3300050491 Bacteria 2414
346 nmdc:mga0yw44_15586_c1 3300050492 Bacteria 4076
347 nmdc:mga0yw44_43572_c1 3300050492 Bacteria 2680
348 nmdc:mga0yw44_99150_c1 3300050492 Bacteria 1853
349 nmdc:mga04h51_36325_c1 3300050495 Bacteria 1584
350 nmdc:mga05p37_448803_c1 3300050507 Bacteria 1493
351 nmdc:mga06r32_609226_c1 3300050510 Bacteria 1062
352 nmdc:mga0n895_73788_c1 3300050512 Bacteria 3388
353 nmdc:mga0rr50_105896_c1 3300050513 Bacteria 2218
354 nmdc:mga0a205_221308_c1 3300050515 Bacteria 1778
355 Ga0495601_0000326 3300053077 Bacteria 25282
356 Ga0495612_0011747 3300053078 Bacteria 3529
357 Ga0495595_0000103 3300053084 Bacteria 38598
358 Ga0495619_0000025 3300053085 Bacteria 167905
359 Ga0495619_0033354 3300053085 Bacteria 3343
360 Ga0500566_0001679 3300053094 Bacteria 12979
361 Ga0500614_000397 3300053123 Bacteria 11312
362 Ga0501084_0091048 3300054114 Bacteria 2561
363 Ga0501082_0125991 3300060353 Bacteria 2221
364 Ga0530510_0108453 3300061734 Bacteria 2032
365 Ga0530510_0168569 3300061734 Bacteria 1622
366 Ga0495624_0008756
367 JGI24746J21847_1000158
368 Ga0070658_10013036
369 Ga0070658_10013240
370 Ga0070683_100100934
371 Ga0070683_100216610
372 Ga0070683_100519848
373 Ga0070690_100166946
374 Ga0070666_10010018
375 Ga0070680_100004075
376 Ga0070680_100499893
377 Ga0070682_100005880
378 Ga0070682_100368980
379 Ga0068868_100003415
380 Ga0068868_100189640
381 Ga0070660_100012090
382 Ga0070661_100000023
383 Ga0070661_100036157
384 Ga0070668_100055205
385 Ga0070668_100064648
386 Ga0070675_100000111
387 Ga0070675_100289448
388 Ga0070674_100000064
389 Ga0070674_100047314
390 Ga0070674_100066158
391 Ga0070673_100038478
392 Ga0070688_100000068
393 Ga0070659_100012260
394 Ga0070667_100097536
395 Ga0070667_100280505
396 Ga0070710_10120246
397 Ga0070701_10127902
398 Ga0070711_100010077
399 Ga0070711_100078971
400 Ga0070700_100000366
401 Ga0070663_100002635
402 Ga0070662_100000004
403 Ga0070662_100006680
404 Ga0070681_10751512
405 Ga0068867_100000281
406 Ga0070685_10000364
407 Ga0070685_10011182
408 Ga0070679_100005920
409 Ga0070679_100263647
410 Ga0070684_100013689
411 Ga0070684_100035480
412 Ga0070684_100224255
413 Ga0070684_100334120
414 Ga0068853_100033228
415 Ga0068853_100055564
416 Ga0070672_100000015
417 Ga0070672_100053404
418 Ga0070686_100020206
419 Ga0070665_100000106
420 Ga0070665_100001339
421 Ga0070665_100089169
422 Ga0070704_100058118
423 Ga0070704_100089752
424 Ga0070664_100090533
425 Ga0070664_100208976
426 Ga0068857_100012728
427 Ga0068854_100005170
428 Ga0068854_100185602
429 Ga0068856_100013668
430 Ga0068856_100350888
431 Ga0068852_100002607
432 Ga0068864_100000045
433 Ga0068866_10000001
434 Ga0068863_100000021
435 Ga0068858_100000216
436 Ga0068858_100040767
437 Ga0068860_100056055
438 Ga0068860_100531149
439 Ga0081538_10017400
440 Ga0075365_10093364
441 Ga0075365_10464850
442 Ga0075368_10168041
443 Ga0075363_100043883
444 Ga0075364_10009320
445 Ga0075364_10058111
446 Ga0075364_10123280
447 Ga0070715_10000001
448 Ga0070712_100008219
449 Ga0070712_100010232
450 Ga0075433_10031937
451 Ga0075434_100111975
452 Ga0068865_100112666
453 Ga0075435_100013269
454 Ga0105240_10013241
455 Ga0105245_10000454
456 Ga0105245_10008108
457 Ga0105245_10077147
458 Ga0105245_10573677
459 Ga0114129_10616288
460 Ga0105243_10017722
461 Ga0105237_10026561
462 Ga0105238_10000011
463 Ga0105238_10005199
464 Ga0105239_10162179
465 Ga0105246_10597925
466 Ga0157371_10158030
467 Ga0157371_10290992
468 Ga0157370_10043566
469 Ga0157369_10027214
470 Ga0157369_10282985
471 Ga0157374_10005775
472 Ga0157378_10002995
473 Ga0157378_10005465
474 Ga0163162_10790925
475 Ga0157372_10135996
476 Ga0157375_10001152
477 Ga0157375_10002277
478 Ga0157375_10016006
479 Ga0157375_10016397
480 Ga0163163_10508152
481 Ga0157380_10001196
482 Ga0157380_10498645
483 Ga0157377_10031103
484 Ga0163161_10000035
485 Ga0163161_10154505
486 Ga0206353_11335746
487 Ga0224712_10285118
488 Ga0207692_10118831
489 Ga0207642_10000002
490 Ga0207688_10042982
491 Ga0207680_10014124
492 Ga0207680_10101391
493 Ga0207699_10239546
494 Ga0207705_10033400
495 Ga0207705_10034117
496 Ga0207705_10149277
497 Ga0207654_10210197
498 Ga0207693_10006565
499 Ga0207693_10013567
500 Ga0207662_10071812
501 Ga0207657_10000307
502 Ga0207649_10000523
503 Ga0207649_10290525
504 Ga0207652_10003690
505 Ga0207694_10000004
506 Ga0207659_10000010
507 Ga0207659_10024803
508 Ga0207687_10004954
509 Ga0207687_10052643
510 Ga0207690_10022335
511 Ga0207706_10000012
512 Ga0207706_10012589
513 Ga0207686_10010146
514 Ga0207709_10009100
515 Ga0207709_10107178
516 Ga0207670_10412613
517 Ga0207669_10000018
518 Ga0207669_10486808
519 Ga0207704_10026638
520 Ga0207691_10000044
521 Ga0207691_10031048
522 Ga0207661_10000224
523 Ga0207661_10004878
524 Ga0207661_10008084
525 Ga0207661_10218218
526 Ga0207668_10002989
527 Ga0207668_10058307
528 Ga0207640_10007209
529 Ga0207640_10080946
530 Ga0207658_10079501
531 Ga0207677_10015101
532 Ga0207677_10079551
533 Ga0207703_10000023
534 Ga0207703_10000152
535 Ga0207639_10041767
536 Ga0207639_10047985
537 Ga0207639_10144895
538 Ga0207678_10015271
539 Ga0207708_10005179
540 Ga0207702_10241831
541 Ga0207641_10000151
542 Ga0207641_10220983
543 Ga0207648_10000872
544 Ga0207648_10297931
545 Ga0207676_10000016
546 Ga0207674_10176191
547 Ga0207675_100125937
548 Ga0207675_100514189
549 Ga0207683_10020098
550 Ga0207683_10087288
551 Ga0207698_10025249
552 Ga0268266_10000047
553 Ga0268266_10009487
554 Ga0268264_10006655
555 Ga0268264_10545646
556 Ga0268264_10578985
557 Ga0265326_10000102
558 Ga0265322_10000001
559 Ga0265338_10125844
560 Ga0265324_10005914
561 Ga0265332_10041483
562 Ga0265328_10041256
563 Ga0265320_10000002
564 Ga0265329_10005229
565 Ga0265331_10000751
566 Ga0265327_10000011
567 Ga0265316_10070161
568 Ga0307408_100037001
569 Ga0265314_10000062
570 Ga0316576_10001940
571 Ga0307405_10012861
572 Ga0307410_10050145
573 Ga0307406_10059172
574 Ga0307409_100019635
575 Ga0307416_100289933
576 Ga0307411_10042988
577 Ga0307415_100061447
578 Ga0307415_100188490
579 Ga0316574_0046665
580 Ga0373937_0496596
581 Ga0316582_0278737
582 Ga0395898_0022204
583 Ga0395898_0043389
584 Ga0436365_0172502
585 Ga0451853_2516419
586 Ga0466963_0000001
587 Ga0466968_0026964
588 Ga0466967_0041876
589 Ga0495592_0036400
590 Ga0495603_0001695
591 Ga0495603_0226533
592 Ga0495629_0000272
593 Ga0495629_0004323
594 Ga0495641_0000044
595 Ga0495641_0019025
596 Ga0495641_0044663
597 Ga0495653_0088082
598 Ga0495582_0000011
599 Ga0495662_0000061
600 Ga0495664_0452671
601 Ga0495608_0000583
602 Ga0495608_0452156
603 Ga0495618_0000174
604 Ga0495628_0008782
605 Ga0495628_0092384
606 Ga0495630_0000056
607 Ga0495652_0485770
608 Ga0495586_0012117
609 Ga0495621_0001829
610 Ga0495656_0002145
611 Ga0495668_0036089
612 Ga0495634_0000018
613 Ga0495625_0000587
614 Ga0495657_0026832
615 Ga0495647_0000008
616 Ga0495647_0000352
617 Ga0495647_0000631
618 Ga0495658_0000005
619 Ga0495613_0000203
620 Ga0495624_0000008
621 Ga0495624_0000267
622 Ga0495649_0001624
623 Ga0495600_0001684
624 Ga0495604_0000019
625 Ga0495604_0012279
626 Ga0495676_0000299
627 Ga0495676_0074173
628 Ga0495680_0000773
629 Ga0495680_0003005
630 Ga0495673_0031620
631 Ga0495593_0026947
632 Ga0495602_0094124
633 Ga0496100_0019348
634 Ga0496101_0002935
635 Ga0496102_0023083
636 Ga0496103_0015756
637 Ga0496104_0021896
638 Ga0496106_0004435
639 Ga0496106_0006160
640 Ga0496106_0063106
641 Ga0496107_0025303
642 Ga0496107_0052079
643 Ga0496107_0105665
644 Ga0496108_0002109
645 Ga0496108_0005678
646 Ga0496108_0031506
647 Ga0496109_0000129
648 Ga0496109_0001311
649 Ga0496109_0001392
650 Ga0496109_0130575
651 Ga0496110_0146204
652 Ga0496110_0322518
653 Ga0496110_0539364
654 Ga0496110_0768864
655 Ga0496110_0855829
656 Ga0496111_0033844
657 Ga0496112_0123478
658 Ga0496113_0033970
659 Ga0496113_0035645
660 Ga0496114_0058546
661 Ga0496114_0064505
662 Ga0496115_0002082
663 Ga0496115_0003019
664 Ga0501031_0101404
665 Ga0501033_0033540
666 Ga0501034_0008403
667 Ga0501034_0231347
668 Ga0501036_0050458
669 Ga0501037_0031121
670 Ga0501038_0024670
671 Ga0501039_0003795
672 Ga0501040_0061348
673 Ga0501041_0222215
674 Ga0501042_0052938
675 Ga0501042_0177050
676 Ga0501043_0028532
677 Ga0501046_0463302
678 Ga0501047_0524859
679 Ga0501047_0657076
680 Ga0501047_0680425
681 Ga0501048_0359160
682 Ga0501067_0025635
683 Ga0501067_0227134
684 Ga0501068_0064036
685 Ga0501069_0032882
686 Ga0501069_0229226
687 Ga0501070_0024271
688 Ga0501070_0170835
689 Ga0501070_0700174
690 Ga0501071_0116137
691 Ga0501071_0546959
692 Ga0501072_0051631
693 Ga0501072_0071260
694 Ga0501073_0153938
695 Ga0501074_0058368
696 Ga0501075_0004347
697 Ga0501076_0156513
698 Ga0501079_0158167
699 Ga0501079_0254847
700 Ga0501080_0161631
701 Ga0501081_0487599
702 Ga0501035_0008158
703 Ga0501035_0364087
704 Ga0501044_0057502
705 Ga0501044_0166201
706 Ga0501045_0077981
707 Ga0501045_0115198
708 nmdc:mga00v17_139342_c1
709 nmdc:mga00v17_30717_c1
710 nmdc:mga00v17_55756_c1
711 nmdc:mga0yw44_15586_c1
712 nmdc:mga0yw44_43572_c1
713 nmdc:mga0yw44_99150_c1
714 nmdc:mga04h51_36325_c1
715 nmdc:mga05p37_448803_c1
716 nmdc:mga06r32_609226_c1
717 nmdc:mga0n895_73788_c1
718 nmdc:mga0rr50_105896_c1
719 nmdc:mga0a205_221308_c1
720 Ga0495601_0000326
721 Ga0495612_0011747
722 Ga0495595_0000103
723 Ga0495619_0000025
724 Ga0495619_0033354
725 Ga0500566_0001679
726 Ga0500614_000397
727 Ga0501084_0091048
728 Ga0501082_0125991
729 Ga0530510_0108453
730 Ga0530510_0168569

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

23

216

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

29

237

0.89

PF08659

KR

KR domain

24

200

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ehd-assembly1.cif.gz_A crystal structure analysis of oxidoreductase 0.9362 6 231
3asu-assembly1.cif.gz_B-2 crystal structure of serine dehydrogenase from escherichia coli 0.9311 8 236
3tfo-assembly1.cif.gz_D crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.928 6 232
2ehd-assembly1.cif.gz_A crystal structure analysis of oxidoreductase 0.9275 6 231
3tfo-assembly1.cif.gz_B crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9261 6 233
ID Description Score Start End Superfamily
2ehdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9362 6 231 3.40.50.720
2ehdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9275 6 231 3.40.50.720
3tfoB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9261 6 233 3.40.50.720
af_Q2FVD5_4_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9255 6 232 3.40.50.720
3p19C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9233 7 234 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A838FIT2-F1-model_v4 SDR family oxidoreductase 0.968 4 235 GO:0016020
GO:0016491
AF-A0A838PSI1-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9631 50 236
AF-A0A838PSI1-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9482 50 236
AF-A0A7S1EY49-F1-model_v4 Uncharacterized protein 0.9446 5 147 GO:0016020
GO:0016491
AF-A0A7S0ZS60-F1-model_v4 Uncharacterized protein 0.9374 1 137 GO:0016020
GO:0016491

Map