F423952

General Info

Members Datasets Scaffolds Average Seq Length
366 195 730 110

Family's Representative Sequence

Representative Sequence 3300005547|Ga0070693_100868297|Ga0070693_1008682971
Length 135
Sequence VPFVLIKKTFGFLELIVILRCNDEIMGLTKSEIFTDKQNRLAGMMKALAHPARIAIVQHLIKTNACINGDLVEELGLAQPTISQHLKELKNAGLIQGTIEGTSVCYCIEPKAWALYQKEIGALFAAYKGGEGCCG

Samples

Sample ID Description Type Environment
1 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
120 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
121 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
129 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
132 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
135 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
136 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
137 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
138 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
139 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
140 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
141 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
142 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
143 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
144 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
145 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
146 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
147 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
150 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
151 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
152 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
153 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
154 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
155 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
156 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
157 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
158 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
159 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
160 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
161 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
162 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
163 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
164 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
165 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
166 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
167 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
168 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
169 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
170 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
171 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
175 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
177 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
180 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
181 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
182 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
183 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
184 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
185 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
186 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
187 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
188 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
189 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
190 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
191 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
192 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
193 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
194 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
195 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.64
Nodule 0.55
Rhizoplane 1.64
Rhizosphere 90.44
Stem 0
Stem Tuber 0
Unclassified 16.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070693_100868297 3300005547 Bacteria 674
2 rootH1_10061908 3300003316 Bacteria 8102
3 rootH2_10010515 3300003320 Bacteria 12220
4 rootH1_10146267 3300003323 Bacteria 3771
5 rootH1_10341668 3300003323 Bacteria 2230
6 Ga0065714_10094604 3300005288 Bacteria 1811
7 Ga0065715_11057349 3300005293 Bacteria 530
8 Ga0070658_10042691 3300005327 Bacteria 3663
9 Ga0070658_11833707 3300005327 Bacteria 524
10 Ga0070676_10034971 3300005328 Bacteria 2887
11 Ga0070683_100048314 3300005329 Bacteria 3934
12 Ga0070683_101345706 3300005329 Bacteria 686
13 Ga0070690_101604879 3300005330 Unclassified 527
14 Ga0068869_100044118 3300005334 Bacteria 3206
15 Ga0068869_100193801 3300005334 Unclassified 1599
16 Ga0070666_10002979 3300005335 Bacteria 10267
17 Ga0070666_10229944 3300005335 Bacteria 1309
18 Ga0068868_100016312 3300005338 Bacteria 5513
19 Ga0068868_101541889 3300005338 Unclassified 623
20 Ga0070691_10177336 3300005341 Bacteria 1107
21 Ga0070668_100034157 3300005347 Bacteria 3875
22 Ga0070675_100243326 3300005354 Unclassified 1572
23 Ga0070674_100126815 3300005356 Bacteria 1897
24 Ga0070673_100012995 3300005364 Bacteria 5742
25 Ga0070688_100262264 3300005365 Bacteria 1234
26 Ga0070659_100114084 3300005366 Unclassified 2183
27 Ga0070659_100487844 3300005366 Bacteria 1049
28 Ga0070667_100007158 3300005367 Bacteria 9270
29 Ga0070667_100490588 3300005367 Bacteria 1125
30 Ga0070711_101504284 3300005439 Bacteria 587
31 Ga0070711_101625109 3300005439 Unclassified 565
32 Ga0070663_100847618 3300005455 Unclassified 786
33 Ga0070662_100099135 3300005457 Bacteria 2202
34 Ga0068867_100003587 3300005459 Bacteria 10916
35 Ga0070685_10007381 3300005466 Bacteria 5622
36 Ga0070684_100006927 3300005535 Bacteria 8806
37 Ga0068853_100000587 3300005539 Bacteria 24911
38 Ga0068853_100020621 3300005539 Bacteria 5481
39 Ga0068853_100037849 3300005539 Bacteria 4107
40 Ga0068853_100335384 3300005539 Bacteria 1404
41 Ga0068853_100475653 3300005539 Bacteria 1177
42 Ga0068853_100890077 3300005539 Bacteria 855
43 Ga0068853_102343219 3300005539 Bacteria 517
44 Ga0070672_100364721 3300005543 Bacteria 1233
45 Ga0070693_100238310 3300005547 Bacteria 1200
46 Ga0070665_100000189 3300005548 Bacteria 109948
47 Ga0070665_100023780 3300005548 Bacteria 6172
48 Ga0068855_100048040 3300005563 Bacteria 5038
49 Ga0068855_100099459 3300005563 Bacteria 3350
50 Ga0068855_100559712 3300005563 Unclassified 1237
51 Ga0068855_102528087 3300005563 Bacteria 510
52 Ga0070664_100158950 3300005564 Bacteria 1998
53 Ga0068857_100000317 3300005577 Bacteria 33272
54 Ga0068854_100042028 3300005578 Bacteria 3233
55 Ga0068854_100060467 3300005578 Bacteria 2741
56 Ga0068854_100688453 3300005578 Unclassified 881
57 Ga0068856_100000104 3300005614 Bacteria 81872
58 Ga0068856_100011868 3300005614 Bacteria 8439
59 Ga0068856_100134736 3300005614 Bacteria 2475
60 Ga0068856_100409281 3300005614 Bacteria 1376
61 Ga0068852_100000982 3300005616 Bacteria 18761
62 Ga0068852_100119730 3300005616 Bacteria 2407
63 Ga0068852_100136005 3300005616 Bacteria 2269
64 Ga0068852_100154534 3300005616 Bacteria 2136
65 Ga0068852_100980948 3300005616 Bacteria 863
66 Ga0068864_100005927 3300005618 Bacteria 10018
67 Ga0068864_101007609 3300005618 Bacteria 826
68 Ga0068866_10650838 3300005718 Unclassified 717
69 Ga0068861_100067221 3300005719 Unclassified 2765
70 Ga0068851_10090476 3300005834 Bacteria 1610
71 Ga0068863_100196041 3300005841 Bacteria 1941
72 Ga0068858_100004728 3300005842 Bacteria 13335
73 Ga0068858_101434107 3300005842 Bacteria 680
74 Ga0068860_100000005 3300005843 Bacteria 472349
75 Ga0068860_100027661 3300005843 Bacteria 5460
76 Ga0068860_100051086 3300005843 Bacteria 3934
77 Ga0068862_100272658 3300005844 Bacteria 1548
78 Ga0081540_1016128 3300005983 Bacteria 4692
79 Ga0081540_1247854 3300005983 Unclassified 622
80 Ga0097621_100007509 3300006237 Bacteria 7804
81 Ga0097621_100425608 3300006237 Bacteria 1192
82 Ga0068871_101813128 3300006358 Bacteria 579
83 Ga0068865_100028645 3300006881 Unclassified 3689
84 Ga0099826_10058522 3300006948 Bacteria 2527
85 Ga0105240_10000023 3300009093 Bacteria 385028
86 Ga0105240_10000276 3300009093 Bacteria 101817
87 Ga0105240_10000833 3300009093 Bacteria 55556
88 Ga0105240_10002010 3300009093 Bacteria 33532
89 Ga0105240_10002592 3300009093 Bacteria 28936
90 Ga0105240_10020428 3300009093 Bacteria 8834
91 Ga0105240_10064502 3300009093 Unclassified 4551
92 Ga0105240_10128920 3300009093 Bacteria 3036
93 Ga0105240_10249307 3300009093 Unclassified 2054
94 Ga0105240_11422667 3300009093 Bacteria 728
95 Ga0105240_12434749 3300009093 Bacteria 542
96 Ga0105247_10007937 3300009101 Bacteria 6487
97 Ga0105243_10393902 3300009148 Unclassified 1285
98 Ga0105241_10006070 3300009174 Bacteria 8913
99 Ga0105241_10158659 3300009174 Bacteria 1857
100 Ga0105241_10410098 3300009174 Unclassified 1190
101 Ga0105241_10444444 3300009174 Bacteria 1146
102 Ga0105241_12619481 3300009174 Unclassified 507
103 Ga0105241_12619853 3300009174 Unclassified 507
104 Ga0105242_10025813 3300009176 Bacteria 4653
105 Ga0105242_10944310 3300009176 Bacteria 866
106 Ga0105248_10006702 3300009177 Bacteria 12632
107 Ga0105237_10006548 3300009545 Bacteria 12885
108 Ga0105237_10026390 3300009545 Bacteria 5937
109 Ga0105237_10228850 3300009545 Bacteria 1860
110 Ga0105237_10238527 3300009545 Bacteria 1819
111 Ga0105237_10246370 3300009545 Bacteria 1789
112 Ga0105238_10001751 3300009551 Bacteria 21779
113 Ga0105238_10016912 3300009551 Bacteria 7401
114 Ga0105238_10031339 3300009551 Bacteria 5412
115 Ga0105238_10515817 3300009551 Bacteria 1197
116 Ga0105238_10531330 3300009551 Unclassified 1179
117 Ga0105238_12619717 3300009551 Unclassified 540
118 Ga0105249_10113036 3300009553 Bacteria 2569
119 Ga0105249_10179296 3300009553 Bacteria 2060
120 Ga0099796_10517329 3300010159 Bacteria 535
121 Ga0105239_10000267 3300010375 Bacteria 77181
122 Ga0105239_10000433 3300010375 Bacteria 61072
123 Ga0105239_10001651 3300010375 Bacteria 29415
124 Ga0105239_10022970 3300010375 Bacteria 6877
125 Ga0105239_10038549 3300010375 Bacteria 5237
126 Ga0105239_10068134 3300010375 Bacteria 3911
127 Ga0105239_10173139 3300010375 Bacteria 2414
128 Ga0105239_10920405 3300010375 Archaea 1004
129 Ga0157373_11085852 3300013100 Bacteria 600
130 Ga0157370_10042373 3300013104 Bacteria 4387
131 Ga0157370_10217348 3300013104 Bacteria 1771
132 Ga0157370_11010957 3300013104 Bacteria 752
133 Ga0157369_10086766 3300013105 Bacteria 3342
134 Ga0157369_10299353 3300013105 Bacteria 1673
135 Ga0157369_10703063 3300013105 Bacteria 1041
136 Ga0157374_10000003 3300013296 Bacteria 854471
137 Ga0157374_10050351 3300013296 Bacteria 3871
138 Ga0157374_10055701 3300013296 Unclassified 3691
139 Ga0157374_10638329 3300013296 Bacteria 1076
140 Ga0157378_10032394 3300013297 Unclassified 4619
141 Ga0157378_10041607 3300013297 Bacteria 4076
142 Ga0157378_10109063 3300013297 Unclassified 2535
143 Ga0157378_11524809 3300013297 Unclassified 713
144 Ga0163162_10000459 3300013306 Bacteria 37749
145 Ga0163162_10001420 3300013306 Bacteria 22262
146 Ga0163162_10013639 3300013306 Bacteria 7940
147 Ga0163162_10041824 3300013306 Bacteria 4585
148 Ga0163162_10319150 3300013306 Bacteria 1686
149 Ga0163162_13150417 3300013306 Bacteria 529
150 Ga0157372_10007012 3300013307 Bacteria 12004
151 Ga0157372_10015962 3300013307 Bacteria 8055
152 Ga0157372_10046901 3300013307 Unclassified 4798
153 Ga0157372_10165526 3300013307 Bacteria 2557
154 Ga0157372_10813583 3300013307 Bacteria 1085
155 Ga0157372_11540641 3300013307 Bacteria 766
156 Ga0157372_13417859 3300013307 Unclassified 505
157 Ga0157375_10046366 3300013308 Unclassified 4237
158 Ga0157375_10104445 3300013308 Bacteria 2922
159 Ga0163163_10008368 3300014325 Bacteria 9185
160 Ga0163163_10217605 3300014325 Bacteria 1959
161 Ga0163163_10867730 3300014325 Bacteria 966
162 Ga0157379_10002403 3300014968 Bacteria 15642
163 Ga0157379_10246835 3300014968 Bacteria 1620
164 Ga0157376_10000580 3300014969 Bacteria 23607
165 Ga0157376_10035642 3300014969 Bacteria 4025
166 Ga0157376_10170778 3300014969 Unclassified 1980
167 Ga0157376_10378467 3300014969 Bacteria 1363
168 Ga0157376_11197005 3300014969 Bacteria 788
169 Ga0157376_11461732 3300014969 Bacteria 716
170 Ga0157376_12344799 3300014969 Bacteria 573
171 Ga0163161_10172193 3300017792 Bacteria 1656
172 Ga0163161_10770790 3300017792 Bacteria 806
173 Ga0207656_10618185 3300025321 Unclassified 553
174 Ga0207642_10541321 3300025899 Unclassified 718
175 Ga0207710_10120802 3300025900 Bacteria 1251
176 Ga0207688_10574437 3300025901 Bacteria 709
177 Ga0207680_10017113 3300025903 Bacteria 3823
178 Ga0207680_10285375 3300025903 Bacteria 1148
179 Ga0207680_10797593 3300025903 Bacteria 677
180 Ga0207647_10043755 3300025904 Bacteria 2800
181 Ga0207647_10089096 3300025904 Bacteria 1842
182 Ga0207645_10156852 3300025907 Bacteria 1487
183 Ga0207705_10032752 3300025909 Bacteria 3714
184 Ga0207705_10045407 3300025909 Bacteria 3157
185 Ga0207705_11429995 3300025909 Bacteria 525
186 Ga0207654_10069601 3300025911 Bacteria 2086
187 Ga0207654_10335143 3300025911 Bacteria 1038
188 Ga0207654_10414132 3300025911 Bacteria 939
189 Ga0207654_11416318 3300025911 Unclassified 507
190 Ga0207695_10000016 3300025913 Bacteria 771991
191 Ga0207695_10000184 3300025913 Bacteria 181201
192 Ga0207695_10000645 3300025913 Bacteria 69294
193 Ga0207695_10001186 3300025913 Bacteria 44969
194 Ga0207695_10046630 3300025913 Unclassified 4593
195 Ga0207695_10092837 3300025913 Unclassified 3028
196 Ga0207695_10195178 3300025913 Bacteria 1941
197 Ga0207695_10364844 3300025913 Bacteria 1331
198 Ga0207695_10661473 3300025913 Bacteria 925
199 Ga0207695_11003224 3300025913 Bacteria 715
200 Ga0207695_11708113 3300025913 Bacteria 510
201 Ga0207671_10012172 3300025914 Bacteria 6940
202 Ga0207671_10043367 3300025914 Unclassified 3326
203 Ga0207671_10323135 3300025914 Bacteria 1221
204 Ga0207671_10398112 3300025914 Bacteria 1095
205 Ga0207671_10521937 3300025914 Bacteria 947
206 Ga0207663_11294509 3300025916 Unclassified 587
207 Ga0207694_10013767 3300025924 Bacteria 6097
208 Ga0207694_10320890 3300025924 Bacteria 1278
209 Ga0207694_10709002 3300025924 Bacteria 849
210 Ga0207694_11288392 3300025924 Bacteria 618
211 Ga0207694_11298415 3300025924 Bacteria 615
212 Ga0207650_11340657 3300025925 Unclassified 609
213 Ga0207690_10079711 3300025932 Unclassified 2283
214 Ga0207690_10673846 3300025932 Unclassified 849
215 Ga0207706_10160084 3300025933 Bacteria 1979
216 Ga0207686_10312160 3300025934 Unclassified 1172
217 Ga0207709_11090722 3300025935 Bacteria 655
218 Ga0207669_10392814 3300025937 Bacteria 1084
219 Ga0207704_10004363 3300025938 Bacteria 6469
220 Ga0207691_10000596 3300025940 Bacteria 36065
221 Ga0207711_10052344 3300025941 Bacteria 3499
222 Ga0207689_10083897 3300025942 Bacteria 2619
223 Ga0207661_10064277 3300025944 Bacteria 2974
224 Ga0207679_10103466 3300025945 Bacteria 2231
225 Ga0207667_10001285 3300025949 Bacteria 31480
226 Ga0207667_10003030 3300025949 Bacteria 20857
227 Ga0207667_10080493 3300025949 Bacteria 3375
228 Ga0207651_10072565 3300025960 Bacteria 2444
229 Ga0207712_10394155 3300025961 Bacteria 1162
230 Ga0207668_10020118 3300025972 Unclassified 4233
231 Ga0207640_10056837 3300025981 Bacteria 2571
232 Ga0207658_10211215 3300025986 Bacteria 1626
233 Ga0207658_10429067 3300025986 Unclassified 1167
234 Ga0207677_10012236 3300026023 Bacteria 4924
235 Ga0207677_11277160 3300026023 Unclassified 674
236 Ga0207703_10076156 3300026035 Bacteria 2782
237 Ga0207703_11282225 3300026035 Bacteria 704
238 Ga0207639_10136021 3300026041 Bacteria 2041
239 Ga0207639_10185237 3300026041 Unclassified 1774
240 Ga0207639_10400827 3300026041 Bacteria 1236
241 Ga0207639_10413811 3300026041 Bacteria 1217
242 Ga0207639_10831757 3300026041 Bacteria 861
243 Ga0207639_11443129 3300026041 Bacteria 646
244 Ga0207678_10961880 3300026067 Unclassified 755
245 Ga0207702_10000119 3300026078 Bacteria 92653
246 Ga0207702_10008170 3300026078 Bacteria 8848
247 Ga0207702_10169685 3300026078 Bacteria 2000
248 Ga0207702_10404503 3300026078 Bacteria 1317
249 Ga0207641_10016996 3300026088 Bacteria 5956
250 Ga0207648_10002112 3300026089 Bacteria 21646
251 Ga0207676_10004151 3300026095 Bacteria 10229
252 Ga0207674_10001038 3300026116 Bacteria 36091
253 Ga0207675_100092089 3300026118 Bacteria 2851
254 Ga0207683_10094143 3300026121 Bacteria 2670
255 Ga0207698_10041632 3300026142 Bacteria 3425
256 Ga0207698_11104259 3300026142 Bacteria 806
257 Ga0207698_11762625 3300026142 Bacteria 634
258 Ga0209489_118780 3300027361 Bacteria 2567
259 Ga0268266_10000180 3300028379 Bacteria 112295
260 Ga0268266_10179953 3300028379 Bacteria 1924
261 Ga0268264_10000012 3300028381 Bacteria 521740
262 Ga0268264_10019504 3300028381 Bacteria 5540
263 Ga0268264_10051124 3300028381 Bacteria 3443
264 Ga0268264_10151017 3300028381 Bacteria 2082
265 Ga0307517_10014647 3300028786 Bacteria 10505
266 Ga0307517_10017476 3300028786 Bacteria 9348
267 Ga0307517_10362532 3300028786 Bacteria 782
268 Ga0307511_10151612 3300030521 Bacteria 1329
269 Ga0316576_10276593 3300031727 Bacteria 1258
270 Ga0307405_11962948 3300031731 Bacteria 523
271 Ga0316577_10096403 3300031733 Unclassified 1657
272 Ga0307413_10004024 3300031824 Bacteria 6320
273 Ga0307413_11329203 3300031824 Bacteria 630
274 Ga0307416_100009832 3300032002 Bacteria 6288
275 Ga0307414_10000001 3300032004 Bacteria 1352954
276 Ga0307414_10186876 3300032004 Bacteria 1672
277 Ga0307414_10370897 3300032004 Bacteria 1234
278 Ga0307414_10825552 3300032004 Bacteria 846
279 Ga0307411_10000001 3300032005 Bacteria 931810
280 Ga0316574_0510015 3300035398 Bacteria 749
281 Ga0373933_0924897 3300035724 Unclassified 574
282 Ga0373937_0192883 3300036401 Bacteria 1915
283 Ga0316582_0255266 3300036647 Bacteria 1202
284 Ga0316584_0060279 3300036712 Bacteria 2842
285 Ga0395905_0842414 3300037471 Unclassified 820
286 Ga0439466_0107207 3300041411 Bacteria 868
287 Ga0451807_1616836 3300041486 Bacteria 2538
288 Ga0451837_0405384 3300041494 Bacteria 1196
289 Ga0439445_0270689 3300042004 Unclassified 509
290 Ga0466969_0580018 3300044656 Unclassified 514
291 Ga0466972_0011885 3300044658 Bacteria 4373
292 Ga0466972_0275503 3300044658 Bacteria 786
293 Ga0466965_0765855 3300044683 Bacteria 557
294 Ga0466966_0111171 3300044684 Bacteria 1689
295 Ga0466961_0160299 3300044693 Bacteria 1402
296 Ga0466971_0041967 3300044719 Bacteria 2055
297 Ga0466968_0117531 3300044735 Unclassified 1201
298 Ga0466957_0950393 3300044842 Unclassified 616
299 Ga0466959_0001248 3300045049 Bacteria 15359
300 Ga0466959_0214757 3300045049 Bacteria 1336
301 Ga0466958_0932253 3300045836 Bacteria 566
302 Ga0466967_1535956 3300045976 Unclassified 663
303 Ga0495638_0033777 3300046460 Bacteria 3270
304 Ga0495638_0198801 3300046460 Bacteria 1133
305 Ga0495638_0522882 3300046460 Bacteria 594
306 Ga0495650_0000050 3300046471 Bacteria 318894
307 Ga0495606_0000036 3300046507 Bacteria 234596
308 Ga0495606_0019305 3300046507 Bacteria 5077
309 Ga0495610_0000167 3300046512 Bacteria 73458
310 Ga0495610_0001572 3300046512 Bacteria 20100
311 Ga0495616_0000271 3300046513 Bacteria 42005
312 Ga0495630_0386640 3300046517 Bacteria 1072
313 Ga0495648_0001914 3300046524 Bacteria 19837
314 Ga0495586_0512900 3300046535 Bacteria 692
315 Ga0495609_0005232 3300046538 Bacteria 6903
316 Ga0495645_0930075 3300046543 Unclassified 515
317 Ga0495633_0002805 3300046558 Bacteria 12052
318 Ga0495625_0000105 3300046660 Bacteria 126078
319 Ga0495635_0363430 3300046663 Bacteria 965
320 Ga0495661_0013486 3300046665 Bacteria 5487
321 Ga0495623_0500309 3300046679 Bacteria 642
322 Ga0495671_0096463 3300046692 Bacteria 1447
323 Ga0495649_0000011 3300046694 Bacteria 416695
324 Ga0495649_0457247 3300046694 Bacteria 637
325 Ga0495660_0036810 3300046810 Bacteria 2728
326 Ga0495660_0110152 3300046810 Bacteria 1406
327 Ga0495604_0866288 3300047317 Bacteria 566
328 Ga0495683_0070377 3300047323 Bacteria 1718
329 Ga0495683_0142663 3300047323 Bacteria 1121
330 Ga0495687_005139 3300047443 Bacteria 8471
331 Ga0495673_0104808 3300047469 Bacteria 1138
332 Ga0495686_0271201 3300047472 Bacteria 946
333 Ga0495686_0482355 3300047472 Bacteria 655
334 Ga0496104_0706740 3300048907 Bacteria 916
335 Ga0496104_1661811 3300048907 Unclassified 541
336 Ga0496115_0506934 3300048918 Bacteria 969
337 Ga0496115_0532752 3300048918 Bacteria 940
338 Ga0496115_0564604 3300048918 Unclassified 908
339 Ga0496120_0328233 3300048923 Bacteria 693
340 Ga0501038_1190600 3300049574 Bacteria 554
341 Ga0501072_1169481 3300049588 Bacteria 598
342 Ga0501249_002692 3300049679 Bacteria 3580
343 Ga0501080_0019659 3300049742 Bacteria 6256
344 Ga0501080_0144392 3300049742 Bacteria 2200
345 Ga0501266_000016 3300049763 Bacteria 164181
346 Ga0495619_0118540 3300053085 Bacteria 1814
347 Ga0495619_0407478 3300053085 Unclassified 939
348 Ga0500646_0001073 3300053090 Bacteria 7440
349 Ga0500646_0011392 3300053090 Unclassified 2288
350 Ga0500646_0075945 3300053090 Bacteria 1016
351 Ga0500583_0001438 3300053092 Bacteria 6829
352 Ga0500641_0000013 3300053096 Bacteria 156919
353 Ga0500594_0059325 3300053118 Bacteria 1099
354 Ga0500618_018512 3300053125 Bacteria 1722
355 Ga0500628_044649 3300053129 Bacteria 1027
356 Ga0500642_0120876 3300053130 Bacteria 1225
357 Ga0500568_0018087 3300053139 Bacteria 3094
358 Ga0500588_0413822 3300053146 Unclassified 514
359 Ga0500616_0004907 3300053153 Bacteria 9299
360 Ga0500622_0000686 3300053156 Bacteria 29937
361 Ga0500622_0099901 3300053156 Bacteria 1430
362 Ga0500636_0465122 3300053177 Bacteria 568
363 Ga0500637_0350081 3300053178 Unclassified 786
364 Ga0500645_094589 3300053730 Bacteria 846
365 Ga0466962_0090466 3300061719 Bacteria 1466
366 Ga0070693_100868297
367 rootH1_10061908
368 rootH2_10010515
369 rootH1_10146267
370 rootH1_10341668
371 Ga0065714_10094604
372 Ga0065715_11057349
373 Ga0070658_10042691
374 Ga0070658_11833707
375 Ga0070676_10034971
376 Ga0070683_100048314
377 Ga0070683_101345706
378 Ga0070690_101604879
379 Ga0068869_100044118
380 Ga0068869_100193801
381 Ga0070666_10002979
382 Ga0070666_10229944
383 Ga0068868_100016312
384 Ga0068868_101541889
385 Ga0070691_10177336
386 Ga0070668_100034157
387 Ga0070675_100243326
388 Ga0070674_100126815
389 Ga0070673_100012995
390 Ga0070688_100262264
391 Ga0070659_100114084
392 Ga0070659_100487844
393 Ga0070667_100007158
394 Ga0070667_100490588
395 Ga0070711_101504284
396 Ga0070711_101625109
397 Ga0070663_100847618
398 Ga0070662_100099135
399 Ga0068867_100003587
400 Ga0070685_10007381
401 Ga0070684_100006927
402 Ga0068853_100000587
403 Ga0068853_100020621
404 Ga0068853_100037849
405 Ga0068853_100335384
406 Ga0068853_100475653
407 Ga0068853_100890077
408 Ga0068853_102343219
409 Ga0070672_100364721
410 Ga0070693_100238310
411 Ga0070665_100000189
412 Ga0070665_100023780
413 Ga0068855_100048040
414 Ga0068855_100099459
415 Ga0068855_100559712
416 Ga0068855_102528087
417 Ga0070664_100158950
418 Ga0068857_100000317
419 Ga0068854_100042028
420 Ga0068854_100060467
421 Ga0068854_100688453
422 Ga0068856_100000104
423 Ga0068856_100011868
424 Ga0068856_100134736
425 Ga0068856_100409281
426 Ga0068852_100000982
427 Ga0068852_100119730
428 Ga0068852_100136005
429 Ga0068852_100154534
430 Ga0068852_100980948
431 Ga0068864_100005927
432 Ga0068864_101007609
433 Ga0068866_10650838
434 Ga0068861_100067221
435 Ga0068851_10090476
436 Ga0068863_100196041
437 Ga0068858_100004728
438 Ga0068858_101434107
439 Ga0068860_100000005
440 Ga0068860_100027661
441 Ga0068860_100051086
442 Ga0068862_100272658
443 Ga0081540_1016128
444 Ga0081540_1247854
445 Ga0097621_100007509
446 Ga0097621_100425608
447 Ga0068871_101813128
448 Ga0068865_100028645
449 Ga0099826_10058522
450 Ga0105240_10000023
451 Ga0105240_10000276
452 Ga0105240_10000833
453 Ga0105240_10002010
454 Ga0105240_10002592
455 Ga0105240_10020428
456 Ga0105240_10064502
457 Ga0105240_10128920
458 Ga0105240_10249307
459 Ga0105240_11422667
460 Ga0105240_12434749
461 Ga0105247_10007937
462 Ga0105243_10393902
463 Ga0105241_10006070
464 Ga0105241_10158659
465 Ga0105241_10410098
466 Ga0105241_10444444
467 Ga0105241_12619481
468 Ga0105241_12619853
469 Ga0105242_10025813
470 Ga0105242_10944310
471 Ga0105248_10006702
472 Ga0105237_10006548
473 Ga0105237_10026390
474 Ga0105237_10228850
475 Ga0105237_10238527
476 Ga0105237_10246370
477 Ga0105238_10001751
478 Ga0105238_10016912
479 Ga0105238_10031339
480 Ga0105238_10515817
481 Ga0105238_10531330
482 Ga0105238_12619717
483 Ga0105249_10113036
484 Ga0105249_10179296
485 Ga0099796_10517329
486 Ga0105239_10000267
487 Ga0105239_10000433
488 Ga0105239_10001651
489 Ga0105239_10022970
490 Ga0105239_10038549
491 Ga0105239_10068134
492 Ga0105239_10173139
493 Ga0105239_10920405
494 Ga0157373_11085852
495 Ga0157370_10042373
496 Ga0157370_10217348
497 Ga0157370_11010957
498 Ga0157369_10086766
499 Ga0157369_10299353
500 Ga0157369_10703063
501 Ga0157374_10000003
502 Ga0157374_10050351
503 Ga0157374_10055701
504 Ga0157374_10638329
505 Ga0157378_10032394
506 Ga0157378_10041607
507 Ga0157378_10109063
508 Ga0157378_11524809
509 Ga0163162_10000459
510 Ga0163162_10001420
511 Ga0163162_10013639
512 Ga0163162_10041824
513 Ga0163162_10319150
514 Ga0163162_13150417
515 Ga0157372_10007012
516 Ga0157372_10015962
517 Ga0157372_10046901
518 Ga0157372_10165526
519 Ga0157372_10813583
520 Ga0157372_11540641
521 Ga0157372_13417859
522 Ga0157375_10046366
523 Ga0157375_10104445
524 Ga0163163_10008368
525 Ga0163163_10217605
526 Ga0163163_10867730
527 Ga0157379_10002403
528 Ga0157379_10246835
529 Ga0157376_10000580
530 Ga0157376_10035642
531 Ga0157376_10170778
532 Ga0157376_10378467
533 Ga0157376_11197005
534 Ga0157376_11461732
535 Ga0157376_12344799
536 Ga0163161_10172193
537 Ga0163161_10770790
538 Ga0207656_10618185
539 Ga0207642_10541321
540 Ga0207710_10120802
541 Ga0207688_10574437
542 Ga0207680_10017113
543 Ga0207680_10285375
544 Ga0207680_10797593
545 Ga0207647_10043755
546 Ga0207647_10089096
547 Ga0207645_10156852
548 Ga0207705_10032752
549 Ga0207705_10045407
550 Ga0207705_11429995
551 Ga0207654_10069601
552 Ga0207654_10335143
553 Ga0207654_10414132
554 Ga0207654_11416318
555 Ga0207695_10000016
556 Ga0207695_10000184
557 Ga0207695_10000645
558 Ga0207695_10001186
559 Ga0207695_10046630
560 Ga0207695_10092837
561 Ga0207695_10195178
562 Ga0207695_10364844
563 Ga0207695_10661473
564 Ga0207695_11003224
565 Ga0207695_11708113
566 Ga0207671_10012172
567 Ga0207671_10043367
568 Ga0207671_10323135
569 Ga0207671_10398112
570 Ga0207671_10521937
571 Ga0207663_11294509
572 Ga0207694_10013767
573 Ga0207694_10320890
574 Ga0207694_10709002
575 Ga0207694_11288392
576 Ga0207694_11298415
577 Ga0207650_11340657
578 Ga0207690_10079711
579 Ga0207690_10673846
580 Ga0207706_10160084
581 Ga0207686_10312160
582 Ga0207709_11090722
583 Ga0207669_10392814
584 Ga0207704_10004363
585 Ga0207691_10000596
586 Ga0207711_10052344
587 Ga0207689_10083897
588 Ga0207661_10064277
589 Ga0207679_10103466
590 Ga0207667_10001285
591 Ga0207667_10003030
592 Ga0207667_10080493
593 Ga0207651_10072565
594 Ga0207712_10394155
595 Ga0207668_10020118
596 Ga0207640_10056837
597 Ga0207658_10211215
598 Ga0207658_10429067
599 Ga0207677_10012236
600 Ga0207677_11277160
601 Ga0207703_10076156
602 Ga0207703_11282225
603 Ga0207639_10136021
604 Ga0207639_10185237
605 Ga0207639_10400827
606 Ga0207639_10413811
607 Ga0207639_10831757
608 Ga0207639_11443129
609 Ga0207678_10961880
610 Ga0207702_10000119
611 Ga0207702_10008170
612 Ga0207702_10169685
613 Ga0207702_10404503
614 Ga0207641_10016996
615 Ga0207648_10002112
616 Ga0207676_10004151
617 Ga0207674_10001038
618 Ga0207675_100092089
619 Ga0207683_10094143
620 Ga0207698_10041632
621 Ga0207698_11104259
622 Ga0207698_11762625
623 Ga0209489_118780
624 Ga0268266_10000180
625 Ga0268266_10179953
626 Ga0268264_10000012
627 Ga0268264_10019504
628 Ga0268264_10051124
629 Ga0268264_10151017
630 Ga0307517_10014647
631 Ga0307517_10017476
632 Ga0307517_10362532
633 Ga0307511_10151612
634 Ga0316576_10276593
635 Ga0307405_11962948
636 Ga0316577_10096403
637 Ga0307413_10004024
638 Ga0307413_11329203
639 Ga0307416_100009832
640 Ga0307414_10000001
641 Ga0307414_10186876
642 Ga0307414_10370897
643 Ga0307414_10825552
644 Ga0307411_10000001
645 Ga0316574_0510015
646 Ga0373933_0924897
647 Ga0373937_0192883
648 Ga0316582_0255266
649 Ga0316584_0060279
650 Ga0395905_0842414
651 Ga0439466_0107207
652 Ga0451807_1616836
653 Ga0451837_0405384
654 Ga0439445_0270689
655 Ga0466969_0580018
656 Ga0466972_0011885
657 Ga0466972_0275503
658 Ga0466965_0765855
659 Ga0466966_0111171
660 Ga0466961_0160299
661 Ga0466971_0041967
662 Ga0466968_0117531
663 Ga0466957_0950393
664 Ga0466959_0001248
665 Ga0466959_0214757
666 Ga0466958_0932253
667 Ga0466967_1535956
668 Ga0495638_0033777
669 Ga0495638_0198801
670 Ga0495638_0522882
671 Ga0495650_0000050
672 Ga0495606_0000036
673 Ga0495606_0019305
674 Ga0495610_0000167
675 Ga0495610_0001572
676 Ga0495616_0000271
677 Ga0495630_0386640
678 Ga0495648_0001914
679 Ga0495586_0512900
680 Ga0495609_0005232
681 Ga0495645_0930075
682 Ga0495633_0002805
683 Ga0495625_0000105
684 Ga0495635_0363430
685 Ga0495661_0013486
686 Ga0495623_0500309
687 Ga0495671_0096463
688 Ga0495649_0000011
689 Ga0495649_0457247
690 Ga0495660_0036810
691 Ga0495660_0110152
692 Ga0495604_0866288
693 Ga0495683_0070377
694 Ga0495683_0142663
695 Ga0495687_005139
696 Ga0495673_0104808
697 Ga0495686_0271201
698 Ga0495686_0482355
699 Ga0496104_0706740
700 Ga0496104_1661811
701 Ga0496115_0506934
702 Ga0496115_0532752
703 Ga0496115_0564604
704 Ga0496120_0328233
705 Ga0501038_1190600
706 Ga0501072_1169481
707 Ga0501249_002692
708 Ga0501080_0019659
709 Ga0501080_0144392
710 Ga0501266_000016
711 Ga0495619_0118540
712 Ga0495619_0407478
713 Ga0500646_0001073
714 Ga0500646_0011392
715 Ga0500646_0075945
716 Ga0500583_0001438
717 Ga0500641_0000013
718 Ga0500594_0059325
719 Ga0500618_018512
720 Ga0500628_044649
721 Ga0500642_0120876
722 Ga0500568_0018087
723 Ga0500588_0413822
724 Ga0500616_0004907
725 Ga0500622_0000686
726 Ga0500622_0099901
727 Ga0500636_0465122
728 Ga0500637_0350081
729 Ga0500645_094589
730 Ga0466962_0090466

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12840

HTH_20

Helix-turn-helix domain

48

98

0.96

PF01022

HTH_5

Bacterial regulatory protein, arsR family

50

96

0.91

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

51

96

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p4w-assembly1.cif.gz_A crystal structure of heat shock regulator from pyrococcus furiosus 0.9064 15 84
6j0e-assembly1.cif.gz_A structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.8957 9 95
3irq-assembly1.cif.gz_D crystal structure of a z-z junction 0.8887 24 83
3f6v-assembly1.cif.gz_A-2 crystal structure of possible transcriptional regulator for arsenical resistance 0.8856 20 101
5zup-assembly1.cif.gz_A crystal structure of bz junction in diverse sequence 0.8813 45 83
ID Description Score Start End Superfamily
af_O53478_1_106_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9089 16 99 1.10.10.10
af_O53773_1_99_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.907 20 99 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9032 25 82 1.10.10.10
af_I6Y1A7_25_116_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9032 10 96 1.10.10.10
2p4wB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8999 15 84 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7T9D5Z1-F1-model_v4 deleted 0.9622 1 105
AF-A0A2M8HID5-F1-model_v4 Transcriptional regulator 0.9608 1 98 GO:0003700
AF-A0A2T3LEI4-F1-model_v4 Transcriptional regulator 0.9574 12 96 GO:0003700
AF-A0A316U001-F1-model_v4 Transcriptional regulator 0.9548 10 98 GO:0003700
AF-A0A437PPG9-F1-model_v4 ArsR family transcriptional regulator 0.9548 9 99 GO:0003700
GO:0005737

Map