F423957

General Info

Members Datasets Scaffolds Average Seq Length
366 190 732 206

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100411150|Ga0068856_1004111503
Length 204
Sequence MGLTAEQINAGLDVIAAREPAIARALSLAGYPPPRVRARGYITLLRTIVGQQVSVAAANSVWNKLETALGEITPEAVLAADFDTLRACGLSRQKQGYARSLSELVTSGEVMLEHLPEDDEEAIAQLTRIKGIGRWSAEIYLLFAEGRPDIFPAGDLAVQAGMGRILGLAERPSEKAIREVAEPWRPHRGAVTLLTWHCYNTAAL

Samples

Sample ID Description Type Environment
1 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
107 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
108 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
118 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
124 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
125 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
126 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
127 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
128 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
131 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
132 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
133 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
134 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
135 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
136 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
137 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
138 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
139 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
140 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
141 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
142 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
143 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
144 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
145 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
146 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
147 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
148 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
149 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
150 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
153 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
154 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
155 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
156 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
164 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
168 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
169 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
170 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
171 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
172 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
173 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
174 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
177 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
178 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
179 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
180 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
181 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
182 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
183 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
184 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
185 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
186 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
187 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
188 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
189 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
190 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.09
Metatranscriptomes 0
Isolates 1.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.11
Nodule 0
Rhizoplane 0.82
Rhizosphere 87.16
Stem 0
Stem Tuber 0.27
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068856_100411150 3300005614 Bacteria 1373
2 SwRhRL2b_contig_3634486 2162886007 Bacteria 25034
3 JGI24033J26618_1005801 3300002155 Bacteria 1372
4 Ga0055536_1012486 3300003781 Bacteria 3148
5 Ga0055536_1035442 3300003781 Bacteria 1248
6 Ga0055530_10005876 3300003791 Bacteria 5670
7 Ga0055531_10007926 3300003794 Bacteria 5697
8 Ga0055531_10008542 3300003794 Bacteria 5377
9 Ga0065704_10070176 3300005289 Bacteria 138803
10 Ga0065712_10161903 3300005290 Bacteria 1280
11 Ga0065715_10003368 3300005293 Bacteria 5532
12 Ga0070658_10007991 3300005327 Bacteria 8509
13 Ga0070676_10001015 3300005328 Bacteria 13927
14 Ga0070670_100001290 3300005331 Bacteria 19979
15 Ga0070670_100009958 3300005331 Bacteria 8113
16 Ga0070670_100488648 3300005331 Bacteria 1094
17 Ga0070677_10004500 3300005333 Bacteria 4556
18 Ga0070666_10124304 3300005335 Bacteria 1790
19 Ga0070680_100346532 3300005336 Bacteria 1263
20 Ga0070682_100178876 3300005337 Bacteria 1480
21 Ga0070689_100159213 3300005340 Bacteria 1824
22 Ga0070661_100148175 3300005344 Bacteria 1773
23 Ga0070668_100028004 3300005347 Bacteria 4277
24 Ga0070668_100238328 3300005347 Bacteria 1506
25 Ga0070669_100015209 3300005353 Bacteria 5480
26 Ga0070669_100017295 3300005353 Bacteria 5143
27 Ga0070669_100941745 3300005353 Bacteria 739
28 Ga0070671_100002289 3300005355 Bacteria 14780
29 Ga0070671_100013854 3300005355 Bacteria 6505
30 Ga0070671_100037249 3300005355 Bacteria 4033
31 Ga0070674_100014313 3300005356 Bacteria 4931
32 Ga0070674_100018281 3300005356 Bacteria 4428
33 Ga0070674_100060786 3300005356 Bacteria 2635
34 Ga0070673_100004100 3300005364 Bacteria 9176
35 Ga0070659_100073017 3300005366 Bacteria 2731
36 Ga0070659_100153589 3300005366 Bacteria 1879
37 Ga0070667_100012450 3300005367 Bacteria 7037
38 Ga0070667_101210747 3300005367 Bacteria 707
39 Ga0070714_100123332 3300005435 Bacteria 2307
40 Ga0070663_100021228 3300005455 Bacteria 4315
41 Ga0070663_100039247 3300005455 Bacteria 3308
42 Ga0070678_100015300 3300005456 Bacteria 4872
43 Ga0070662_100002657 3300005457 Bacteria 11026
44 Ga0070662_100012125 3300005457 Bacteria 5706
45 Ga0070681_10138566 3300005458 Bacteria 2363
46 Ga0068867_100017416 3300005459 Bacteria 5104
47 Ga0070679_100240050 3300005530 Bacteria 1770
48 Ga0070672_100018503 3300005543 Bacteria 5038
49 Ga0070672_100223050 3300005543 Bacteria 1581
50 Ga0070695_100065956 3300005545 Bacteria 2359
51 Ga0070664_100188001 3300005564 Bacteria 1839
52 Ga0068854_100006061 3300005578 Bacteria 7667
53 Ga0068854_100114353 3300005578 Bacteria 2040
54 Ga0068852_100455142 3300005616 Bacteria 1268
55 Ga0068859_100044147 3300005617 Bacteria 4479
56 Ga0068859_100189373 3300005617 Bacteria 2142
57 Ga0068864_100062663 3300005618 Bacteria 3222
58 Ga0068863_100016476 3300005841 Bacteria 7090
59 Ga0068858_100078607 3300005842 Bacteria 3065
60 Ga0068860_100119683 3300005843 Bacteria 2521
61 Ga0068860_100219471 3300005843 Bacteria 1846
62 Ga0068862_100013226 3300005844 Bacteria 6825
63 Ga0068862_100023489 3300005844 Bacteria 5167
64 Ga0068862_100455120 3300005844 Bacteria 1207
65 Ga0075368_10004233 3300006042 Bacteria 4845
66 Ga0075363_100024303 3300006048 Bacteria 3079
67 Ga0075364_10253386 3300006051 Bacteria 1196
68 Ga0075432_10001883 3300006058 Bacteria 6952
69 Ga0075362_10001164 3300006177 Bacteria 8227
70 Ga0075367_10001794 3300006178 Bacteria 9449
71 Ga0075369_10020819 3300006186 Bacteria 2688
72 Ga0075366_10181826 3300006195 Bacteria 1277
73 Ga0075370_10095838 3300006353 Bacteria 1714
74 Ga0075431_100012663 3300006847 Bacteria 8519
75 Ga0097620_100044149 3300006931 Bacteria 4479
76 Ga0097620_100189351 3300006931 Bacteria 2142
77 Ga0111539_10699742 3300009094 Bacteria 1180
78 Ga0105243_10139246 3300009148 Bacteria 2068
79 Ga0105241_10043202 3300009174 Bacteria 3413
80 Ga0105242_10272843 3300009176 Bacteria 1533
81 Ga0105248_10016423 3300009177 Bacteria 8147
82 Ga0105249_10013707 3300009553 Bacteria 7159
83 Ga0105249_10015106 3300009553 Bacteria 6831
84 Ga0105246_10021827 3300011119 Bacteria 4125
85 Ga0157371_10413660 3300013102 Bacteria 988
86 Ga0157378_11290063 3300013297 Bacteria 771
87 Ga0157375_10675630 3300013308 Bacteria 1188
88 Ga0157380_10007408 3300014326 Bacteria 7791
89 Ga0157380_10044825 3300014326 Bacteria 3468
90 Ga0157380_10334581 3300014326 Bacteria 1409
91 Ga0163161_10006677 3300017792 Bacteria 7985
92 Ga0209675_1000126 3300025291 Bacteria 104792
93 Ga0209676_1000060 3300025292 Bacteria 338238
94 Ga0209676_1000148 3300025292 Bacteria 172161
95 Ga0209025_1006023 3300025294 Bacteria 9612
96 Ga0209050_1000047 3300025298 Bacteria 380561
97 Ga0209050_1008397 3300025298 Bacteria 5531
98 Ga0209050_1014877 3300025298 Bacteria 3313
99 Ga0209257_1005238 3300025304 Bacteria 9274
100 Ga0209257_1006164 3300025304 Bacteria 7910
101 Ga0207697_10003320 3300025315 Bacteria 8009
102 Ga0207682_10002133 3300025893 Bacteria 8972
103 Ga0207680_10301116 3300025903 Bacteria 1118
104 Ga0207645_10002195 3300025907 Bacteria 15584
105 Ga0207645_10027578 3300025907 Bacteria 3667
106 Ga0207707_10034762 3300025912 Bacteria 4409
107 Ga0207657_10575175 3300025919 Bacteria 880
108 Ga0207652_10056943 3300025921 Bacteria 3366
109 Ga0207652_10275055 3300025921 Bacteria 1519
110 Ga0207681_10052686 3300025923 Bacteria 2760
111 Ga0207681_10481787 3300025923 Bacteria 1013
112 Ga0207681_10625715 3300025923 Bacteria 891
113 Ga0207650_10013803 3300025925 Bacteria 5601
114 Ga0207659_10000660 3300025926 Bacteria 20395
115 Ga0207659_10530343 3300025926 Bacteria 999
116 Ga0207644_10004854 3300025931 Bacteria 8752
117 Ga0207644_10015544 3300025931 Bacteria 5112
118 Ga0207690_10213043 3300025932 Bacteria 1474
119 Ga0207706_10006280 3300025933 Bacteria 11042
120 Ga0207706_10010084 3300025933 Bacteria 8653
121 Ga0207706_10675577 3300025933 Bacteria 883
122 Ga0207709_10120541 3300025935 Bacteria 1770
123 Ga0207670_10060765 3300025936 Bacteria 2576
124 Ga0207670_10435228 3300025936 Bacteria 1055
125 Ga0207669_10091271 3300025937 Bacteria 1984
126 Ga0207691_10019054 3300025940 Bacteria 6498
127 Ga0207691_10064907 3300025940 Bacteria 3306
128 Ga0207691_10545715 3300025940 Bacteria 983
129 Ga0207689_10025472 3300025942 Bacteria 4957
130 Ga0207661_10195378 3300025944 Bacteria 1776
131 Ga0207651_10023590 3300025960 Bacteria 3789
132 Ga0207668_10015916 3300025972 Bacteria 4682
133 Ga0207668_10024980 3300025972 Bacteria 3862
134 Ga0207668_10150033 3300025972 Bacteria 1803
135 Ga0207668_10270091 3300025972 Bacteria 1390
136 Ga0207640_10027521 3300025981 Bacteria 3465
137 Ga0207640_10082064 3300025981 Bacteria 2206
138 Ga0207640_10151290 3300025981 Bacteria 1705
139 Ga0207678_10017396 3300026067 Bacteria 6312
140 Ga0207678_10029358 3300026067 Bacteria 4799
141 Ga0207678_10050957 3300026067 Bacteria 3575
142 Ga0207648_10042523 3300026089 Bacteria 3988
143 Ga0207676_10043027 3300026095 Bacteria 3475
144 Ga0207674_10047499 3300026116 Bacteria 4399
145 Ga0207675_100017757 3300026118 Bacteria 6636
146 Ga0207683_10005512 3300026121 Bacteria 10848
147 Ga0207698_10402379 3300026142 Bacteria 1309
148 Ga0209983_1027859 3300027665 Bacteria 1197
149 Ga0209813_10000330 3300027866 Bacteria 12446
150 Ga0268265_10006294 3300028380 Bacteria 8040
151 Ga0268265_10165245 3300028380 Bacteria 1885
152 Ga0268264_10100870 3300028381 Bacteria 2508
153 Ga0268264_10103647 3300028381 Bacteria 2478
154 Ga0268264_10694490 3300028381 Bacteria 1010
155 Ga0307408_100030175 3300031548 Bacteria 3763
156 Ga0307408_100210696 3300031548 Bacteria 1579
157 Ga0307408_100313094 3300031548 Bacteria 1320
158 Ga0307408_100808375 3300031548 Bacteria 851
159 Ga0307405_10008034 3300031731 Bacteria 5320
160 Ga0307405_10012974 3300031731 Bacteria 4432
161 Ga0307405_10075045 3300031731 Bacteria 2189
162 Ga0307405_10085056 3300031731 Bacteria 2078
163 Ga0307405_10102298 3300031731 Bacteria 1924
164 Ga0307405_10116314 3300031731 Bacteria 1821
165 Ga0307405_10142586 3300031731 Bacteria 1673
166 Ga0307405_10599709 3300031731 Bacteria 898
167 Ga0307413_10010495 3300031824 Bacteria 4498
168 Ga0307413_10014206 3300031824 Bacteria 4034
169 Ga0307413_10146976 3300031824 Bacteria 1637
170 Ga0307413_10358996 3300031824 Bacteria 1127
171 Ga0307413_10386767 3300031824 Bacteria 1092
172 Ga0307413_10482449 3300031824 Bacteria 991
173 Ga0307413_10719509 3300031824 Bacteria 831
174 Ga0307410_10034244 3300031852 Bacteria 3287
175 Ga0307410_10050626 3300031852 Bacteria 2794
176 Ga0307410_10065471 3300031852 Bacteria 2500
177 Ga0307410_10109718 3300031852 Bacteria 1994
178 Ga0307410_10137034 3300031852 Bacteria 1805
179 Ga0307410_10259106 3300031852 Bacteria 1355
180 Ga0307410_10344391 3300031852 Bacteria 1189
181 Ga0307410_10735202 3300031852 Bacteria 834
182 Ga0307406_10035278 3300031901 Bacteria 3075
183 Ga0307406_10070664 3300031901 Bacteria 2286
184 Ga0307406_10146969 3300031901 Bacteria 1676
185 Ga0307406_10179918 3300031901 Bacteria 1538
186 Ga0307406_10181387 3300031901 Bacteria 1533
187 Ga0307407_10015031 3300031903 Bacteria 3810
188 Ga0307407_10062444 3300031903 Bacteria 2181
189 Ga0307407_10068151 3300031903 Bacteria 2106
190 Ga0307407_10084812 3300031903 Bacteria 1926
191 Ga0307407_10132194 3300031903 Bacteria 1598
192 Ga0307407_10140501 3300031903 Bacteria 1557
193 Ga0307407_10457949 3300031903 Bacteria 927
194 Ga0307407_10519923 3300031903 Bacteria 875
195 Ga0307412_10044005 3300031911 Bacteria 2911
196 Ga0307412_10110541 3300031911 Bacteria 1961
197 Ga0307412_10118745 3300031911 Bacteria 1900
198 Ga0307412_10123197 3300031911 Bacteria 1870
199 Ga0307412_10146392 3300031911 Bacteria 1737
200 Ga0307412_10148598 3300031911 Bacteria 1726
201 Ga0307412_10238513 3300031911 Bacteria 1405
202 Ga0307412_10329247 3300031911 Bacteria 1218
203 Ga0307412_10339244 3300031911 Bacteria 1202
204 Ga0307412_10342365 3300031911 Bacteria 1197
205 Ga0307409_100013350 3300031995 Bacteria 5282
206 Ga0307409_100028852 3300031995 Bacteria 3961
207 Ga0307409_100037285 3300031995 Bacteria 3583
208 Ga0307409_100103523 3300031995 Bacteria 2368
209 Ga0307409_100176109 3300031995 Bacteria 1888
210 Ga0307409_100589676 3300031995 Bacteria 1097
211 Ga0307409_100659528 3300031995 Bacteria 1041
212 Ga0307409_100748896 3300031995 Bacteria 980
213 Ga0307409_101029238 3300031995 Bacteria 842
214 Ga0307416_100000337 3300032002 Bacteria 24339
215 Ga0307416_100032798 3300032002 Bacteria 3930
216 Ga0307416_100262578 3300032002 Bacteria 1689
217 Ga0307416_100289407 3300032002 Bacteria 1621
218 Ga0307416_100488787 3300032002 Bacteria 1292
219 Ga0307416_100641972 3300032002 Bacteria 1145
220 Ga0307416_100656040 3300032002 Bacteria 1134
221 Ga0307416_100717029 3300032002 Bacteria 1090
222 Ga0307416_100723005 3300032002 Bacteria 1086
223 Ga0307416_100822709 3300032002 Bacteria 1025
224 Ga0307416_100879250 3300032002 Bacteria 995
225 Ga0307416_101799192 3300032002 Bacteria 716
226 Ga0307414_10008399 3300032004 Bacteria 5854
227 Ga0307414_10020774 3300032004 Bacteria 4101
228 Ga0307414_10022464 3300032004 Bacteria 3979
229 Ga0307414_10023337 3300032004 Bacteria 3922
230 Ga0307414_10051414 3300032004 Bacteria 2861
231 Ga0307414_10059601 3300032004 Bacteria 2696
232 Ga0307414_10061541 3300032004 Bacteria 2659
233 Ga0307414_10087113 3300032004 Bacteria 2306
234 Ga0307414_10107446 3300032004 Bacteria 2114
235 Ga0307414_10179245 3300032004 Bacteria 1702
236 Ga0307414_10180463 3300032004 Bacteria 1697
237 Ga0307414_10246351 3300032004 Bacteria 1482
238 Ga0307414_10533127 3300032004 Bacteria 1044
239 Ga0307414_10882230 3300032004 Bacteria 819
240 Ga0307411_10029388 3300032005 Bacteria 3355
241 Ga0307411_10073056 3300032005 Bacteria 2331
242 Ga0307411_10080535 3300032005 Bacteria 2239
243 Ga0307411_10095718 3300032005 Bacteria 2085
244 Ga0307411_10137217 3300032005 Bacteria 1798
245 Ga0307411_10263466 3300032005 Bacteria 1362
246 Ga0307411_10288110 3300032005 Bacteria 1311
247 Ga0307415_100048339 3300032126 Bacteria 2870
248 Ga0307415_100082752 3300032126 Bacteria 2297
249 Ga0307415_100158289 3300032126 Bacteria 1752
250 Ga0307415_100165840 3300032126 Bacteria 1717
251 Ga0307415_100176094 3300032126 Bacteria 1673
252 Ga0307415_100241462 3300032126 Bacteria 1461
253 Ga0307415_100329175 3300032126 Bacteria 1277
254 Ga0307415_100427595 3300032126 Bacteria 1138
255 Ga0307415_100513022 3300032126 Bacteria 1050
256 Ga0307415_100517450 3300032126 Bacteria 1046
257 Ga0307415_100582545 3300032126 Bacteria 993
258 Ga0307415_100780287 3300032126 Bacteria 870
259 Ga0307415_100810194 3300032126 Bacteria 856
260 Ga0395899_0011901 3300037312 Bacteria 6662
261 Ga0395899_0033927 3300037312 Bacteria 3832
262 Ga0395900_0001169 3300037418 Bacteria 32753
263 Ga0395900_0035553 3300037418 Bacteria 5131
264 Ga0395900_0089282 3300037418 Bacteria 3168
265 Ga0395900_0155944 3300037418 Bacteria 2332
266 Ga0395898_0071186 3300037466 Bacteria 3360
267 Ga0395898_0147998 3300037466 Bacteria 2247
268 Ga0395905_0000818 3300037471 Bacteria 40874
269 Ga0395905_0002628 3300037471 Bacteria 19724
270 Ga0395905_0192401 3300037471 Bacteria 1913
271 Ga0395905_0551634 3300037471 Bacteria 1054
272 Ga0395905_0671599 3300037471 Bacteria 938
273 Ga0395901_0002349 3300038443 Bacteria 19233
274 Ga0395901_0033788 3300038443 Bacteria 5281
275 Ga0395901_0037352 3300038443 Bacteria 5023
276 Ga0395901_0113667 3300038443 Bacteria 2843
277 Ga0395901_0129106 3300038443 Bacteria 2657
278 Ga0436365_1315168 3300039437 Bacteria 940
279 Ga0439445_0005947 3300042004 Bacteria 2795
280 Ga0439462_0000170 3300042015 Bacteria 10898
281 Ga0451577_0268277 3300042876 Bacteria 1546
282 Ga0466969_0059563 3300044656 Bacteria 1857
283 Ga0453684_0115264 3300044712 Bacteria 3256
284 Ga0466970_0076298 3300044765 Bacteria 1806
285 Ga0466957_0151725 3300044842 Bacteria 1499
286 Ga0466967_0866353 3300045976 Bacteria 898
287 Ga0495638_0012558 3300046460 Bacteria 5798
288 Ga0495596_0054551 3300046500 Bacteria 1563
289 Ga0495583_0000248 3300046506 Bacteria 89173
290 Ga0495583_0004867 3300046506 Bacteria 9380
291 Ga0495643_0059771 3300046522 Bacteria 2025
292 Ga0495663_0002307 3300046525 Bacteria 5768
293 Ga0495663_0031795 3300046525 Bacteria 1569
294 Ga0495642_0006249 3300046528 Bacteria 4571
295 Ga0495598_0016247 3300046537 Bacteria 1896
296 Ga0495621_0000162 3300046539 Bacteria 14957
297 Ga0495621_0006043 3300046539 Bacteria 3515
298 Ga0495621_0025677 3300046539 Bacteria 1981
299 Ga0495668_0000024 3300046616 Bacteria 359469
300 Ga0495668_0013175 3300046616 Bacteria 4889
301 Ga0495611_0145838 3300046648 Bacteria 1105
302 Ga0495625_0009967 3300046660 Bacteria 7903
303 Ga0495625_0018105 3300046660 Bacteria 5507
304 Ga0495625_0292191 3300046660 Bacteria 1045
305 Ga0495625_0365959 3300046660 Bacteria 908
306 Ga0495625_0406142 3300046660 Bacteria 850
307 Ga0495659_0005610 3300046664 Bacteria 3952
308 Ga0495659_0109862 3300046664 Bacteria 1076
309 Ga0495661_0036795 3300046665 Bacteria 3061
310 Ga0495669_0008652 3300046684 Bacteria 4283
311 Ga0495669_0163507 3300046684 Bacteria 1057
312 Ga0495670_0013454 3300046691 Bacteria 4025
313 Ga0495670_0015655 3300046691 Bacteria 3727
314 Ga0495670_0038953 3300046691 Bacteria 2370
315 Ga0495670_0046715 3300046691 Bacteria 2163
316 Ga0495670_0131577 3300046691 Bacteria 1304
317 Ga0495671_0011227 3300046692 Bacteria 4940
318 Ga0495677_0009974 3300047445 Bacteria 3495
319 Ga0495686_0000986 3300047472 Bacteria 34762
320 Ga0495615_0002923 3300048090 Bacteria 2806
321 Ga0496101_0740210 3300048904 Bacteria 776
322 Ga0496102_0170144 3300048905 Bacteria 2051
323 Ga0496103_0169920 3300048906 Bacteria 1400
324 Ga0496125_0207012 3300048928 Bacteria 1278
325 Ga0496126_0508850 3300048929 Bacteria 961
326 Ga0495682_0070177 3300049460 Bacteria 1261
327 Ga0495682_0138415 3300049460 Bacteria 870
328 Ga0501031_0289261 3300049568 Bacteria 1063
329 Ga0501033_0058789 3300049570 Bacteria 2839
330 Ga0501038_0082142 3300049574 Bacteria 2713
331 Ga0501039_0014310 3300049575 Bacteria 6075
332 Ga0501043_0022505 3300049579 Bacteria 4941
333 Ga0501047_0131027 3300049581 Bacteria 2388
334 Ga0501047_0281176 3300049581 Bacteria 1509
335 Ga0501047_0315486 3300049581 Bacteria 1404
336 Ga0501048_0312378 3300049582 Bacteria 1119
337 Ga0501068_0268368 3300049584 Bacteria 1089
338 Ga0501224_019023 3300049664 Bacteria 1023
339 Ga0501035_0070196 3300049822 Bacteria 3103
340 Ga0501044_0003561 3300049823 Bacteria 17529
341 Ga0501044_0415910 3300049823 Bacteria 1255
342 Ga0501045_0083884 3300049824 Bacteria 2351
343 nmdc:mga03683_567_c1 3300050489 Bacteria 10622
344 nmdc:mga03n38_68377_c1 3300050490 Bacteria 1638
345 nmdc:mga0k408_55974_c1 3300050493 Bacteria 2288
346 nmdc:mga06z11_107_c1 3300050494 Bacteria 34558
347 nmdc:mga04h51_127_c1 3300050495 Bacteria 22206
348 nmdc:mga07m45_90_c1 3300050496 Bacteria 34935
349 nmdc:mga06r32_5150_c1 3300050510 Bacteria 11753
350 nmdc:mga08y16_573471_c1 3300050511 Bacteria 1140
351 nmdc:mga08y16_603301_c1 3300050511 Bacteria 1106
352 nmdc:mga0sz30_960_c1 3300050516 Bacteria 10339
353 Ga0500555_000466 3300053103 Bacteria 16783
354 Ga0500592_002611 3300053116 Bacteria 2894
355 Ga0500594_0004500 3300053118 Bacteria 3073
356 Ga0500658_0118904 3300053134 Bacteria 1170
357 Ga0500568_0055417 3300053139 Bacteria 1547
358 Ga0500604_0014245 3300053151 Bacteria 2164
359 Ga0500627_0000068 3300053158 Bacteria 44198
360 2643822476 2643221560 Bacteria 4801179
361 2643833508 2643221563 Bacteria 4726935
362 2644054435 2643221608 Bacteria 4724829
363 2852656782 2852653556 Bacteria 4050083
364 2852682017 2852680915 Bacteria 4100189
365 2885427413 2885427238 Bacteria 2291351
366 8054304982 8054302542 Bacteria 5698134
367 Ga0068856_100411150
368 SwRhRL2b_contig_3634486
369 JGI24033J26618_1005801
370 Ga0055536_1012486
371 Ga0055536_1035442
372 Ga0055530_10005876
373 Ga0055531_10007926
374 Ga0055531_10008542
375 Ga0065704_10070176
376 Ga0065712_10161903
377 Ga0065715_10003368
378 Ga0070658_10007991
379 Ga0070676_10001015
380 Ga0070670_100001290
381 Ga0070670_100009958
382 Ga0070670_100488648
383 Ga0070677_10004500
384 Ga0070666_10124304
385 Ga0070680_100346532
386 Ga0070682_100178876
387 Ga0070689_100159213
388 Ga0070661_100148175
389 Ga0070668_100028004
390 Ga0070668_100238328
391 Ga0070669_100015209
392 Ga0070669_100017295
393 Ga0070669_100941745
394 Ga0070671_100002289
395 Ga0070671_100013854
396 Ga0070671_100037249
397 Ga0070674_100014313
398 Ga0070674_100018281
399 Ga0070674_100060786
400 Ga0070673_100004100
401 Ga0070659_100073017
402 Ga0070659_100153589
403 Ga0070667_100012450
404 Ga0070667_101210747
405 Ga0070714_100123332
406 Ga0070663_100021228
407 Ga0070663_100039247
408 Ga0070678_100015300
409 Ga0070662_100002657
410 Ga0070662_100012125
411 Ga0070681_10138566
412 Ga0068867_100017416
413 Ga0070679_100240050
414 Ga0070672_100018503
415 Ga0070672_100223050
416 Ga0070695_100065956
417 Ga0070664_100188001
418 Ga0068854_100006061
419 Ga0068854_100114353
420 Ga0068852_100455142
421 Ga0068859_100044147
422 Ga0068859_100189373
423 Ga0068864_100062663
424 Ga0068863_100016476
425 Ga0068858_100078607
426 Ga0068860_100119683
427 Ga0068860_100219471
428 Ga0068862_100013226
429 Ga0068862_100023489
430 Ga0068862_100455120
431 Ga0075368_10004233
432 Ga0075363_100024303
433 Ga0075364_10253386
434 Ga0075432_10001883
435 Ga0075362_10001164
436 Ga0075367_10001794
437 Ga0075369_10020819
438 Ga0075366_10181826
439 Ga0075370_10095838
440 Ga0075431_100012663
441 Ga0097620_100044149
442 Ga0097620_100189351
443 Ga0111539_10699742
444 Ga0105243_10139246
445 Ga0105241_10043202
446 Ga0105242_10272843
447 Ga0105248_10016423
448 Ga0105249_10013707
449 Ga0105249_10015106
450 Ga0105246_10021827
451 Ga0157371_10413660
452 Ga0157378_11290063
453 Ga0157375_10675630
454 Ga0157380_10007408
455 Ga0157380_10044825
456 Ga0157380_10334581
457 Ga0163161_10006677
458 Ga0209675_1000126
459 Ga0209676_1000060
460 Ga0209676_1000148
461 Ga0209025_1006023
462 Ga0209050_1000047
463 Ga0209050_1008397
464 Ga0209050_1014877
465 Ga0209257_1005238
466 Ga0209257_1006164
467 Ga0207697_10003320
468 Ga0207682_10002133
469 Ga0207680_10301116
470 Ga0207645_10002195
471 Ga0207645_10027578
472 Ga0207707_10034762
473 Ga0207657_10575175
474 Ga0207652_10056943
475 Ga0207652_10275055
476 Ga0207681_10052686
477 Ga0207681_10481787
478 Ga0207681_10625715
479 Ga0207650_10013803
480 Ga0207659_10000660
481 Ga0207659_10530343
482 Ga0207644_10004854
483 Ga0207644_10015544
484 Ga0207690_10213043
485 Ga0207706_10006280
486 Ga0207706_10010084
487 Ga0207706_10675577
488 Ga0207709_10120541
489 Ga0207670_10060765
490 Ga0207670_10435228
491 Ga0207669_10091271
492 Ga0207691_10019054
493 Ga0207691_10064907
494 Ga0207691_10545715
495 Ga0207689_10025472
496 Ga0207661_10195378
497 Ga0207651_10023590
498 Ga0207668_10015916
499 Ga0207668_10024980
500 Ga0207668_10150033
501 Ga0207668_10270091
502 Ga0207640_10027521
503 Ga0207640_10082064
504 Ga0207640_10151290
505 Ga0207678_10017396
506 Ga0207678_10029358
507 Ga0207678_10050957
508 Ga0207648_10042523
509 Ga0207676_10043027
510 Ga0207674_10047499
511 Ga0207675_100017757
512 Ga0207683_10005512
513 Ga0207698_10402379
514 Ga0209983_1027859
515 Ga0209813_10000330
516 Ga0268265_10006294
517 Ga0268265_10165245
518 Ga0268264_10100870
519 Ga0268264_10103647
520 Ga0268264_10694490
521 Ga0307408_100030175
522 Ga0307408_100210696
523 Ga0307408_100313094
524 Ga0307408_100808375
525 Ga0307405_10008034
526 Ga0307405_10012974
527 Ga0307405_10075045
528 Ga0307405_10085056
529 Ga0307405_10102298
530 Ga0307405_10116314
531 Ga0307405_10142586
532 Ga0307405_10599709
533 Ga0307413_10010495
534 Ga0307413_10014206
535 Ga0307413_10146976
536 Ga0307413_10358996
537 Ga0307413_10386767
538 Ga0307413_10482449
539 Ga0307413_10719509
540 Ga0307410_10034244
541 Ga0307410_10050626
542 Ga0307410_10065471
543 Ga0307410_10109718
544 Ga0307410_10137034
545 Ga0307410_10259106
546 Ga0307410_10344391
547 Ga0307410_10735202
548 Ga0307406_10035278
549 Ga0307406_10070664
550 Ga0307406_10146969
551 Ga0307406_10179918
552 Ga0307406_10181387
553 Ga0307407_10015031
554 Ga0307407_10062444
555 Ga0307407_10068151
556 Ga0307407_10084812
557 Ga0307407_10132194
558 Ga0307407_10140501
559 Ga0307407_10457949
560 Ga0307407_10519923
561 Ga0307412_10044005
562 Ga0307412_10110541
563 Ga0307412_10118745
564 Ga0307412_10123197
565 Ga0307412_10146392
566 Ga0307412_10148598
567 Ga0307412_10238513
568 Ga0307412_10329247
569 Ga0307412_10339244
570 Ga0307412_10342365
571 Ga0307409_100013350
572 Ga0307409_100028852
573 Ga0307409_100037285
574 Ga0307409_100103523
575 Ga0307409_100176109
576 Ga0307409_100589676
577 Ga0307409_100659528
578 Ga0307409_100748896
579 Ga0307409_101029238
580 Ga0307416_100000337
581 Ga0307416_100032798
582 Ga0307416_100262578
583 Ga0307416_100289407
584 Ga0307416_100488787
585 Ga0307416_100641972
586 Ga0307416_100656040
587 Ga0307416_100717029
588 Ga0307416_100723005
589 Ga0307416_100822709
590 Ga0307416_100879250
591 Ga0307416_101799192
592 Ga0307414_10008399
593 Ga0307414_10020774
594 Ga0307414_10022464
595 Ga0307414_10023337
596 Ga0307414_10051414
597 Ga0307414_10059601
598 Ga0307414_10061541
599 Ga0307414_10087113
600 Ga0307414_10107446
601 Ga0307414_10179245
602 Ga0307414_10180463
603 Ga0307414_10246351
604 Ga0307414_10533127
605 Ga0307414_10882230
606 Ga0307411_10029388
607 Ga0307411_10073056
608 Ga0307411_10080535
609 Ga0307411_10095718
610 Ga0307411_10137217
611 Ga0307411_10263466
612 Ga0307411_10288110
613 Ga0307415_100048339
614 Ga0307415_100082752
615 Ga0307415_100158289
616 Ga0307415_100165840
617 Ga0307415_100176094
618 Ga0307415_100241462
619 Ga0307415_100329175
620 Ga0307415_100427595
621 Ga0307415_100513022
622 Ga0307415_100517450
623 Ga0307415_100582545
624 Ga0307415_100780287
625 Ga0307415_100810194
626 Ga0395899_0011901
627 Ga0395899_0033927
628 Ga0395900_0001169
629 Ga0395900_0035553
630 Ga0395900_0089282
631 Ga0395900_0155944
632 Ga0395898_0071186
633 Ga0395898_0147998
634 Ga0395905_0000818
635 Ga0395905_0002628
636 Ga0395905_0192401
637 Ga0395905_0551634
638 Ga0395905_0671599
639 Ga0395901_0002349
640 Ga0395901_0033788
641 Ga0395901_0037352
642 Ga0395901_0113667
643 Ga0395901_0129106
644 Ga0436365_1315168
645 Ga0439445_0005947
646 Ga0439462_0000170
647 Ga0451577_0268277
648 Ga0466969_0059563
649 Ga0453684_0115264
650 Ga0466970_0076298
651 Ga0466957_0151725
652 Ga0466967_0866353
653 Ga0495638_0012558
654 Ga0495596_0054551
655 Ga0495583_0000248
656 Ga0495583_0004867
657 Ga0495643_0059771
658 Ga0495663_0002307
659 Ga0495663_0031795
660 Ga0495642_0006249
661 Ga0495598_0016247
662 Ga0495621_0000162
663 Ga0495621_0006043
664 Ga0495621_0025677
665 Ga0495668_0000024
666 Ga0495668_0013175
667 Ga0495611_0145838
668 Ga0495625_0009967
669 Ga0495625_0018105
670 Ga0495625_0292191
671 Ga0495625_0365959
672 Ga0495625_0406142
673 Ga0495659_0005610
674 Ga0495659_0109862
675 Ga0495661_0036795
676 Ga0495669_0008652
677 Ga0495669_0163507
678 Ga0495670_0013454
679 Ga0495670_0015655
680 Ga0495670_0038953
681 Ga0495670_0046715
682 Ga0495670_0131577
683 Ga0495671_0011227
684 Ga0495677_0009974
685 Ga0495686_0000986
686 Ga0495615_0002923
687 Ga0496101_0740210
688 Ga0496102_0170144
689 Ga0496103_0169920
690 Ga0496125_0207012
691 Ga0496126_0508850
692 Ga0495682_0070177
693 Ga0495682_0138415
694 Ga0501031_0289261
695 Ga0501033_0058789
696 Ga0501038_0082142
697 Ga0501039_0014310
698 Ga0501043_0022505
699 Ga0501047_0131027
700 Ga0501047_0281176
701 Ga0501047_0315486
702 Ga0501048_0312378
703 Ga0501068_0268368
704 Ga0501224_019023
705 Ga0501035_0070196
706 Ga0501044_0003561
707 Ga0501044_0415910
708 Ga0501045_0083884
709 nmdc:mga03683_567_c1
710 nmdc:mga03n38_68377_c1
711 nmdc:mga0k408_55974_c1
712 nmdc:mga06z11_107_c1
713 nmdc:mga04h51_127_c1
714 nmdc:mga07m45_90_c1
715 nmdc:mga06r32_5150_c1
716 nmdc:mga08y16_573471_c1
717 nmdc:mga08y16_603301_c1
718 nmdc:mga0sz30_960_c1
719 Ga0500555_000466
720 Ga0500592_002611
721 Ga0500594_0004500
722 Ga0500658_0118904
723 Ga0500568_0055417
724 Ga0500604_0014245
725 Ga0500627_0000068
726 2643822476
727 2643833508
728 2644054435
729 2852656782
730 2852682017
731 2885427413
732 8054304982

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00730

HhH-GPD

HhH-GPD superfamily base excision DNA repair protein

45

186

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2h56-assembly2.cif.gz_B crystal structure of dna-3-methyladenine glycosidase (10174367) from bacillus halodurans at 2.55 a resolution 0.9297 11 204
2h56-assembly2.cif.gz_B crystal structure of dna-3-methyladenine glycosidase (10174367) from bacillus halodurans at 2.55 a resolution 0.8781 11 204
2yg9-assembly2.cif.gz_B structure of an unusual 3-methyladenine dna glycosylase ii (alka) from deinococcus radiodurans 0.8622 11 198
3s6i-assembly1.cif.gz_A schizosaccaromyces pombe 3-methyladenine dna glycosylase (mag1) in complex with abasic-dna. 0.8307 21 197
4ejz-assembly2.cif.gz_B structure of mbogg1 in complex with low affinity dna ligand 0.8036 9 205
ID Description Score Start End Superfamily
3s6iA01 Mainly Alpha;Orthogonal Bundle;Endonuclease Iii, domain 2; 0.9472 149 197 1.10.1670.40
af_B4FZ58_120_231_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9456 40 144 1.10.340.30
2h56B02 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9158 37 143 1.10.340.30
af_A0A1D8PI96_136_252_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9119 41 144 1.10.340.30
af_P22134_82_201_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.8964 40 142 1.10.340.30
ID Description Score Start End GO Terms
AF-J2ZN98-F1-model_v4 DNA-3-methyladenine glycosylase II (EC 3.2.2.21) 0.9965 1 205 GO:0005737
GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032993
GO:0043916
AF-A0A1Y6E944-F1-model_v4 DNA-3-methyladenine glycosylase II (EC 3.2.2.21) 0.9957 1 201 GO:0005737
GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032993
GO:0043916
AF-A0A2E4CRL8-F1-model_v4 DNA-3-methyladenine glycosylase II (EC 3.2.2.21) 0.994 1 205 GO:0005737
GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032993
GO:0043916
AF-A0A3N2QDX5-F1-model_v4 deleted 0.9935 1 195
AF-A0A5S3P6Z8-F1-model_v4 DNA-3-methyladenine glycosylase II (EC 3.2.2.21) 0.9933 1 205 GO:0005737
GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032993
GO:0043916

Map