F424000

General Info

Members Datasets Scaffolds Average Seq Length
366 181 366 189

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10091117|Ga0105243_100911172
Length 219
Sequence MLARPRISTLETTIDAANAAKGARMGKILENLYLTLAIGLVLAIVIMLLPDAGYNPGPTGELATGVLQWLHVFFGITWIGLLYYFNFVQIPTMPSIPAELKPGVSKYIAPNALFYFRWAAAMTMLIGLLLAWVNGYLVEALTFQPGFQLIGTGMWLGLIMGFNVWGVIWPNQKKALGLVEADDATKAKAARVAMLASRTNTLLSIPMLYAMASFQSLPR

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
73 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
74 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
139 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
140 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
141 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
142 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
143 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
144 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
145 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
146 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
147 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
148 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
149 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
150 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
161 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
162 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
163 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
164 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
165 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
166 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
167 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
168 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
169 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
170 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
171 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
172 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
173 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
174 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
175 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
176 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
177 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
178 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
179 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
180 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
181 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.01
Nodule 0
Rhizoplane 3.28
Rhizosphere 89.89
Stem 0
Stem Tuber 0
Unclassified 3.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000017 3300001904 Bacteria 28475
2 JGI24746J21847_1007014 3300001977 Bacteria 1731
3 JGI24749J21850_1000020 3300002076 Bacteria 31050
4 JGI24749J21850_1003945 3300002076 Bacteria 2067
5 JGI24751J29686_10000177 3300002459 Bacteria 29687
6 JGI24751J29686_10013044 3300002459 Bacteria 1716
7 JGI24751J29686_10019850 3300002459 Bacteria 1391
8 Ga0065712_10518209 3300005290 Bacteria 637
9 Ga0065715_10034224 3300005293 Bacteria 1373
10 Ga0065707_10100721 3300005295 Bacteria 2910
11 Ga0065707_10230567 3300005295 Bacteria 1190
12 Ga0070658_10000001 3300005327 Bacteria 856789
13 Ga0070676_10054542 3300005328 Bacteria 2357
14 Ga0070690_100082644 3300005330 Bacteria 2103
15 Ga0070670_100000008 3300005331 Bacteria 292132
16 Ga0070670_100002664 3300005331 Bacteria 14745
17 Ga0070670_100011203 3300005331 Bacteria 7663
18 Ga0070677_10000559 3300005333 Bacteria 12697
19 Ga0070677_10001594 3300005333 Bacteria 7175
20 Ga0070666_10001162 3300005335 Bacteria 15997
21 Ga0070660_100000362 3300005339 Bacteria 30297
22 Ga0070661_100033121 3300005344 Bacteria 3742
23 Ga0070661_100859825 3300005344 Bacteria 747
24 Ga0070692_10000109 3300005345 Bacteria 18891
25 Ga0070692_10381253 3300005345 Bacteria 885
26 Ga0070668_100051510 3300005347 Bacteria 3172
27 Ga0070668_100084892 3300005347 Bacteria 2488
28 Ga0070668_100142907 3300005347 Bacteria 1930
29 Ga0070668_100455484 3300005347 Bacteria 1101
30 Ga0070669_100000240 3300005353 Bacteria 45481
31 Ga0070669_100043886 3300005353 Bacteria 3257
32 Ga0070669_100106335 3300005353 Bacteria 2124
33 Ga0070669_100132466 3300005353 Bacteria 1914
34 Ga0070669_100386014 3300005353 Bacteria 1143
35 Ga0070675_100005534 3300005354 Bacteria 9669
36 Ga0070675_100040705 3300005354 Bacteria 3795
37 Ga0070671_100031747 3300005355 Bacteria 4366
38 Ga0070671_100035745 3300005355 Bacteria 4116
39 Ga0070671_100066772 3300005355 Bacteria 2998
40 Ga0070671_100719236 3300005355 Bacteria 867
41 Ga0070673_100000428 3300005364 Bacteria 22198
42 Ga0070673_100007906 3300005364 Bacteria 7049
43 Ga0070659_100007247 3300005366 Bacteria 8050
44 Ga0070659_100526543 3300005366 Bacteria 1010
45 Ga0070667_100006507 3300005367 Bacteria 9712
46 Ga0070667_100007799 3300005367 Bacteria 8876
47 Ga0070667_100008815 3300005367 Bacteria 8356
48 Ga0070667_100024780 3300005367 Bacteria 4985
49 Ga0070701_10098188 3300005438 Bacteria 1617
50 Ga0070705_100068209 3300005440 Bacteria 2140
51 Ga0070663_100080728 3300005455 Bacteria 2389
52 Ga0070678_100001331 3300005456 Bacteria 13124
53 Ga0070678_100290808 3300005456 Bacteria 1385
54 Ga0070678_100848790 3300005456 Bacteria 832
55 Ga0070662_100000663 3300005457 Bacteria 20915
56 Ga0070662_100054296 3300005457 Bacteria 2903
57 Ga0068867_100575591 3300005459 Bacteria 979
58 Ga0068853_100002896 3300005539 Bacteria 13028
59 Ga0070672_100010331 3300005543 Bacteria 6472
60 Ga0070672_100121902 3300005543 Bacteria 2135
61 Ga0070665_100071879 3300005548 Bacteria 3467
62 Ga0068855_100068059 3300005563 Bacteria 4147
63 Ga0070664_100071235 3300005564 Bacteria 2978
64 Ga0068857_100081151 3300005577 Bacteria 2896
65 Ga0068857_100087141 3300005577 Bacteria 2792
66 Ga0068856_100243231 3300005614 Bacteria 1814
67 Ga0068852_100028465 3300005616 Bacteria 4574
68 Ga0068859_100007209 3300005617 Bacteria 11280
69 Ga0068859_100013083 3300005617 Bacteria 8338
70 Ga0068859_100096889 3300005617 Bacteria 3002
71 Ga0068859_100233491 3300005617 Bacteria 1928
72 Ga0068859_100242668 3300005617 Bacteria 1891
73 Ga0068864_100000027 3300005618 Bacteria 229759
74 Ga0068864_100000773 3300005618 Bacteria 26846
75 Ga0068864_100025420 3300005618 Bacteria 4986
76 Ga0068864_100128234 3300005618 Bacteria 2276
77 Ga0068864_100542762 3300005618 Bacteria 1123
78 Ga0068864_100547688 3300005618 Bacteria 1118
79 Ga0068866_10720806 3300005718 Bacteria 686
80 Ga0068861_100042697 3300005719 Bacteria 3399
81 Ga0068861_100062401 3300005719 Bacteria 2863
82 Ga0068851_10241896 3300005834 Bacteria 1021
83 Ga0068870_10135302 3300005840 Bacteria 1436
84 Ga0068863_100005259 3300005841 Bacteria 12779
85 Ga0068863_100011484 3300005841 Bacteria 8565
86 Ga0068858_100001877 3300005842 Bacteria 21436
87 Ga0068858_100006666 3300005842 Bacteria 11233
88 Ga0068858_100389940 3300005842 Bacteria 1337
89 Ga0068860_100007912 3300005843 Bacteria 10613
90 Ga0068860_100012480 3300005843 Bacteria 8368
91 Ga0068862_100000014 3300005844 Bacteria 251552
92 Ga0068862_100000143 3300005844 Bacteria 80650
93 Ga0068862_100064938 3300005844 Bacteria 3143
94 Ga0068862_100222252 3300005844 Bacteria 1710
95 Ga0068862_100331441 3300005844 Bacteria 1407
96 Ga0075366_10074941 3300006195 Bacteria 2018
97 Ga0097621_100013435 3300006237 Bacteria 6104
98 Ga0068871_100053270 3300006358 Bacteria 3278
99 Ga0068865_100113827 3300006881 Bacteria 2000
100 Ga0097620_100007208 3300006931 Bacteria 11280
101 Ga0097620_100013082 3300006931 Bacteria 8338
102 Ga0097620_100096892 3300006931 Bacteria 3002
103 Ga0097620_100233493 3300006931 Bacteria 1928
104 Ga0097620_100242660 3300006931 Bacteria 1891
105 Ga0105240_10207214 3300009093 Bacteria 2294
106 Ga0105240_11555056 3300009093 Bacteria 693
107 Ga0105247_10001608 3300009101 Bacteria 15987
108 Ga0105243_10091117 3300009148 Bacteria 2510
109 Ga0105242_10791674 3300009176 Bacteria 938
110 Ga0105248_10000156 3300009177 Bacteria 79110
111 Ga0105248_10004603 3300009177 Bacteria 15267
112 Ga0105248_10007268 3300009177 Bacteria 12152
113 Ga0105248_10070066 3300009177 Bacteria 3938
114 Ga0105248_10812550 3300009177 Bacteria 1055
115 Ga0105237_10113130 3300009545 Bacteria 2706
116 Ga0105238_10254491 3300009551 Bacteria 1735
117 Ga0105249_10000002 3300009553 Bacteria 376207
118 Ga0105249_10009121 3300009553 Bacteria 8676
119 Ga0105249_10191647 3300009553 Bacteria 1996
120 Ga0157373_10198853 3300013100 Bacteria 1413
121 Ga0157371_10128265 3300013102 Bacteria 1804
122 Ga0157370_10316070 3300013104 Bacteria 1441
123 Ga0157369_10000412 3300013105 Bacteria 56593
124 Ga0157369_10158145 3300013105 Bacteria 2393
125 Ga0157374_10005548 3300013296 Bacteria 10619
126 Ga0163162_10007095 3300013306 Bacteria 10874
127 Ga0163162_10036415 3300013306 Bacteria 4904
128 Ga0163162_10048710 3300013306 Bacteria 4246
129 Ga0163162_10581957 3300013306 Bacteria 1246
130 Ga0157372_10683143 3300013307 Bacteria 1195
131 Ga0157375_10001588 3300013308 Bacteria 19530
132 Ga0157375_10005314 3300013308 Bacteria 11187
133 Ga0157375_10426749 3300013308 Bacteria 1492
134 Ga0163163_10011326 3300014325 Bacteria 8085
135 Ga0163163_10173343 3300014325 Bacteria 2204
136 Ga0163163_11036801 3300014325 Bacteria 884
137 Ga0157380_10000416 3300014326 Bacteria 25905
138 Ga0157380_10014156 3300014326 Bacteria 5832
139 Ga0157380_10032729 3300014326 Bacteria 4002
140 Ga0157380_10782261 3300014326 Bacteria 969
141 Ga0163161_10025240 3300017792 Bacteria 4205
142 Ga0163161_10337600 3300017792 Bacteria 1195
143 Ga0213873_10000008 3300021358 Bacteria 263363
144 Ga0213876_10000005 3300021384 Bacteria 727326
145 Ga0213876_10000120 3300021384 Bacteria 85450
146 Ga0213876_10020039 3300021384 Bacteria 3533
147 Ga0207697_10004971 3300025315 Bacteria 6266
148 Ga0207656_10214057 3300025321 Bacteria 935
149 Ga0207696_1049740 3300025711 Bacteria 1201
150 Ga0207682_10000576 3300025893 Bacteria 16980
151 Ga0207682_10002227 3300025893 Bacteria 8747
152 Ga0207710_10002422 3300025900 Bacteria 8689
153 Ga0207710_10102477 3300025900 Bacteria 1351
154 Ga0207688_10246200 3300025901 Bacteria 1082
155 Ga0207645_10062165 3300025907 Bacteria 2385
156 Ga0207643_10065468 3300025908 Bacteria 2082
157 Ga0207705_10000002 3300025909 Bacteria 2046852
158 Ga0207671_10244459 3300025914 Bacteria 1410
159 Ga0207657_10000084 3300025919 Bacteria 89401
160 Ga0207657_10026027 3300025919 Bacteria 5384
161 Ga0207681_10000022 3300025923 Bacteria 230079
162 Ga0207681_10001934 3300025923 Bacteria 13274
163 Ga0207681_10072234 3300025923 Bacteria 2409
164 Ga0207681_10356867 3300025923 Bacteria 1171
165 Ga0207650_10000019 3300025925 Bacteria 344751
166 Ga0207650_10000020 3300025925 Bacteria 342596
167 Ga0207650_10007152 3300025925 Bacteria 7607
168 Ga0207650_10019611 3300025925 Bacteria 4754
169 Ga0207650_10097298 3300025925 Bacteria 2259
170 Ga0207659_10001721 3300025926 Bacteria 12974
171 Ga0207644_10060220 3300025931 Bacteria 2747
172 Ga0207644_10093670 3300025931 Bacteria 2243
173 Ga0207690_10003423 3300025932 Bacteria 9469
174 Ga0207690_10667300 3300025932 Bacteria 853
175 Ga0207706_10000187 3300025933 Bacteria 69090
176 Ga0207706_10004830 3300025933 Bacteria 12622
177 Ga0207669_10098652 3300025937 Bacteria 1924
178 Ga0207704_10428205 3300025938 Bacteria 1051
179 Ga0207691_10011199 3300025940 Bacteria 8606
180 Ga0207691_10160669 3300025940 Bacteria 1971
181 Ga0207711_10001615 3300025941 Bacteria 20798
182 Ga0207711_10003462 3300025941 Bacteria 13667
183 Ga0207711_10006884 3300025941 Bacteria 9546
184 Ga0207711_10210724 3300025941 Bacteria 1775
185 Ga0207679_10101212 3300025945 Bacteria 2254
186 Ga0207667_10089869 3300025949 Bacteria 3174
187 Ga0207667_10191589 3300025949 Bacteria 2098
188 Ga0207651_10009088 3300025960 Bacteria 5410
189 Ga0207651_10025291 3300025960 Bacteria 3689
190 Ga0207712_10000002 3300025961 Bacteria 706628
191 Ga0207712_10532788 3300025961 Bacteria 1008
192 Ga0207668_10004109 3300025972 Bacteria 8547
193 Ga0207668_10101875 3300025972 Bacteria 2135
194 Ga0207668_10131855 3300025972 Bacteria 1909
195 Ga0207640_10464037 3300025981 Bacteria 1047
196 Ga0207658_10002545 3300025986 Bacteria 13255
197 Ga0207658_10004415 3300025986 Bacteria 9784
198 Ga0207658_10069373 3300025986 Bacteria 2663
199 Ga0207658_10186760 3300025986 Bacteria 1720
200 Ga0207703_10007646 3300026035 Bacteria 8564
201 Ga0207703_10031128 3300026035 Bacteria 4217
202 Ga0207639_10003166 3300026041 Bacteria 11071
203 Ga0207678_10022045 3300026067 Bacteria 5580
204 Ga0207641_10000659 3300026088 Bacteria 37671
205 Ga0207641_10004570 3300026088 Bacteria 11965
206 Ga0207641_10028171 3300026088 Bacteria 4640
207 Ga0207648_10131645 3300026089 Bacteria 2202
208 Ga0207648_10661010 3300026089 Bacteria 966
209 Ga0207676_10000022 3300026095 Bacteria 296286
210 Ga0207676_10000975 3300026095 Bacteria 22066
211 Ga0207676_10010875 3300026095 Bacteria 6491
212 Ga0207676_10481489 3300026095 Bacteria 1175
213 Ga0207674_10007205 3300026116 Bacteria 12980
214 Ga0207674_10142334 3300026116 Bacteria 2358
215 Ga0207674_10197305 3300026116 Bacteria 1962
216 Ga0207675_100006920 3300026118 Bacteria 10730
217 Ga0207675_100017724 3300026118 Bacteria 6643
218 Ga0207683_10019836 3300026121 Bacteria 5743
219 Ga0207683_10242189 3300026121 Bacteria 1645
220 Ga0207683_10348987 3300026121 Bacteria 1358
221 Ga0207698_10056432 3300026142 Bacteria 3033
222 Ga0209982_1035857 3300027552 Bacteria 786
223 Ga0209983_1004609 3300027665 Bacteria 2892
224 Ga0209974_10002749 3300027876 Bacteria 6378
225 Ga0268266_10123913 3300028379 Bacteria 2303
226 Ga0268265_10000031 3300028380 Bacteria 226725
227 Ga0268265_10000176 3300028380 Bacteria 76619
228 Ga0268265_10034646 3300028380 Bacteria 3682
229 Ga0268265_10046966 3300028380 Bacteria 3231
230 Ga0268265_10124239 3300028380 Bacteria 2132
231 Ga0268264_10000548 3300028381 Bacteria 47198
232 Ga0268264_10007610 3300028381 Bacteria 9032
233 Ga0268264_10544296 3300028381 Bacteria 1138
234 Ga0307513_10016067 3300031456 Bacteria 9045
235 Ga0307513_10269738 3300031456 Bacteria 1486
236 Ga0307408_100012826 3300031548 Bacteria 5558
237 Ga0307408_100183350 3300031548 Bacteria 1680
238 Ga0307408_100226301 3300031548 Bacteria 1529
239 Ga0307408_100564376 3300031548 Bacteria 1006
240 Ga0307405_10049288 3300031731 Bacteria 2602
241 Ga0307405_10056175 3300031731 Bacteria 2468
242 Ga0307405_10246984 3300031731 Bacteria 1325
243 Ga0307405_10422265 3300031731 Bacteria 1050
244 Ga0307405_11157019 3300031731 Bacteria 667
245 Ga0307413_10008193 3300031824 Bacteria 4915
246 Ga0307413_10045237 3300031824 Bacteria 2608
247 Ga0307413_10085082 3300031824 Bacteria 2041
248 Ga0307413_10109699 3300031824 Bacteria 1845
249 Ga0307413_10346005 3300031824 Bacteria 1145
250 Ga0307413_10426672 3300031824 Bacteria 1046
251 Ga0307413_10427126 3300031824 Bacteria 1045
252 Ga0307410_10006176 3300031852 Bacteria 6434
253 Ga0307410_10039243 3300031852 Bacteria 3107
254 Ga0307410_10259039 3300031852 Bacteria 1356
255 Ga0307410_10319245 3300031852 Bacteria 1232
256 Ga0307410_10508093 3300031852 Bacteria 993
257 Ga0307406_10061605 3300031901 Bacteria 2423
258 Ga0307406_10356111 3300031901 Bacteria 1145
259 Ga0307407_10019616 3300031903 Bacteria 3447
260 Ga0307407_10026515 3300031903 Bacteria 3070
261 Ga0307407_10287324 3300031903 Bacteria 1142
262 Ga0307412_10005897 3300031911 Bacteria 6899
263 Ga0307412_10021294 3300031911 Bacteria 3958
264 Ga0307412_10040176 3300031911 Bacteria 3026
265 Ga0307412_10148765 3300031911 Bacteria 1725
266 Ga0307412_10510954 3300031911 Bacteria 1002
267 Ga0307409_100005979 3300031995 Bacteria 7092
268 Ga0307409_100022990 3300031995 Bacteria 4309
269 Ga0307409_100028822 3300031995 Bacteria 3962
270 Ga0307409_100060696 3300031995 Bacteria 2950
271 Ga0307409_100120076 3300031995 Bacteria 2224
272 Ga0307409_100193461 3300031995 Bacteria 1813
273 Ga0307409_100245178 3300031995 Bacteria 1634
274 Ga0307409_100422285 3300031995 Bacteria 1279
275 Ga0307416_100010456 3300032002 Bacteria 6129
276 Ga0307416_100020106 3300032002 Bacteria 4755
277 Ga0307416_100045268 3300032002 Bacteria 3464
278 Ga0307416_100047106 3300032002 Bacteria 3409
279 Ga0307416_100136749 3300032002 Bacteria 2218
280 Ga0307416_100219344 3300032002 Bacteria 1822
281 Ga0307416_100265480 3300032002 Bacteria 1681
282 Ga0307416_100512370 3300032002 Bacteria 1266
283 Ga0307416_100848208 3300032002 Bacteria 1012
284 Ga0307416_101175488 3300032002 Bacteria 872
285 Ga0307414_10010008 3300032004 Bacteria 5477
286 Ga0307414_10012904 3300032004 Bacteria 4959
287 Ga0307414_10467267 3300032004 Bacteria 1110
288 Ga0307414_10672670 3300032004 Bacteria 935
289 Ga0307411_10006291 3300032005 Bacteria 5927
290 Ga0307411_10015969 3300032005 Bacteria 4237
291 Ga0307411_10016001 3300032005 Bacteria 4234
292 Ga0307411_10020032 3300032005 Bacteria 3881
293 Ga0307411_10024467 3300032005 Bacteria 3600
294 Ga0307411_10087285 3300032005 Bacteria 2166
295 Ga0307411_10290037 3300032005 Bacteria 1307
296 Ga0307411_10619979 3300032005 Bacteria 932
297 Ga0307411_10998202 3300032005 Bacteria 749
298 Ga0307411_11000651 3300032005 Bacteria 748
299 Ga0307415_100004398 3300032126 Bacteria 7305
300 Ga0307415_100018828 3300032126 Bacteria 4180
301 Ga0307415_100047202 3300032126 Bacteria 2898
302 Ga0307415_100047481 3300032126 Bacteria 2890
303 Ga0307415_100084281 3300032126 Bacteria 2280
304 Ga0307415_100208577 3300032126 Bacteria 1557
305 Ga0307415_100434101 3300032126 Bacteria 1131
306 Ga0307510_10083889 3300033180 Bacteria 3073
307 Ga0395899_0296532 3300037312 Bacteria 1095
308 Ga0395900_0452757 3300037418 Bacteria 1239
309 Ga0395900_0524162 3300037418 Bacteria 1132
310 Ga0395898_0402879 3300037466 Bacteria 1304
311 Ga0395905_0118198 3300037471 Bacteria 2492
312 Ga0395901_0140619 3300038443 Bacteria 2537
313 Ga0436365_0010969 3300039437 Bacteria 175809
314 Ga0436365_1858586 3300039437 Bacteria 166193
315 Ga0436362_1035670 3300039453 Bacteria 125910
316 Ga0439439_0177145 3300041406 Bacteria 613
317 Ga0439449_0060849 3300042007 Bacteria 1393
318 Ga0439464_0046531 3300042439 Bacteria 1247
319 Ga0451576_0020748 3300045051 Bacteria 7151
320 Ga0495597_0075966 3300046542 Bacteria 1441
321 Ga0495633_0250321 3300046558 Bacteria 808
322 Ga0495668_0125060 3300046616 Bacteria 1407
323 Ga0495668_0257096 3300046616 Bacteria 956
324 Ga0495625_0000332 3300046660 Bacteria 71947
325 Ga0495625_0005843 3300046660 Bacteria 11094
326 Ga0495625_0330813 3300046660 Bacteria 968
327 Ga0495659_0083459 3300046664 Bacteria 1216
328 Ga0495677_0023470 3300047445 Bacteria 2239
329 Ga0495685_074143 3300047447 Bacteria 1138
330 Ga0496100_0011427 3300048903 Bacteria 5053
331 Ga0496101_0018098 3300048904 Bacteria 4784
332 Ga0496101_0564616 3300048904 Bacteria 900
333 Ga0496102_0000036 3300048905 Bacteria 201896
334 Ga0496103_0000120 3300048906 Bacteria 85481
335 Ga0496107_0026565 3300048910 Bacteria 4105
336 Ga0496108_0003313 3300048911 Bacteria 12943
337 Ga0496110_0035000 3300048913 Bacteria 4354
338 Ga0496112_0256355 3300048915 Bacteria 1699
339 Ga0496114_0017208 3300048917 Bacteria 5831
340 Ga0496114_0025387 3300048917 Bacteria 4842
341 Ga0496115_0036347 3300048918 Bacteria 3899
342 Ga0496116_0002277 3300048919 Bacteria 20365
343 Ga0496117_0000093 3300048920 Bacteria 201862
344 Ga0496118_0000070 3300048921 Bacteria 201866
345 Ga0496119_0075454 3300048922 Bacteria 1960
346 Ga0496124_0000302 3300048927 Bacteria 91124
347 Ga0496125_0134938 3300048928 Bacteria 1728
348 Ga0501202_052270 3300049652 Bacteria 907
349 Ga0501217_024251 3300049661 Bacteria 1450
350 Ga0501233_021304 3300049668 Bacteria 1390
351 Ga0501249_010157 3300049679 Bacteria 1965
352 Ga0501249_023216 3300049679 Bacteria 1361
353 Ga0501263_012155 3300049760 Bacteria 1077
354 Ga0501268_019677 3300049765 Bacteria 1145
355 Ga0501270_025924 3300049767 Bacteria 932
356 Ga0501273_026821 3300049770 Bacteria 805
357 nmdc:mga0k408_67326_c2 3300050493 Bacteria 1788
358 Ga0500643_002412 3300053087 Bacteria 9688
359 Ga0500643_013234 3300053087 Bacteria 2921
360 Ga0500583_0208456 3300053092 Bacteria 971
361 Ga0500562_058796 3300053108 Bacteria 1032
362 Ga0500592_011628 3300053116 Bacteria 1408
363 Ga0500597_044887 3300053120 Bacteria 1868
364 Ga0500624_000257 3300053157 Bacteria 18682
365 Ga0500637_0000023 3300053178 Bacteria 61044
366 Ga0500637_0004105 3300053178 Bacteria 6851

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006195 Ga0075366_10074941 Ga0075366_100749412 163
2 3300050493 nmdc:mga0k408_67326_c2 nmdc:mga0k408_67326_c2_274_873 163
3 3300053087 Ga0500643_002412 Ga0500643_002412_6388_6954 163
4 3300046616 Ga0495668_0125060 Ga0495668_0125060_110_670 165
5 3300046660 Ga0495625_0005843 Ga0495625_0005843_5117_5677 165
6 3300047445 Ga0495677_0023470 Ga0495677_0023470_55_615 165
7 3300053178 Ga0500637_0004105 Ga0500637_0004105_49_603 165
8 3300045051 Ga0451576_0020748 Ga0451576_0020748_3271_3855 167
9 3300048928 Ga0496125_0134938 Ga0496125_0134938_895_1461 168
10 3300053087 Ga0500643_013234 Ga0500643_013234_1192_1758 170
11 3300053120 Ga0500597_044887 Ga0500597_044887_1185_1754 170
12 3300053157 Ga0500624_000257 Ga0500624_000257_14735_15304 170
13 3300053178 Ga0500637_0000023 Ga0500637_0000023_45684_46253 170
14 3300002076 JGI24749J21850_1000020 JGI24749J21850_100002027 171
15 3300002459 JGI24751J29686_10000177 JGI24751J29686_1000017727 171
16 3300005295 Ga0065707_10100721 Ga0065707_101007213 171
17 3300005331 Ga0070670_100000008 Ga0070670_10000000861 171
18 3300005347 Ga0070668_100142907 Ga0070668_1001429073 171
19 3300005353 Ga0070669_100000240 Ga0070669_10000024035 171
20 3300005367 Ga0070667_100024780 Ga0070667_1000247805 171
21 3300005617 Ga0068859_100007209 Ga0068859_1000072093 171
22 3300005618 Ga0068864_100000027 Ga0068864_10000002739 171
23 3300005719 Ga0068861_100042697 Ga0068861_1000426971 171
24 3300005844 Ga0068862_100000143 Ga0068862_10000014337 171
25 3300006931 Ga0097620_100007208 Ga0097620_10000720810 171
26 3300009177 Ga0105248_10000156 Ga0105248_1000015659 171
27 3300013306 Ga0163162_10581957 Ga0163162_105819572 171
28 3300014326 Ga0157380_10000416 Ga0157380_1000041613 171
29 3300017792 Ga0163161_10337600 Ga0163161_103376002 171
30 3300025923 Ga0207681_10000022 Ga0207681_1000002240 171
31 3300025925 Ga0207650_10000019 Ga0207650_10000019270 171
32 3300025925 Ga0207650_10000020 Ga0207650_10000020263 171
33 3300025941 Ga0207711_10003462 Ga0207711_100034626 171
34 3300025961 Ga0207712_10532788 Ga0207712_105327881 171
35 3300025972 Ga0207668_10131855 Ga0207668_101318553 171
36 3300025986 Ga0207658_10002545 Ga0207658_1000254514 171
37 3300026095 Ga0207676_10000022 Ga0207676_10000022214 171
38 3300026118 Ga0207675_100017724 Ga0207675_1000177247 171
39 3300028380 Ga0268265_10000031 Ga0268265_1000003166 171
40 3300037312 Ga0395899_0296532 Ga0395899_0296532_454_1026 171
41 3300037418 Ga0395900_0452757 Ga0395900_0452757_521_1093 171
42 3300037466 Ga0395898_0402879 Ga0395898_0402879_136_708 171
43 3300037471 Ga0395905_0118198 Ga0395905_0118198_873_1445 171
44 3300005295 Ga0065707_10230567 Ga0065707_102305672 172
45 3300005617 Ga0068859_100233491 Ga0068859_1002334911 172
46 3300005841 Ga0068863_100011484 Ga0068863_1000114849 172
47 3300005843 Ga0068860_100007912 Ga0068860_1000079125 172
48 3300005844 Ga0068862_100000014 Ga0068862_10000001444 172
49 3300006931 Ga0097620_100233493 Ga0097620_1002334934 172
50 3300009101 Ga0105247_10001608 Ga0105247_1000160810 172
51 3300009553 Ga0105249_10000002 Ga0105249_10000002356 172
52 3300025900 Ga0207710_10002422 Ga0207710_100024224 172
53 3300025961 Ga0207712_10000002 Ga0207712_10000002727 172
54 3300026088 Ga0207641_10004570 Ga0207641_100045706 172
55 3300028380 Ga0268265_10000176 Ga0268265_1000017645 172
56 3300028381 Ga0268264_10000548 Ga0268264_100005489 172
57 3300031456 Ga0307513_10016067 Ga0307513_100160677 172
58 3300048905 Ga0496102_0000036 Ga0496102_0000036_166173_166739 172
59 3300048906 Ga0496103_0000120 Ga0496103_0000120_49758_50324 172
60 3300048919 Ga0496116_0002277 Ga0496116_0002277_3676_4242 172
61 3300048920 Ga0496117_0000093 Ga0496117_0000093_166139_166705 172
62 3300048921 Ga0496118_0000070 Ga0496118_0000070_166143_166709 172
63 3300048922 Ga0496119_0075454 Ga0496119_0075454_924_1490 172
64 3300048927 Ga0496124_0000302 Ga0496124_0000302_35158_35724 172
65 3300026121 Ga0207683_10242189 Ga0207683_102421892 173
66 3300031548 Ga0307408_100012826 Ga0307408_1000128264 173
67 3300031901 Ga0307406_10061605 Ga0307406_100616054 173
68 3300031911 Ga0307412_10005897 Ga0307412_100058974 173
69 3300031995 Ga0307409_100120076 Ga0307409_1001200762 173
70 3300032002 Ga0307416_100010456 Ga0307416_1000104567 173
71 3300032005 Ga0307411_10006291 Ga0307411_100062914 173
72 3300042007 Ga0439449_0060849 Ga0439449_0060849_241_801 173
73 3300005440 Ga0070705_100068209 Ga0070705_1000682094 174
74 3300009545 Ga0105237_10113130 Ga0105237_101131302 174
75 3300025914 Ga0207671_10244459 Ga0207671_102444592 174
76 3300005355 Ga0070671_100719236 Ga0070671_1007192361 175
77 3300005330 Ga0070690_100082644 Ga0070690_1000826443 176
78 3300005331 Ga0070670_100002664 Ga0070670_1000026643 176
79 3300005335 Ga0070666_10001162 Ga0070666_1000116211 176
80 3300005344 Ga0070661_100033121 Ga0070661_1000331216 176
81 3300005347 Ga0070668_100084892 Ga0070668_1000848922 176
82 3300005347 Ga0070668_100455484 Ga0070668_1004554842 176
83 3300005353 Ga0070669_100106335 Ga0070669_1001063352 176
84 3300005354 Ga0070675_100040705 Ga0070675_1000407053 176
85 3300005355 Ga0070671_100031747 Ga0070671_1000317474 176
86 3300005355 Ga0070671_100035745 Ga0070671_1000357451 176
87 3300005355 Ga0070671_100066772 Ga0070671_1000667722 176
88 3300005364 Ga0070673_100000428 Ga0070673_10000042823 176
89 3300005367 Ga0070667_100006507 Ga0070667_10000650716 176
90 3300005367 Ga0070667_100008815 Ga0070667_1000088153 176
91 3300005456 Ga0070678_100001331 Ga0070678_10000133117 176
92 3300005457 Ga0070662_100000663 Ga0070662_10000066323 176
93 3300005543 Ga0070672_100121902 Ga0070672_1001219022 176
94 3300005548 Ga0070665_100071879 Ga0070665_1000718793 176
95 3300005564 Ga0070664_100071235 Ga0070664_1000712352 176
96 3300005614 Ga0068856_100243231 Ga0068856_1002432312 176
97 3300005616 Ga0068852_100028465 Ga0068852_1000284654 176
98 3300005617 Ga0068859_100013083 Ga0068859_1000130838 176
99 3300005617 Ga0068859_100242668 Ga0068859_1002426682 176
100 3300005618 Ga0068864_100000773 Ga0068864_10000077322 176
101 3300005618 Ga0068864_100025420 Ga0068864_1000254203 176
102 3300005841 Ga0068863_100005259 Ga0068863_10000525914 176
103 3300005842 Ga0068858_100001877 Ga0068858_10000187714 176
104 3300005842 Ga0068858_100006666 Ga0068858_1000066666 176
105 3300005843 Ga0068860_100012480 Ga0068860_1000124808 176
106 3300005844 Ga0068862_100064938 Ga0068862_1000649384 176
107 3300005844 Ga0068862_100222252 Ga0068862_1002222522 176
108 3300006237 Ga0097621_100013435 Ga0097621_1000134357 176
109 3300006358 Ga0068871_100053270 Ga0068871_1000532704 176
110 3300006931 Ga0097620_100013082 Ga0097620_1000130828 176
111 3300006931 Ga0097620_100242660 Ga0097620_1002426602 176
112 3300009177 Ga0105248_10004603 Ga0105248_1000460311 176
113 3300009177 Ga0105248_10007268 Ga0105248_100072687 176
114 3300013102 Ga0157371_10128265 Ga0157371_101282652 176
115 3300013296 Ga0157374_10005548 Ga0157374_100055481 176
116 3300013306 Ga0163162_10007095 Ga0163162_1000709516 176
117 3300013308 Ga0157375_10005314 Ga0157375_100053149 176
118 3300014325 Ga0163163_10011326 Ga0163163_1001132615 176
119 3300014326 Ga0157380_10032729 Ga0157380_100327295 176
120 3300025711 Ga0207696_1049740 Ga0207696_10497402 176
121 3300025900 Ga0207710_10102477 Ga0207710_101024772 176
122 3300025901 Ga0207688_10246200 Ga0207688_102462001 176
123 3300025923 Ga0207681_10072234 Ga0207681_100722342 176
124 3300025925 Ga0207650_10097298 Ga0207650_100972983 176
125 3300025931 Ga0207644_10060220 Ga0207644_100602203 176
126 3300025931 Ga0207644_10093670 Ga0207644_100936702 176
127 3300025933 Ga0207706_10004830 Ga0207706_100048307 176
128 3300025940 Ga0207691_10011199 Ga0207691_100111993 176
129 3300025940 Ga0207691_10160669 Ga0207691_101606692 176
130 3300025941 Ga0207711_10001615 Ga0207711_100016152 176
131 3300025941 Ga0207711_10006884 Ga0207711_1000688416 176
132 3300025945 Ga0207679_10101212 Ga0207679_101012121 176
133 3300025960 Ga0207651_10009088 Ga0207651_100090888 176
134 3300025960 Ga0207651_10025291 Ga0207651_100252912 176
135 3300025972 Ga0207668_10101875 Ga0207668_101018752 176
136 3300025986 Ga0207658_10004415 Ga0207658_100044156 176
137 3300026035 Ga0207703_10007646 Ga0207703_100076467 176
138 3300026035 Ga0207703_10031128 Ga0207703_100311281 176
139 3300026088 Ga0207641_10000659 Ga0207641_1000065910 176
140 3300026088 Ga0207641_10028171 Ga0207641_100281712 176
141 3300026089 Ga0207648_10131645 Ga0207648_101316452 176
142 3300026095 Ga0207676_10000975 Ga0207676_1000097522 176
143 3300026095 Ga0207676_10010875 Ga0207676_100108759 176
144 3300026116 Ga0207674_10197305 Ga0207674_101973053 176
145 3300026142 Ga0207698_10056432 Ga0207698_100564324 176
146 3300028379 Ga0268266_10123913 Ga0268266_101239133 176
147 3300028380 Ga0268265_10034646 Ga0268265_100346464 176
148 3300028380 Ga0268265_10046966 Ga0268265_100469662 176
149 3300028380 Ga0268265_10124239 Ga0268265_101242393 176
150 3300028381 Ga0268264_10007610 Ga0268264_100076102 176
151 3300028381 Ga0268264_10544296 Ga0268264_105442962 176
152 3300031456 Ga0307513_10269738 Ga0307513_102697382 176
153 3300031824 Ga0307413_10085082 Ga0307413_100850821 176
154 3300031901 Ga0307406_10356111 Ga0307406_103561112 176
155 3300031995 Ga0307409_100060696 Ga0307409_1000606962 176
156 3300031995 Ga0307409_100245178 Ga0307409_1002451782 176
157 3300032002 Ga0307416_101175488 Ga0307416_1011754881 176
158 3300032005 Ga0307411_10020032 Ga0307411_100200321 176
159 3300032126 Ga0307415_100004398 Ga0307415_1000043986 176
160 3300032126 Ga0307415_100047481 Ga0307415_1000474813 176
161 3300032126 Ga0307415_100084281 Ga0307415_1000842813 176
162 3300032126 Ga0307415_100208577 Ga0307415_1002085772 176
163 3300037418 Ga0395900_0524162 Ga0395900_0524162_409_981 176
164 3300038443 Ga0395901_0140619 Ga0395901_0140619_1110_1682 176
165 3300048903 Ga0496100_0011427 Ga0496100_0011427_1008_1595 176
166 3300048904 Ga0496101_0018098 Ga0496101_0018098_2931_3518 176
167 3300048910 Ga0496107_0026565 Ga0496107_0026565_935_1522 176
168 3300048911 Ga0496108_0003313 Ga0496108_0003313_4644_5216 176
169 3300048915 Ga0496112_0256355 Ga0496112_0256355_981_1553 176
170 3300048917 Ga0496114_0025387 Ga0496114_0025387_1675_2262 176
171 3300048918 Ga0496115_0036347 Ga0496115_0036347_251_838 176
172 3300049652 Ga0501202_052270 Ga0501202_052270_120_737 176
173 3300049661 Ga0501217_024251 Ga0501217_024251_444_1061 176
174 3300049679 Ga0501249_023216 Ga0501249_023216_381_953 176
175 3300049760 Ga0501263_012155 Ga0501263_012155_120_737 176
176 3300049765 Ga0501268_019677 Ga0501268_019677_159_731 176
177 3300049767 Ga0501270_025924 Ga0501270_025924_37_654 176
178 3300049770 Ga0501273_026821 Ga0501273_026821_51_668 176
179 3300001977 JGI24746J21847_1007014 JGI24746J21847_10070142 177
180 3300002076 JGI24749J21850_1003945 JGI24749J21850_10039452 177
181 3300002459 JGI24751J29686_10013044 JGI24751J29686_100130441 177
182 3300002459 JGI24751J29686_10019850 JGI24751J29686_100198502 177
183 3300005290 Ga0065712_10518209 Ga0065712_105182091 177
184 3300005293 Ga0065715_10034224 Ga0065715_100342242 177
185 3300005327 Ga0070658_10000001 Ga0070658_1000000197 177
186 3300005328 Ga0070676_10054542 Ga0070676_100545423 177
187 3300005331 Ga0070670_100011203 Ga0070670_1000112034 177
188 3300005333 Ga0070677_10000559 Ga0070677_1000055911 177
189 3300005333 Ga0070677_10001594 Ga0070677_100015943 177
190 3300005339 Ga0070660_100000362 Ga0070660_1000003629 177
191 3300005344 Ga0070661_100859825 Ga0070661_1008598251 177
192 3300005345 Ga0070692_10000109 Ga0070692_100001097 177
193 3300005345 Ga0070692_10381253 Ga0070692_103812532 177
194 3300005347 Ga0070668_100051510 Ga0070668_1000515102 177
195 3300005353 Ga0070669_100043886 Ga0070669_1000438863 177
196 3300005353 Ga0070669_100132466 Ga0070669_1001324661 177
197 3300005353 Ga0070669_100386014 Ga0070669_1003860142 177
198 3300005354 Ga0070675_100005534 Ga0070675_10000553416 177
199 3300005364 Ga0070673_100007906 Ga0070673_1000079064 177
200 3300005366 Ga0070659_100007247 Ga0070659_1000072472 177
201 3300005366 Ga0070659_100526543 Ga0070659_1005265432 177
202 3300005367 Ga0070667_100007799 Ga0070667_1000077993 177
203 3300005438 Ga0070701_10098188 Ga0070701_100981883 177
204 3300005455 Ga0070663_100080728 Ga0070663_1000807283 177
205 3300005456 Ga0070678_100290808 Ga0070678_1002908082 177
206 3300005457 Ga0070662_100054296 Ga0070662_1000542963 177
207 3300005459 Ga0068867_100575591 Ga0068867_1005755911 177
208 3300005539 Ga0068853_100002896 Ga0068853_1000028969 177
209 3300005543 Ga0070672_100010331 Ga0070672_1000103313 177
210 3300005577 Ga0068857_100081151 Ga0068857_1000811512 177
211 3300005577 Ga0068857_100087141 Ga0068857_1000871412 177
212 3300005617 Ga0068859_100096889 Ga0068859_1000968894 177
213 3300005618 Ga0068864_100128234 Ga0068864_1001282341 177
214 3300005618 Ga0068864_100542762 Ga0068864_1005427621 177
215 3300005618 Ga0068864_100547688 Ga0068864_1005476882 177
216 3300005718 Ga0068866_10720806 Ga0068866_107208062 177
217 3300005719 Ga0068861_100062401 Ga0068861_1000624013 177
218 3300005834 Ga0068851_10241896 Ga0068851_102418962 177
219 3300005840 Ga0068870_10135302 Ga0068870_101353022 177
220 3300005842 Ga0068858_100389940 Ga0068858_1003899402 177
221 3300005844 Ga0068862_100331441 Ga0068862_1003314411 177
222 3300006881 Ga0068865_100113827 Ga0068865_1001138273 177
223 3300006931 Ga0097620_100096892 Ga0097620_1000968922 177
224 3300009093 Ga0105240_10207214 Ga0105240_102072142 177
225 3300009148 Ga0105243_10091117 Ga0105243_100911172 177
226 3300009176 Ga0105242_10791674 Ga0105242_107916741 177
227 3300009177 Ga0105248_10070066 Ga0105248_100700663 177
228 3300009177 Ga0105248_10812550 Ga0105248_108125501 177
229 3300009551 Ga0105238_10254491 Ga0105238_102544913 177
230 3300009553 Ga0105249_10009121 Ga0105249_100091212 177
231 3300009553 Ga0105249_10191647 Ga0105249_101916473 177
232 3300013100 Ga0157373_10198853 Ga0157373_101988532 177
233 3300013104 Ga0157370_10316070 Ga0157370_103160702 177
234 3300013105 Ga0157369_10000412 Ga0157369_1000041261 177
235 3300013105 Ga0157369_10158145 Ga0157369_101581452 177
236 3300013306 Ga0163162_10036415 Ga0163162_100364152 177
237 3300013306 Ga0163162_10048710 Ga0163162_100487104 177
238 3300013307 Ga0157372_10683143 Ga0157372_106831432 177
239 3300013308 Ga0157375_10001588 Ga0157375_100015888 177
240 3300013308 Ga0157375_10426749 Ga0157375_104267492 177
241 3300014325 Ga0163163_10173343 Ga0163163_101733431 177
242 3300014325 Ga0163163_11036801 Ga0163163_110368012 177
243 3300014326 Ga0157380_10014156 Ga0157380_100141564 177
244 3300014326 Ga0157380_10782261 Ga0157380_107822611 177
245 3300017792 Ga0163161_10025240 Ga0163161_100252405 177
246 3300021358 Ga0213873_10000008 Ga0213873_10000008197 177
247 3300021384 Ga0213876_10000005 Ga0213876_10000005406 177
248 3300021384 Ga0213876_10000120 Ga0213876_1000012074 177
249 3300021384 Ga0213876_10020039 Ga0213876_100200394 177
250 3300025315 Ga0207697_10004971 Ga0207697_100049717 177
251 3300025321 Ga0207656_10214057 Ga0207656_102140571 177
252 3300025893 Ga0207682_10000576 Ga0207682_100005765 177
253 3300025893 Ga0207682_10002227 Ga0207682_100022273 177
254 3300025907 Ga0207645_10062165 Ga0207645_100621652 177
255 3300025908 Ga0207643_10065468 Ga0207643_100654683 177
256 3300025909 Ga0207705_10000002 Ga0207705_100000021782 177
257 3300025919 Ga0207657_10000084 Ga0207657_100000842 177
258 3300025919 Ga0207657_10026027 Ga0207657_100260272 177
259 3300025923 Ga0207681_10001934 Ga0207681_1000193415 177
260 3300025923 Ga0207681_10356867 Ga0207681_103568672 177
261 3300025925 Ga0207650_10007152 Ga0207650_100071528 177
262 3300025925 Ga0207650_10019611 Ga0207650_100196113 177
263 3300025926 Ga0207659_10001721 Ga0207659_100017218 177
264 3300025932 Ga0207690_10003423 Ga0207690_100034239 177
265 3300025932 Ga0207690_10667300 Ga0207690_106673002 177
266 3300025933 Ga0207706_10000187 Ga0207706_1000018757 177
267 3300025937 Ga0207669_10098652 Ga0207669_100986521 177
268 3300025938 Ga0207704_10428205 Ga0207704_104282052 177
269 3300025941 Ga0207711_10210724 Ga0207711_102107242 177
270 3300025949 Ga0207667_10191589 Ga0207667_101915892 177
271 3300025972 Ga0207668_10004109 Ga0207668_100041093 177
272 3300025981 Ga0207640_10464037 Ga0207640_104640372 177
273 3300025986 Ga0207658_10069373 Ga0207658_100693733 177
274 3300025986 Ga0207658_10186760 Ga0207658_101867603 177
275 3300026041 Ga0207639_10003166 Ga0207639_1000316617 177
276 3300026067 Ga0207678_10022045 Ga0207678_100220452 177
277 3300026089 Ga0207648_10661010 Ga0207648_106610101 177
278 3300026095 Ga0207676_10481489 Ga0207676_104814892 177
279 3300026116 Ga0207674_10007205 Ga0207674_100072056 177
280 3300026116 Ga0207674_10142334 Ga0207674_101423342 177
281 3300026118 Ga0207675_100006920 Ga0207675_10000692013 177
282 3300026121 Ga0207683_10019836 Ga0207683_100198362 177
283 3300027552 Ga0209982_1035857 Ga0209982_10358571 177
284 3300027665 Ga0209983_1004609 Ga0209983_10046092 177
285 3300027876 Ga0209974_10002749 Ga0209974_100027495 177
286 3300031548 Ga0307408_100183350 Ga0307408_1001833502 177
287 3300031548 Ga0307408_100226301 Ga0307408_1002263012 177
288 3300031548 Ga0307408_100564376 Ga0307408_1005643762 177
289 3300031731 Ga0307405_10049288 Ga0307405_100492883 177
290 3300031731 Ga0307405_10056175 Ga0307405_100561753 177
291 3300031731 Ga0307405_10246984 Ga0307405_102469841 177
292 3300031731 Ga0307405_10422265 Ga0307405_104222651 177
293 3300031731 Ga0307405_11157019 Ga0307405_111570191 177
294 3300031824 Ga0307413_10008193 Ga0307413_100081934 177
295 3300031824 Ga0307413_10045237 Ga0307413_100452373 177
296 3300031824 Ga0307413_10109699 Ga0307413_101096992 177
297 3300031824 Ga0307413_10346005 Ga0307413_103460051 177
298 3300031824 Ga0307413_10426672 Ga0307413_104266722 177
299 3300031824 Ga0307413_10427126 Ga0307413_104271261 177
300 3300031852 Ga0307410_10006176 Ga0307410_1000617613 177
301 3300031852 Ga0307410_10039243 Ga0307410_100392434 177
302 3300031852 Ga0307410_10259039 Ga0307410_102590392 177
303 3300031852 Ga0307410_10319245 Ga0307410_103192452 177
304 3300031852 Ga0307410_10508093 Ga0307410_105080931 177
305 3300031903 Ga0307407_10019616 Ga0307407_100196162 177
306 3300031903 Ga0307407_10026515 Ga0307407_100265153 177
307 3300031903 Ga0307407_10287324 Ga0307407_102873242 177
308 3300031911 Ga0307412_10021294 Ga0307412_100212942 177
309 3300031911 Ga0307412_10040176 Ga0307412_100401764 177
310 3300031911 Ga0307412_10148765 Ga0307412_101487653 177
311 3300031911 Ga0307412_10510954 Ga0307412_105109542 177
312 3300031995 Ga0307409_100005979 Ga0307409_1000059792 177
313 3300031995 Ga0307409_100022990 Ga0307409_1000229904 177
314 3300031995 Ga0307409_100028822 Ga0307409_1000288223 177
315 3300031995 Ga0307409_100193461 Ga0307409_1001934612 177
316 3300031995 Ga0307409_100422285 Ga0307409_1004222851 177
317 3300032002 Ga0307416_100020106 Ga0307416_1000201062 177
318 3300032002 Ga0307416_100045268 Ga0307416_1000452682 177
319 3300032002 Ga0307416_100047106 Ga0307416_1000471063 177
320 3300032002 Ga0307416_100136749 Ga0307416_1001367493 177
321 3300032002 Ga0307416_100219344 Ga0307416_1002193443 177
322 3300032002 Ga0307416_100265480 Ga0307416_1002654803 177
323 3300032002 Ga0307416_100512370 Ga0307416_1005123702 177
324 3300032002 Ga0307416_100848208 Ga0307416_1008482081 177
325 3300032004 Ga0307414_10010008 Ga0307414_100100084 177
326 3300032004 Ga0307414_10012904 Ga0307414_100129043 177
327 3300032004 Ga0307414_10467267 Ga0307414_104672672 177
328 3300032004 Ga0307414_10672670 Ga0307414_106726701 177
329 3300032005 Ga0307411_10015969 Ga0307411_100159692 177
330 3300032005 Ga0307411_10016001 Ga0307411_100160014 177
331 3300032005 Ga0307411_10024467 Ga0307411_100244674 177
332 3300032005 Ga0307411_10087285 Ga0307411_100872853 177
333 3300032005 Ga0307411_10290037 Ga0307411_102900372 177
334 3300032005 Ga0307411_10619979 Ga0307411_106199791 177
335 3300032005 Ga0307411_10998202 Ga0307411_109982021 177
336 3300032005 Ga0307411_11000651 Ga0307411_110006511 177
337 3300032126 Ga0307415_100018828 Ga0307415_1000188283 177
338 3300032126 Ga0307415_100047202 Ga0307415_1000472024 177
339 3300032126 Ga0307415_100434101 Ga0307415_1004341012 177
340 3300033180 Ga0307510_10083889 Ga0307510_100838892 177
341 3300039437 Ga0436365_0010969 Ga0436365_0010969_65008_65598 177
342 3300039437 Ga0436365_1858586 Ga0436365_1858586_60912_61499 177
343 3300039453 Ga0436362_1035670 Ga0436362_1035670_120394_120981 177
344 3300041406 Ga0439439_0177145 Ga0439439_0177145_25_594 177
345 3300042439 Ga0439464_0046531 Ga0439464_0046531_283_852 177
346 3300046558 Ga0495633_0250321 Ga0495633_0250321_205_774 177
347 3300046664 Ga0495659_0083459 Ga0495659_0083459_322_891 177
348 3300047447 Ga0495685_074143 Ga0495685_074143_74_643 177
349 3300048904 Ga0496101_0564616 Ga0496101_0564616_175_744 177
350 3300048913 Ga0496110_0035000 Ga0496110_0035000_215_784 177
351 3300048917 Ga0496114_0017208 Ga0496114_0017208_3488_4057 177
352 3300049668 Ga0501233_021304 Ga0501233_021304_807_1376 177
353 3300049679 Ga0501249_010157 Ga0501249_010157_1054_1623 177
354 3300001904 JGI24736J21556_1000017 JGI24736J21556_100001735 178
355 3300005456 Ga0070678_100848790 Ga0070678_1008487902 178
356 3300005563 Ga0068855_100068059 Ga0068855_1000680594 178
357 3300009093 Ga0105240_11555056 Ga0105240_115550561 178
358 3300025949 Ga0207667_10089869 Ga0207667_100898693 178
359 3300026121 Ga0207683_10348987 Ga0207683_103489872 178
360 3300046542 Ga0495597_0075966 Ga0495597_0075966_488_1048 178
361 3300046616 Ga0495668_0257096 Ga0495668_0257096_319_885 178
362 3300046660 Ga0495625_0000332 Ga0495625_0000332_37591_38151 178
363 3300046660 Ga0495625_0330813 Ga0495625_0330813_376_954 178
364 3300053092 Ga0500583_0208456 Ga0500583_0208456_377_943 178
365 3300053108 Ga0500562_058796 Ga0500562_058796_238_804 178
366 3300053116 Ga0500592_011628 Ga0500592_011628_747_1313 178

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06181

Urate_ox_N

Urate oxidase N-terminal

140

215

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1b68-assembly1.cif.gz_A apolipoprotein e4 (apoe4), 22k fragment 0.5831 37 175
1nfn-assembly1.cif.gz_A apolipoprotein e3 (apoe3) 0.575 33 174
1b68-assembly1.cif.gz_A apolipoprotein e4 (apoe4), 22k fragment 0.5711 37 175
7fcs-assembly1.cif.gz_A crystal structure of the n-terminal domain of mutants of human apolipoprotein-e (apoe) 0.5674 34 176
1nfo-assembly1.cif.gz_A apolipoprotein e2 (apoe2, d154a mutation) 0.5588 33 176
ID Description Score Start End Superfamily
af_K7KZX1_376_557_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7508 21 174 1.20.120.1770
af_Q59QL0_312_444_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.6594 27 101 3.30.40.10
1sesB01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Serine-tRNA synthetase, tRNA binding domain 0.6541 91 174 1.10.287.40
af_K7LU78_450_565_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.6128 74 174 1.20.58.390
af_K7KZX1_376_557_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5983 21 174 1.20.120.1770
ID Description Score Start End GO Terms
AF-A0A2E4GUV7-F1-model_v4 Urate oxidase N-terminal domain-containing protein 0.981 108 174 GO:0016020
AF-A0A7C7S3Q6-F1-model_v4 deleted 0.9753 25 172
AF-A0A2E6X907-F1-model_v4 Urate oxidase N-terminal domain-containing protein 0.9722 41 174 GO:0016020
AF-A0A2W5X8J5-F1-model_v4 Urate oxidase N-terminal domain-containing protein 0.9627 27 174 GO:0016020
AF-A0A520B816-F1-model_v4 Urate oxidase N-terminal domain-containing protein 0.962 100 174 GO:0016020

Feature Viewer

pLDDT pTM Quality
92.7 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map