F424000
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 366 | 181 | 366 | 189 |
Family's Representative Sequence
| Representative Sequence | 3300009148|Ga0105243_10091117|Ga0105243_100911172 |
| Length | 219 |
| Sequence | MLARPRISTLETTIDAANAAKGARMGKILENLYLTLAIGLVLAIVIMLLPDAGYNPGPTGELATGVLQWLHVFFGITWIGLLYYFNFVQIPTMPSIPAELKPGVSKYIAPNALFYFRWAAAMTMLIGLLLAWVNGYLVEALTFQPGFQLIGTGMWLGLIMGFNVWGVIWPNQKKALGLVEADDATKAKAARVAMLASRTNTLLSIPMLYAMASFQSLPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 4 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 37 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 38 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 39 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 40 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 41 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 42 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 43 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 44 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 45 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 46 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 47 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 48 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 49 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 51 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 52 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 73 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 74 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 119 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 120 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 121 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 122 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 123 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 124 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 125 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 126 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 127 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 128 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 129 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 130 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 131 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 132 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 133 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 134 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 135 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 136 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 137 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 138 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 139 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 140 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 141 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 142 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 143 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 151 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 152 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 153 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 154 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 155 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 156 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 157 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 158 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 159 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 160 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 161 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 162 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 163 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 164 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 165 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 166 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 167 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 168 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 169 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 170 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 171 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 172 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 173 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 174 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 175 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 176 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 177 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 178 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 179 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 180 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 181 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.01 |
| Nodule | 0 |
| Rhizoplane | 3.28 |
| Rhizosphere | 89.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1000017 | 3300001904 | Bacteria | 28475 |
| 2 | JGI24746J21847_1007014 | 3300001977 | Bacteria | 1731 |
| 3 | JGI24749J21850_1000020 | 3300002076 | Bacteria | 31050 |
| 4 | JGI24749J21850_1003945 | 3300002076 | Bacteria | 2067 |
| 5 | JGI24751J29686_10000177 | 3300002459 | Bacteria | 29687 |
| 6 | JGI24751J29686_10013044 | 3300002459 | Bacteria | 1716 |
| 7 | JGI24751J29686_10019850 | 3300002459 | Bacteria | 1391 |
| 8 | Ga0065712_10518209 | 3300005290 | Bacteria | 637 |
| 9 | Ga0065715_10034224 | 3300005293 | Bacteria | 1373 |
| 10 | Ga0065707_10100721 | 3300005295 | Bacteria | 2910 |
| 11 | Ga0065707_10230567 | 3300005295 | Bacteria | 1190 |
| 12 | Ga0070658_10000001 | 3300005327 | Bacteria | 856789 |
| 13 | Ga0070676_10054542 | 3300005328 | Bacteria | 2357 |
| 14 | Ga0070690_100082644 | 3300005330 | Bacteria | 2103 |
| 15 | Ga0070670_100000008 | 3300005331 | Bacteria | 292132 |
| 16 | Ga0070670_100002664 | 3300005331 | Bacteria | 14745 |
| 17 | Ga0070670_100011203 | 3300005331 | Bacteria | 7663 |
| 18 | Ga0070677_10000559 | 3300005333 | Bacteria | 12697 |
| 19 | Ga0070677_10001594 | 3300005333 | Bacteria | 7175 |
| 20 | Ga0070666_10001162 | 3300005335 | Bacteria | 15997 |
| 21 | Ga0070660_100000362 | 3300005339 | Bacteria | 30297 |
| 22 | Ga0070661_100033121 | 3300005344 | Bacteria | 3742 |
| 23 | Ga0070661_100859825 | 3300005344 | Bacteria | 747 |
| 24 | Ga0070692_10000109 | 3300005345 | Bacteria | 18891 |
| 25 | Ga0070692_10381253 | 3300005345 | Bacteria | 885 |
| 26 | Ga0070668_100051510 | 3300005347 | Bacteria | 3172 |
| 27 | Ga0070668_100084892 | 3300005347 | Bacteria | 2488 |
| 28 | Ga0070668_100142907 | 3300005347 | Bacteria | 1930 |
| 29 | Ga0070668_100455484 | 3300005347 | Bacteria | 1101 |
| 30 | Ga0070669_100000240 | 3300005353 | Bacteria | 45481 |
| 31 | Ga0070669_100043886 | 3300005353 | Bacteria | 3257 |
| 32 | Ga0070669_100106335 | 3300005353 | Bacteria | 2124 |
| 33 | Ga0070669_100132466 | 3300005353 | Bacteria | 1914 |
| 34 | Ga0070669_100386014 | 3300005353 | Bacteria | 1143 |
| 35 | Ga0070675_100005534 | 3300005354 | Bacteria | 9669 |
| 36 | Ga0070675_100040705 | 3300005354 | Bacteria | 3795 |
| 37 | Ga0070671_100031747 | 3300005355 | Bacteria | 4366 |
| 38 | Ga0070671_100035745 | 3300005355 | Bacteria | 4116 |
| 39 | Ga0070671_100066772 | 3300005355 | Bacteria | 2998 |
| 40 | Ga0070671_100719236 | 3300005355 | Bacteria | 867 |
| 41 | Ga0070673_100000428 | 3300005364 | Bacteria | 22198 |
| 42 | Ga0070673_100007906 | 3300005364 | Bacteria | 7049 |
| 43 | Ga0070659_100007247 | 3300005366 | Bacteria | 8050 |
| 44 | Ga0070659_100526543 | 3300005366 | Bacteria | 1010 |
| 45 | Ga0070667_100006507 | 3300005367 | Bacteria | 9712 |
| 46 | Ga0070667_100007799 | 3300005367 | Bacteria | 8876 |
| 47 | Ga0070667_100008815 | 3300005367 | Bacteria | 8356 |
| 48 | Ga0070667_100024780 | 3300005367 | Bacteria | 4985 |
| 49 | Ga0070701_10098188 | 3300005438 | Bacteria | 1617 |
| 50 | Ga0070705_100068209 | 3300005440 | Bacteria | 2140 |
| 51 | Ga0070663_100080728 | 3300005455 | Bacteria | 2389 |
| 52 | Ga0070678_100001331 | 3300005456 | Bacteria | 13124 |
| 53 | Ga0070678_100290808 | 3300005456 | Bacteria | 1385 |
| 54 | Ga0070678_100848790 | 3300005456 | Bacteria | 832 |
| 55 | Ga0070662_100000663 | 3300005457 | Bacteria | 20915 |
| 56 | Ga0070662_100054296 | 3300005457 | Bacteria | 2903 |
| 57 | Ga0068867_100575591 | 3300005459 | Bacteria | 979 |
| 58 | Ga0068853_100002896 | 3300005539 | Bacteria | 13028 |
| 59 | Ga0070672_100010331 | 3300005543 | Bacteria | 6472 |
| 60 | Ga0070672_100121902 | 3300005543 | Bacteria | 2135 |
| 61 | Ga0070665_100071879 | 3300005548 | Bacteria | 3467 |
| 62 | Ga0068855_100068059 | 3300005563 | Bacteria | 4147 |
| 63 | Ga0070664_100071235 | 3300005564 | Bacteria | 2978 |
| 64 | Ga0068857_100081151 | 3300005577 | Bacteria | 2896 |
| 65 | Ga0068857_100087141 | 3300005577 | Bacteria | 2792 |
| 66 | Ga0068856_100243231 | 3300005614 | Bacteria | 1814 |
| 67 | Ga0068852_100028465 | 3300005616 | Bacteria | 4574 |
| 68 | Ga0068859_100007209 | 3300005617 | Bacteria | 11280 |
| 69 | Ga0068859_100013083 | 3300005617 | Bacteria | 8338 |
| 70 | Ga0068859_100096889 | 3300005617 | Bacteria | 3002 |
| 71 | Ga0068859_100233491 | 3300005617 | Bacteria | 1928 |
| 72 | Ga0068859_100242668 | 3300005617 | Bacteria | 1891 |
| 73 | Ga0068864_100000027 | 3300005618 | Bacteria | 229759 |
| 74 | Ga0068864_100000773 | 3300005618 | Bacteria | 26846 |
| 75 | Ga0068864_100025420 | 3300005618 | Bacteria | 4986 |
| 76 | Ga0068864_100128234 | 3300005618 | Bacteria | 2276 |
| 77 | Ga0068864_100542762 | 3300005618 | Bacteria | 1123 |
| 78 | Ga0068864_100547688 | 3300005618 | Bacteria | 1118 |
| 79 | Ga0068866_10720806 | 3300005718 | Bacteria | 686 |
| 80 | Ga0068861_100042697 | 3300005719 | Bacteria | 3399 |
| 81 | Ga0068861_100062401 | 3300005719 | Bacteria | 2863 |
| 82 | Ga0068851_10241896 | 3300005834 | Bacteria | 1021 |
| 83 | Ga0068870_10135302 | 3300005840 | Bacteria | 1436 |
| 84 | Ga0068863_100005259 | 3300005841 | Bacteria | 12779 |
| 85 | Ga0068863_100011484 | 3300005841 | Bacteria | 8565 |
| 86 | Ga0068858_100001877 | 3300005842 | Bacteria | 21436 |
| 87 | Ga0068858_100006666 | 3300005842 | Bacteria | 11233 |
| 88 | Ga0068858_100389940 | 3300005842 | Bacteria | 1337 |
| 89 | Ga0068860_100007912 | 3300005843 | Bacteria | 10613 |
| 90 | Ga0068860_100012480 | 3300005843 | Bacteria | 8368 |
| 91 | Ga0068862_100000014 | 3300005844 | Bacteria | 251552 |
| 92 | Ga0068862_100000143 | 3300005844 | Bacteria | 80650 |
| 93 | Ga0068862_100064938 | 3300005844 | Bacteria | 3143 |
| 94 | Ga0068862_100222252 | 3300005844 | Bacteria | 1710 |
| 95 | Ga0068862_100331441 | 3300005844 | Bacteria | 1407 |
| 96 | Ga0075366_10074941 | 3300006195 | Bacteria | 2018 |
| 97 | Ga0097621_100013435 | 3300006237 | Bacteria | 6104 |
| 98 | Ga0068871_100053270 | 3300006358 | Bacteria | 3278 |
| 99 | Ga0068865_100113827 | 3300006881 | Bacteria | 2000 |
| 100 | Ga0097620_100007208 | 3300006931 | Bacteria | 11280 |
| 101 | Ga0097620_100013082 | 3300006931 | Bacteria | 8338 |
| 102 | Ga0097620_100096892 | 3300006931 | Bacteria | 3002 |
| 103 | Ga0097620_100233493 | 3300006931 | Bacteria | 1928 |
| 104 | Ga0097620_100242660 | 3300006931 | Bacteria | 1891 |
| 105 | Ga0105240_10207214 | 3300009093 | Bacteria | 2294 |
| 106 | Ga0105240_11555056 | 3300009093 | Bacteria | 693 |
| 107 | Ga0105247_10001608 | 3300009101 | Bacteria | 15987 |
| 108 | Ga0105243_10091117 | 3300009148 | Bacteria | 2510 |
| 109 | Ga0105242_10791674 | 3300009176 | Bacteria | 938 |
| 110 | Ga0105248_10000156 | 3300009177 | Bacteria | 79110 |
| 111 | Ga0105248_10004603 | 3300009177 | Bacteria | 15267 |
| 112 | Ga0105248_10007268 | 3300009177 | Bacteria | 12152 |
| 113 | Ga0105248_10070066 | 3300009177 | Bacteria | 3938 |
| 114 | Ga0105248_10812550 | 3300009177 | Bacteria | 1055 |
| 115 | Ga0105237_10113130 | 3300009545 | Bacteria | 2706 |
| 116 | Ga0105238_10254491 | 3300009551 | Bacteria | 1735 |
| 117 | Ga0105249_10000002 | 3300009553 | Bacteria | 376207 |
| 118 | Ga0105249_10009121 | 3300009553 | Bacteria | 8676 |
| 119 | Ga0105249_10191647 | 3300009553 | Bacteria | 1996 |
| 120 | Ga0157373_10198853 | 3300013100 | Bacteria | 1413 |
| 121 | Ga0157371_10128265 | 3300013102 | Bacteria | 1804 |
| 122 | Ga0157370_10316070 | 3300013104 | Bacteria | 1441 |
| 123 | Ga0157369_10000412 | 3300013105 | Bacteria | 56593 |
| 124 | Ga0157369_10158145 | 3300013105 | Bacteria | 2393 |
| 125 | Ga0157374_10005548 | 3300013296 | Bacteria | 10619 |
| 126 | Ga0163162_10007095 | 3300013306 | Bacteria | 10874 |
| 127 | Ga0163162_10036415 | 3300013306 | Bacteria | 4904 |
| 128 | Ga0163162_10048710 | 3300013306 | Bacteria | 4246 |
| 129 | Ga0163162_10581957 | 3300013306 | Bacteria | 1246 |
| 130 | Ga0157372_10683143 | 3300013307 | Bacteria | 1195 |
| 131 | Ga0157375_10001588 | 3300013308 | Bacteria | 19530 |
| 132 | Ga0157375_10005314 | 3300013308 | Bacteria | 11187 |
| 133 | Ga0157375_10426749 | 3300013308 | Bacteria | 1492 |
| 134 | Ga0163163_10011326 | 3300014325 | Bacteria | 8085 |
| 135 | Ga0163163_10173343 | 3300014325 | Bacteria | 2204 |
| 136 | Ga0163163_11036801 | 3300014325 | Bacteria | 884 |
| 137 | Ga0157380_10000416 | 3300014326 | Bacteria | 25905 |
| 138 | Ga0157380_10014156 | 3300014326 | Bacteria | 5832 |
| 139 | Ga0157380_10032729 | 3300014326 | Bacteria | 4002 |
| 140 | Ga0157380_10782261 | 3300014326 | Bacteria | 969 |
| 141 | Ga0163161_10025240 | 3300017792 | Bacteria | 4205 |
| 142 | Ga0163161_10337600 | 3300017792 | Bacteria | 1195 |
| 143 | Ga0213873_10000008 | 3300021358 | Bacteria | 263363 |
| 144 | Ga0213876_10000005 | 3300021384 | Bacteria | 727326 |
| 145 | Ga0213876_10000120 | 3300021384 | Bacteria | 85450 |
| 146 | Ga0213876_10020039 | 3300021384 | Bacteria | 3533 |
| 147 | Ga0207697_10004971 | 3300025315 | Bacteria | 6266 |
| 148 | Ga0207656_10214057 | 3300025321 | Bacteria | 935 |
| 149 | Ga0207696_1049740 | 3300025711 | Bacteria | 1201 |
| 150 | Ga0207682_10000576 | 3300025893 | Bacteria | 16980 |
| 151 | Ga0207682_10002227 | 3300025893 | Bacteria | 8747 |
| 152 | Ga0207710_10002422 | 3300025900 | Bacteria | 8689 |
| 153 | Ga0207710_10102477 | 3300025900 | Bacteria | 1351 |
| 154 | Ga0207688_10246200 | 3300025901 | Bacteria | 1082 |
| 155 | Ga0207645_10062165 | 3300025907 | Bacteria | 2385 |
| 156 | Ga0207643_10065468 | 3300025908 | Bacteria | 2082 |
| 157 | Ga0207705_10000002 | 3300025909 | Bacteria | 2046852 |
| 158 | Ga0207671_10244459 | 3300025914 | Bacteria | 1410 |
| 159 | Ga0207657_10000084 | 3300025919 | Bacteria | 89401 |
| 160 | Ga0207657_10026027 | 3300025919 | Bacteria | 5384 |
| 161 | Ga0207681_10000022 | 3300025923 | Bacteria | 230079 |
| 162 | Ga0207681_10001934 | 3300025923 | Bacteria | 13274 |
| 163 | Ga0207681_10072234 | 3300025923 | Bacteria | 2409 |
| 164 | Ga0207681_10356867 | 3300025923 | Bacteria | 1171 |
| 165 | Ga0207650_10000019 | 3300025925 | Bacteria | 344751 |
| 166 | Ga0207650_10000020 | 3300025925 | Bacteria | 342596 |
| 167 | Ga0207650_10007152 | 3300025925 | Bacteria | 7607 |
| 168 | Ga0207650_10019611 | 3300025925 | Bacteria | 4754 |
| 169 | Ga0207650_10097298 | 3300025925 | Bacteria | 2259 |
| 170 | Ga0207659_10001721 | 3300025926 | Bacteria | 12974 |
| 171 | Ga0207644_10060220 | 3300025931 | Bacteria | 2747 |
| 172 | Ga0207644_10093670 | 3300025931 | Bacteria | 2243 |
| 173 | Ga0207690_10003423 | 3300025932 | Bacteria | 9469 |
| 174 | Ga0207690_10667300 | 3300025932 | Bacteria | 853 |
| 175 | Ga0207706_10000187 | 3300025933 | Bacteria | 69090 |
| 176 | Ga0207706_10004830 | 3300025933 | Bacteria | 12622 |
| 177 | Ga0207669_10098652 | 3300025937 | Bacteria | 1924 |
| 178 | Ga0207704_10428205 | 3300025938 | Bacteria | 1051 |
| 179 | Ga0207691_10011199 | 3300025940 | Bacteria | 8606 |
| 180 | Ga0207691_10160669 | 3300025940 | Bacteria | 1971 |
| 181 | Ga0207711_10001615 | 3300025941 | Bacteria | 20798 |
| 182 | Ga0207711_10003462 | 3300025941 | Bacteria | 13667 |
| 183 | Ga0207711_10006884 | 3300025941 | Bacteria | 9546 |
| 184 | Ga0207711_10210724 | 3300025941 | Bacteria | 1775 |
| 185 | Ga0207679_10101212 | 3300025945 | Bacteria | 2254 |
| 186 | Ga0207667_10089869 | 3300025949 | Bacteria | 3174 |
| 187 | Ga0207667_10191589 | 3300025949 | Bacteria | 2098 |
| 188 | Ga0207651_10009088 | 3300025960 | Bacteria | 5410 |
| 189 | Ga0207651_10025291 | 3300025960 | Bacteria | 3689 |
| 190 | Ga0207712_10000002 | 3300025961 | Bacteria | 706628 |
| 191 | Ga0207712_10532788 | 3300025961 | Bacteria | 1008 |
| 192 | Ga0207668_10004109 | 3300025972 | Bacteria | 8547 |
| 193 | Ga0207668_10101875 | 3300025972 | Bacteria | 2135 |
| 194 | Ga0207668_10131855 | 3300025972 | Bacteria | 1909 |
| 195 | Ga0207640_10464037 | 3300025981 | Bacteria | 1047 |
| 196 | Ga0207658_10002545 | 3300025986 | Bacteria | 13255 |
| 197 | Ga0207658_10004415 | 3300025986 | Bacteria | 9784 |
| 198 | Ga0207658_10069373 | 3300025986 | Bacteria | 2663 |
| 199 | Ga0207658_10186760 | 3300025986 | Bacteria | 1720 |
| 200 | Ga0207703_10007646 | 3300026035 | Bacteria | 8564 |
| 201 | Ga0207703_10031128 | 3300026035 | Bacteria | 4217 |
| 202 | Ga0207639_10003166 | 3300026041 | Bacteria | 11071 |
| 203 | Ga0207678_10022045 | 3300026067 | Bacteria | 5580 |
| 204 | Ga0207641_10000659 | 3300026088 | Bacteria | 37671 |
| 205 | Ga0207641_10004570 | 3300026088 | Bacteria | 11965 |
| 206 | Ga0207641_10028171 | 3300026088 | Bacteria | 4640 |
| 207 | Ga0207648_10131645 | 3300026089 | Bacteria | 2202 |
| 208 | Ga0207648_10661010 | 3300026089 | Bacteria | 966 |
| 209 | Ga0207676_10000022 | 3300026095 | Bacteria | 296286 |
| 210 | Ga0207676_10000975 | 3300026095 | Bacteria | 22066 |
| 211 | Ga0207676_10010875 | 3300026095 | Bacteria | 6491 |
| 212 | Ga0207676_10481489 | 3300026095 | Bacteria | 1175 |
| 213 | Ga0207674_10007205 | 3300026116 | Bacteria | 12980 |
| 214 | Ga0207674_10142334 | 3300026116 | Bacteria | 2358 |
| 215 | Ga0207674_10197305 | 3300026116 | Bacteria | 1962 |
| 216 | Ga0207675_100006920 | 3300026118 | Bacteria | 10730 |
| 217 | Ga0207675_100017724 | 3300026118 | Bacteria | 6643 |
| 218 | Ga0207683_10019836 | 3300026121 | Bacteria | 5743 |
| 219 | Ga0207683_10242189 | 3300026121 | Bacteria | 1645 |
| 220 | Ga0207683_10348987 | 3300026121 | Bacteria | 1358 |
| 221 | Ga0207698_10056432 | 3300026142 | Bacteria | 3033 |
| 222 | Ga0209982_1035857 | 3300027552 | Bacteria | 786 |
| 223 | Ga0209983_1004609 | 3300027665 | Bacteria | 2892 |
| 224 | Ga0209974_10002749 | 3300027876 | Bacteria | 6378 |
| 225 | Ga0268266_10123913 | 3300028379 | Bacteria | 2303 |
| 226 | Ga0268265_10000031 | 3300028380 | Bacteria | 226725 |
| 227 | Ga0268265_10000176 | 3300028380 | Bacteria | 76619 |
| 228 | Ga0268265_10034646 | 3300028380 | Bacteria | 3682 |
| 229 | Ga0268265_10046966 | 3300028380 | Bacteria | 3231 |
| 230 | Ga0268265_10124239 | 3300028380 | Bacteria | 2132 |
| 231 | Ga0268264_10000548 | 3300028381 | Bacteria | 47198 |
| 232 | Ga0268264_10007610 | 3300028381 | Bacteria | 9032 |
| 233 | Ga0268264_10544296 | 3300028381 | Bacteria | 1138 |
| 234 | Ga0307513_10016067 | 3300031456 | Bacteria | 9045 |
| 235 | Ga0307513_10269738 | 3300031456 | Bacteria | 1486 |
| 236 | Ga0307408_100012826 | 3300031548 | Bacteria | 5558 |
| 237 | Ga0307408_100183350 | 3300031548 | Bacteria | 1680 |
| 238 | Ga0307408_100226301 | 3300031548 | Bacteria | 1529 |
| 239 | Ga0307408_100564376 | 3300031548 | Bacteria | 1006 |
| 240 | Ga0307405_10049288 | 3300031731 | Bacteria | 2602 |
| 241 | Ga0307405_10056175 | 3300031731 | Bacteria | 2468 |
| 242 | Ga0307405_10246984 | 3300031731 | Bacteria | 1325 |
| 243 | Ga0307405_10422265 | 3300031731 | Bacteria | 1050 |
| 244 | Ga0307405_11157019 | 3300031731 | Bacteria | 667 |
| 245 | Ga0307413_10008193 | 3300031824 | Bacteria | 4915 |
| 246 | Ga0307413_10045237 | 3300031824 | Bacteria | 2608 |
| 247 | Ga0307413_10085082 | 3300031824 | Bacteria | 2041 |
| 248 | Ga0307413_10109699 | 3300031824 | Bacteria | 1845 |
| 249 | Ga0307413_10346005 | 3300031824 | Bacteria | 1145 |
| 250 | Ga0307413_10426672 | 3300031824 | Bacteria | 1046 |
| 251 | Ga0307413_10427126 | 3300031824 | Bacteria | 1045 |
| 252 | Ga0307410_10006176 | 3300031852 | Bacteria | 6434 |
| 253 | Ga0307410_10039243 | 3300031852 | Bacteria | 3107 |
| 254 | Ga0307410_10259039 | 3300031852 | Bacteria | 1356 |
| 255 | Ga0307410_10319245 | 3300031852 | Bacteria | 1232 |
| 256 | Ga0307410_10508093 | 3300031852 | Bacteria | 993 |
| 257 | Ga0307406_10061605 | 3300031901 | Bacteria | 2423 |
| 258 | Ga0307406_10356111 | 3300031901 | Bacteria | 1145 |
| 259 | Ga0307407_10019616 | 3300031903 | Bacteria | 3447 |
| 260 | Ga0307407_10026515 | 3300031903 | Bacteria | 3070 |
| 261 | Ga0307407_10287324 | 3300031903 | Bacteria | 1142 |
| 262 | Ga0307412_10005897 | 3300031911 | Bacteria | 6899 |
| 263 | Ga0307412_10021294 | 3300031911 | Bacteria | 3958 |
| 264 | Ga0307412_10040176 | 3300031911 | Bacteria | 3026 |
| 265 | Ga0307412_10148765 | 3300031911 | Bacteria | 1725 |
| 266 | Ga0307412_10510954 | 3300031911 | Bacteria | 1002 |
| 267 | Ga0307409_100005979 | 3300031995 | Bacteria | 7092 |
| 268 | Ga0307409_100022990 | 3300031995 | Bacteria | 4309 |
| 269 | Ga0307409_100028822 | 3300031995 | Bacteria | 3962 |
| 270 | Ga0307409_100060696 | 3300031995 | Bacteria | 2950 |
| 271 | Ga0307409_100120076 | 3300031995 | Bacteria | 2224 |
| 272 | Ga0307409_100193461 | 3300031995 | Bacteria | 1813 |
| 273 | Ga0307409_100245178 | 3300031995 | Bacteria | 1634 |
| 274 | Ga0307409_100422285 | 3300031995 | Bacteria | 1279 |
| 275 | Ga0307416_100010456 | 3300032002 | Bacteria | 6129 |
| 276 | Ga0307416_100020106 | 3300032002 | Bacteria | 4755 |
| 277 | Ga0307416_100045268 | 3300032002 | Bacteria | 3464 |
| 278 | Ga0307416_100047106 | 3300032002 | Bacteria | 3409 |
| 279 | Ga0307416_100136749 | 3300032002 | Bacteria | 2218 |
| 280 | Ga0307416_100219344 | 3300032002 | Bacteria | 1822 |
| 281 | Ga0307416_100265480 | 3300032002 | Bacteria | 1681 |
| 282 | Ga0307416_100512370 | 3300032002 | Bacteria | 1266 |
| 283 | Ga0307416_100848208 | 3300032002 | Bacteria | 1012 |
| 284 | Ga0307416_101175488 | 3300032002 | Bacteria | 872 |
| 285 | Ga0307414_10010008 | 3300032004 | Bacteria | 5477 |
| 286 | Ga0307414_10012904 | 3300032004 | Bacteria | 4959 |
| 287 | Ga0307414_10467267 | 3300032004 | Bacteria | 1110 |
| 288 | Ga0307414_10672670 | 3300032004 | Bacteria | 935 |
| 289 | Ga0307411_10006291 | 3300032005 | Bacteria | 5927 |
| 290 | Ga0307411_10015969 | 3300032005 | Bacteria | 4237 |
| 291 | Ga0307411_10016001 | 3300032005 | Bacteria | 4234 |
| 292 | Ga0307411_10020032 | 3300032005 | Bacteria | 3881 |
| 293 | Ga0307411_10024467 | 3300032005 | Bacteria | 3600 |
| 294 | Ga0307411_10087285 | 3300032005 | Bacteria | 2166 |
| 295 | Ga0307411_10290037 | 3300032005 | Bacteria | 1307 |
| 296 | Ga0307411_10619979 | 3300032005 | Bacteria | 932 |
| 297 | Ga0307411_10998202 | 3300032005 | Bacteria | 749 |
| 298 | Ga0307411_11000651 | 3300032005 | Bacteria | 748 |
| 299 | Ga0307415_100004398 | 3300032126 | Bacteria | 7305 |
| 300 | Ga0307415_100018828 | 3300032126 | Bacteria | 4180 |
| 301 | Ga0307415_100047202 | 3300032126 | Bacteria | 2898 |
| 302 | Ga0307415_100047481 | 3300032126 | Bacteria | 2890 |
| 303 | Ga0307415_100084281 | 3300032126 | Bacteria | 2280 |
| 304 | Ga0307415_100208577 | 3300032126 | Bacteria | 1557 |
| 305 | Ga0307415_100434101 | 3300032126 | Bacteria | 1131 |
| 306 | Ga0307510_10083889 | 3300033180 | Bacteria | 3073 |
| 307 | Ga0395899_0296532 | 3300037312 | Bacteria | 1095 |
| 308 | Ga0395900_0452757 | 3300037418 | Bacteria | 1239 |
| 309 | Ga0395900_0524162 | 3300037418 | Bacteria | 1132 |
| 310 | Ga0395898_0402879 | 3300037466 | Bacteria | 1304 |
| 311 | Ga0395905_0118198 | 3300037471 | Bacteria | 2492 |
| 312 | Ga0395901_0140619 | 3300038443 | Bacteria | 2537 |
| 313 | Ga0436365_0010969 | 3300039437 | Bacteria | 175809 |
| 314 | Ga0436365_1858586 | 3300039437 | Bacteria | 166193 |
| 315 | Ga0436362_1035670 | 3300039453 | Bacteria | 125910 |
| 316 | Ga0439439_0177145 | 3300041406 | Bacteria | 613 |
| 317 | Ga0439449_0060849 | 3300042007 | Bacteria | 1393 |
| 318 | Ga0439464_0046531 | 3300042439 | Bacteria | 1247 |
| 319 | Ga0451576_0020748 | 3300045051 | Bacteria | 7151 |
| 320 | Ga0495597_0075966 | 3300046542 | Bacteria | 1441 |
| 321 | Ga0495633_0250321 | 3300046558 | Bacteria | 808 |
| 322 | Ga0495668_0125060 | 3300046616 | Bacteria | 1407 |
| 323 | Ga0495668_0257096 | 3300046616 | Bacteria | 956 |
| 324 | Ga0495625_0000332 | 3300046660 | Bacteria | 71947 |
| 325 | Ga0495625_0005843 | 3300046660 | Bacteria | 11094 |
| 326 | Ga0495625_0330813 | 3300046660 | Bacteria | 968 |
| 327 | Ga0495659_0083459 | 3300046664 | Bacteria | 1216 |
| 328 | Ga0495677_0023470 | 3300047445 | Bacteria | 2239 |
| 329 | Ga0495685_074143 | 3300047447 | Bacteria | 1138 |
| 330 | Ga0496100_0011427 | 3300048903 | Bacteria | 5053 |
| 331 | Ga0496101_0018098 | 3300048904 | Bacteria | 4784 |
| 332 | Ga0496101_0564616 | 3300048904 | Bacteria | 900 |
| 333 | Ga0496102_0000036 | 3300048905 | Bacteria | 201896 |
| 334 | Ga0496103_0000120 | 3300048906 | Bacteria | 85481 |
| 335 | Ga0496107_0026565 | 3300048910 | Bacteria | 4105 |
| 336 | Ga0496108_0003313 | 3300048911 | Bacteria | 12943 |
| 337 | Ga0496110_0035000 | 3300048913 | Bacteria | 4354 |
| 338 | Ga0496112_0256355 | 3300048915 | Bacteria | 1699 |
| 339 | Ga0496114_0017208 | 3300048917 | Bacteria | 5831 |
| 340 | Ga0496114_0025387 | 3300048917 | Bacteria | 4842 |
| 341 | Ga0496115_0036347 | 3300048918 | Bacteria | 3899 |
| 342 | Ga0496116_0002277 | 3300048919 | Bacteria | 20365 |
| 343 | Ga0496117_0000093 | 3300048920 | Bacteria | 201862 |
| 344 | Ga0496118_0000070 | 3300048921 | Bacteria | 201866 |
| 345 | Ga0496119_0075454 | 3300048922 | Bacteria | 1960 |
| 346 | Ga0496124_0000302 | 3300048927 | Bacteria | 91124 |
| 347 | Ga0496125_0134938 | 3300048928 | Bacteria | 1728 |
| 348 | Ga0501202_052270 | 3300049652 | Bacteria | 907 |
| 349 | Ga0501217_024251 | 3300049661 | Bacteria | 1450 |
| 350 | Ga0501233_021304 | 3300049668 | Bacteria | 1390 |
| 351 | Ga0501249_010157 | 3300049679 | Bacteria | 1965 |
| 352 | Ga0501249_023216 | 3300049679 | Bacteria | 1361 |
| 353 | Ga0501263_012155 | 3300049760 | Bacteria | 1077 |
| 354 | Ga0501268_019677 | 3300049765 | Bacteria | 1145 |
| 355 | Ga0501270_025924 | 3300049767 | Bacteria | 932 |
| 356 | Ga0501273_026821 | 3300049770 | Bacteria | 805 |
| 357 | nmdc:mga0k408_67326_c2 | 3300050493 | Bacteria | 1788 |
| 358 | Ga0500643_002412 | 3300053087 | Bacteria | 9688 |
| 359 | Ga0500643_013234 | 3300053087 | Bacteria | 2921 |
| 360 | Ga0500583_0208456 | 3300053092 | Bacteria | 971 |
| 361 | Ga0500562_058796 | 3300053108 | Bacteria | 1032 |
| 362 | Ga0500592_011628 | 3300053116 | Bacteria | 1408 |
| 363 | Ga0500597_044887 | 3300053120 | Bacteria | 1868 |
| 364 | Ga0500624_000257 | 3300053157 | Bacteria | 18682 |
| 365 | Ga0500637_0000023 | 3300053178 | Bacteria | 61044 |
| 366 | Ga0500637_0004105 | 3300053178 | Bacteria | 6851 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006195 | Ga0075366_10074941 | Ga0075366_100749412 | 163 |
| 2 | 3300050493 | nmdc:mga0k408_67326_c2 | nmdc:mga0k408_67326_c2_274_873 | 163 |
| 3 | 3300053087 | Ga0500643_002412 | Ga0500643_002412_6388_6954 | 163 |
| 4 | 3300046616 | Ga0495668_0125060 | Ga0495668_0125060_110_670 | 165 |
| 5 | 3300046660 | Ga0495625_0005843 | Ga0495625_0005843_5117_5677 | 165 |
| 6 | 3300047445 | Ga0495677_0023470 | Ga0495677_0023470_55_615 | 165 |
| 7 | 3300053178 | Ga0500637_0004105 | Ga0500637_0004105_49_603 | 165 |
| 8 | 3300045051 | Ga0451576_0020748 | Ga0451576_0020748_3271_3855 | 167 |
| 9 | 3300048928 | Ga0496125_0134938 | Ga0496125_0134938_895_1461 | 168 |
| 10 | 3300053087 | Ga0500643_013234 | Ga0500643_013234_1192_1758 | 170 |
| 11 | 3300053120 | Ga0500597_044887 | Ga0500597_044887_1185_1754 | 170 |
| 12 | 3300053157 | Ga0500624_000257 | Ga0500624_000257_14735_15304 | 170 |
| 13 | 3300053178 | Ga0500637_0000023 | Ga0500637_0000023_45684_46253 | 170 |
| 14 | 3300002076 | JGI24749J21850_1000020 | JGI24749J21850_100002027 | 171 |
| 15 | 3300002459 | JGI24751J29686_10000177 | JGI24751J29686_1000017727 | 171 |
| 16 | 3300005295 | Ga0065707_10100721 | Ga0065707_101007213 | 171 |
| 17 | 3300005331 | Ga0070670_100000008 | Ga0070670_10000000861 | 171 |
| 18 | 3300005347 | Ga0070668_100142907 | Ga0070668_1001429073 | 171 |
| 19 | 3300005353 | Ga0070669_100000240 | Ga0070669_10000024035 | 171 |
| 20 | 3300005367 | Ga0070667_100024780 | Ga0070667_1000247805 | 171 |
| 21 | 3300005617 | Ga0068859_100007209 | Ga0068859_1000072093 | 171 |
| 22 | 3300005618 | Ga0068864_100000027 | Ga0068864_10000002739 | 171 |
| 23 | 3300005719 | Ga0068861_100042697 | Ga0068861_1000426971 | 171 |
| 24 | 3300005844 | Ga0068862_100000143 | Ga0068862_10000014337 | 171 |
| 25 | 3300006931 | Ga0097620_100007208 | Ga0097620_10000720810 | 171 |
| 26 | 3300009177 | Ga0105248_10000156 | Ga0105248_1000015659 | 171 |
| 27 | 3300013306 | Ga0163162_10581957 | Ga0163162_105819572 | 171 |
| 28 | 3300014326 | Ga0157380_10000416 | Ga0157380_1000041613 | 171 |
| 29 | 3300017792 | Ga0163161_10337600 | Ga0163161_103376002 | 171 |
| 30 | 3300025923 | Ga0207681_10000022 | Ga0207681_1000002240 | 171 |
| 31 | 3300025925 | Ga0207650_10000019 | Ga0207650_10000019270 | 171 |
| 32 | 3300025925 | Ga0207650_10000020 | Ga0207650_10000020263 | 171 |
| 33 | 3300025941 | Ga0207711_10003462 | Ga0207711_100034626 | 171 |
| 34 | 3300025961 | Ga0207712_10532788 | Ga0207712_105327881 | 171 |
| 35 | 3300025972 | Ga0207668_10131855 | Ga0207668_101318553 | 171 |
| 36 | 3300025986 | Ga0207658_10002545 | Ga0207658_1000254514 | 171 |
| 37 | 3300026095 | Ga0207676_10000022 | Ga0207676_10000022214 | 171 |
| 38 | 3300026118 | Ga0207675_100017724 | Ga0207675_1000177247 | 171 |
| 39 | 3300028380 | Ga0268265_10000031 | Ga0268265_1000003166 | 171 |
| 40 | 3300037312 | Ga0395899_0296532 | Ga0395899_0296532_454_1026 | 171 |
| 41 | 3300037418 | Ga0395900_0452757 | Ga0395900_0452757_521_1093 | 171 |
| 42 | 3300037466 | Ga0395898_0402879 | Ga0395898_0402879_136_708 | 171 |
| 43 | 3300037471 | Ga0395905_0118198 | Ga0395905_0118198_873_1445 | 171 |
| 44 | 3300005295 | Ga0065707_10230567 | Ga0065707_102305672 | 172 |
| 45 | 3300005617 | Ga0068859_100233491 | Ga0068859_1002334911 | 172 |
| 46 | 3300005841 | Ga0068863_100011484 | Ga0068863_1000114849 | 172 |
| 47 | 3300005843 | Ga0068860_100007912 | Ga0068860_1000079125 | 172 |
| 48 | 3300005844 | Ga0068862_100000014 | Ga0068862_10000001444 | 172 |
| 49 | 3300006931 | Ga0097620_100233493 | Ga0097620_1002334934 | 172 |
| 50 | 3300009101 | Ga0105247_10001608 | Ga0105247_1000160810 | 172 |
| 51 | 3300009553 | Ga0105249_10000002 | Ga0105249_10000002356 | 172 |
| 52 | 3300025900 | Ga0207710_10002422 | Ga0207710_100024224 | 172 |
| 53 | 3300025961 | Ga0207712_10000002 | Ga0207712_10000002727 | 172 |
| 54 | 3300026088 | Ga0207641_10004570 | Ga0207641_100045706 | 172 |
| 55 | 3300028380 | Ga0268265_10000176 | Ga0268265_1000017645 | 172 |
| 56 | 3300028381 | Ga0268264_10000548 | Ga0268264_100005489 | 172 |
| 57 | 3300031456 | Ga0307513_10016067 | Ga0307513_100160677 | 172 |
| 58 | 3300048905 | Ga0496102_0000036 | Ga0496102_0000036_166173_166739 | 172 |
| 59 | 3300048906 | Ga0496103_0000120 | Ga0496103_0000120_49758_50324 | 172 |
| 60 | 3300048919 | Ga0496116_0002277 | Ga0496116_0002277_3676_4242 | 172 |
| 61 | 3300048920 | Ga0496117_0000093 | Ga0496117_0000093_166139_166705 | 172 |
| 62 | 3300048921 | Ga0496118_0000070 | Ga0496118_0000070_166143_166709 | 172 |
| 63 | 3300048922 | Ga0496119_0075454 | Ga0496119_0075454_924_1490 | 172 |
| 64 | 3300048927 | Ga0496124_0000302 | Ga0496124_0000302_35158_35724 | 172 |
| 65 | 3300026121 | Ga0207683_10242189 | Ga0207683_102421892 | 173 |
| 66 | 3300031548 | Ga0307408_100012826 | Ga0307408_1000128264 | 173 |
| 67 | 3300031901 | Ga0307406_10061605 | Ga0307406_100616054 | 173 |
| 68 | 3300031911 | Ga0307412_10005897 | Ga0307412_100058974 | 173 |
| 69 | 3300031995 | Ga0307409_100120076 | Ga0307409_1001200762 | 173 |
| 70 | 3300032002 | Ga0307416_100010456 | Ga0307416_1000104567 | 173 |
| 71 | 3300032005 | Ga0307411_10006291 | Ga0307411_100062914 | 173 |
| 72 | 3300042007 | Ga0439449_0060849 | Ga0439449_0060849_241_801 | 173 |
| 73 | 3300005440 | Ga0070705_100068209 | Ga0070705_1000682094 | 174 |
| 74 | 3300009545 | Ga0105237_10113130 | Ga0105237_101131302 | 174 |
| 75 | 3300025914 | Ga0207671_10244459 | Ga0207671_102444592 | 174 |
| 76 | 3300005355 | Ga0070671_100719236 | Ga0070671_1007192361 | 175 |
| 77 | 3300005330 | Ga0070690_100082644 | Ga0070690_1000826443 | 176 |
| 78 | 3300005331 | Ga0070670_100002664 | Ga0070670_1000026643 | 176 |
| 79 | 3300005335 | Ga0070666_10001162 | Ga0070666_1000116211 | 176 |
| 80 | 3300005344 | Ga0070661_100033121 | Ga0070661_1000331216 | 176 |
| 81 | 3300005347 | Ga0070668_100084892 | Ga0070668_1000848922 | 176 |
| 82 | 3300005347 | Ga0070668_100455484 | Ga0070668_1004554842 | 176 |
| 83 | 3300005353 | Ga0070669_100106335 | Ga0070669_1001063352 | 176 |
| 84 | 3300005354 | Ga0070675_100040705 | Ga0070675_1000407053 | 176 |
| 85 | 3300005355 | Ga0070671_100031747 | Ga0070671_1000317474 | 176 |
| 86 | 3300005355 | Ga0070671_100035745 | Ga0070671_1000357451 | 176 |
| 87 | 3300005355 | Ga0070671_100066772 | Ga0070671_1000667722 | 176 |
| 88 | 3300005364 | Ga0070673_100000428 | Ga0070673_10000042823 | 176 |
| 89 | 3300005367 | Ga0070667_100006507 | Ga0070667_10000650716 | 176 |
| 90 | 3300005367 | Ga0070667_100008815 | Ga0070667_1000088153 | 176 |
| 91 | 3300005456 | Ga0070678_100001331 | Ga0070678_10000133117 | 176 |
| 92 | 3300005457 | Ga0070662_100000663 | Ga0070662_10000066323 | 176 |
| 93 | 3300005543 | Ga0070672_100121902 | Ga0070672_1001219022 | 176 |
| 94 | 3300005548 | Ga0070665_100071879 | Ga0070665_1000718793 | 176 |
| 95 | 3300005564 | Ga0070664_100071235 | Ga0070664_1000712352 | 176 |
| 96 | 3300005614 | Ga0068856_100243231 | Ga0068856_1002432312 | 176 |
| 97 | 3300005616 | Ga0068852_100028465 | Ga0068852_1000284654 | 176 |
| 98 | 3300005617 | Ga0068859_100013083 | Ga0068859_1000130838 | 176 |
| 99 | 3300005617 | Ga0068859_100242668 | Ga0068859_1002426682 | 176 |
| 100 | 3300005618 | Ga0068864_100000773 | Ga0068864_10000077322 | 176 |
| 101 | 3300005618 | Ga0068864_100025420 | Ga0068864_1000254203 | 176 |
| 102 | 3300005841 | Ga0068863_100005259 | Ga0068863_10000525914 | 176 |
| 103 | 3300005842 | Ga0068858_100001877 | Ga0068858_10000187714 | 176 |
| 104 | 3300005842 | Ga0068858_100006666 | Ga0068858_1000066666 | 176 |
| 105 | 3300005843 | Ga0068860_100012480 | Ga0068860_1000124808 | 176 |
| 106 | 3300005844 | Ga0068862_100064938 | Ga0068862_1000649384 | 176 |
| 107 | 3300005844 | Ga0068862_100222252 | Ga0068862_1002222522 | 176 |
| 108 | 3300006237 | Ga0097621_100013435 | Ga0097621_1000134357 | 176 |
| 109 | 3300006358 | Ga0068871_100053270 | Ga0068871_1000532704 | 176 |
| 110 | 3300006931 | Ga0097620_100013082 | Ga0097620_1000130828 | 176 |
| 111 | 3300006931 | Ga0097620_100242660 | Ga0097620_1002426602 | 176 |
| 112 | 3300009177 | Ga0105248_10004603 | Ga0105248_1000460311 | 176 |
| 113 | 3300009177 | Ga0105248_10007268 | Ga0105248_100072687 | 176 |
| 114 | 3300013102 | Ga0157371_10128265 | Ga0157371_101282652 | 176 |
| 115 | 3300013296 | Ga0157374_10005548 | Ga0157374_100055481 | 176 |
| 116 | 3300013306 | Ga0163162_10007095 | Ga0163162_1000709516 | 176 |
| 117 | 3300013308 | Ga0157375_10005314 | Ga0157375_100053149 | 176 |
| 118 | 3300014325 | Ga0163163_10011326 | Ga0163163_1001132615 | 176 |
| 119 | 3300014326 | Ga0157380_10032729 | Ga0157380_100327295 | 176 |
| 120 | 3300025711 | Ga0207696_1049740 | Ga0207696_10497402 | 176 |
| 121 | 3300025900 | Ga0207710_10102477 | Ga0207710_101024772 | 176 |
| 122 | 3300025901 | Ga0207688_10246200 | Ga0207688_102462001 | 176 |
| 123 | 3300025923 | Ga0207681_10072234 | Ga0207681_100722342 | 176 |
| 124 | 3300025925 | Ga0207650_10097298 | Ga0207650_100972983 | 176 |
| 125 | 3300025931 | Ga0207644_10060220 | Ga0207644_100602203 | 176 |
| 126 | 3300025931 | Ga0207644_10093670 | Ga0207644_100936702 | 176 |
| 127 | 3300025933 | Ga0207706_10004830 | Ga0207706_100048307 | 176 |
| 128 | 3300025940 | Ga0207691_10011199 | Ga0207691_100111993 | 176 |
| 129 | 3300025940 | Ga0207691_10160669 | Ga0207691_101606692 | 176 |
| 130 | 3300025941 | Ga0207711_10001615 | Ga0207711_100016152 | 176 |
| 131 | 3300025941 | Ga0207711_10006884 | Ga0207711_1000688416 | 176 |
| 132 | 3300025945 | Ga0207679_10101212 | Ga0207679_101012121 | 176 |
| 133 | 3300025960 | Ga0207651_10009088 | Ga0207651_100090888 | 176 |
| 134 | 3300025960 | Ga0207651_10025291 | Ga0207651_100252912 | 176 |
| 135 | 3300025972 | Ga0207668_10101875 | Ga0207668_101018752 | 176 |
| 136 | 3300025986 | Ga0207658_10004415 | Ga0207658_100044156 | 176 |
| 137 | 3300026035 | Ga0207703_10007646 | Ga0207703_100076467 | 176 |
| 138 | 3300026035 | Ga0207703_10031128 | Ga0207703_100311281 | 176 |
| 139 | 3300026088 | Ga0207641_10000659 | Ga0207641_1000065910 | 176 |
| 140 | 3300026088 | Ga0207641_10028171 | Ga0207641_100281712 | 176 |
| 141 | 3300026089 | Ga0207648_10131645 | Ga0207648_101316452 | 176 |
| 142 | 3300026095 | Ga0207676_10000975 | Ga0207676_1000097522 | 176 |
| 143 | 3300026095 | Ga0207676_10010875 | Ga0207676_100108759 | 176 |
| 144 | 3300026116 | Ga0207674_10197305 | Ga0207674_101973053 | 176 |
| 145 | 3300026142 | Ga0207698_10056432 | Ga0207698_100564324 | 176 |
| 146 | 3300028379 | Ga0268266_10123913 | Ga0268266_101239133 | 176 |
| 147 | 3300028380 | Ga0268265_10034646 | Ga0268265_100346464 | 176 |
| 148 | 3300028380 | Ga0268265_10046966 | Ga0268265_100469662 | 176 |
| 149 | 3300028380 | Ga0268265_10124239 | Ga0268265_101242393 | 176 |
| 150 | 3300028381 | Ga0268264_10007610 | Ga0268264_100076102 | 176 |
| 151 | 3300028381 | Ga0268264_10544296 | Ga0268264_105442962 | 176 |
| 152 | 3300031456 | Ga0307513_10269738 | Ga0307513_102697382 | 176 |
| 153 | 3300031824 | Ga0307413_10085082 | Ga0307413_100850821 | 176 |
| 154 | 3300031901 | Ga0307406_10356111 | Ga0307406_103561112 | 176 |
| 155 | 3300031995 | Ga0307409_100060696 | Ga0307409_1000606962 | 176 |
| 156 | 3300031995 | Ga0307409_100245178 | Ga0307409_1002451782 | 176 |
| 157 | 3300032002 | Ga0307416_101175488 | Ga0307416_1011754881 | 176 |
| 158 | 3300032005 | Ga0307411_10020032 | Ga0307411_100200321 | 176 |
| 159 | 3300032126 | Ga0307415_100004398 | Ga0307415_1000043986 | 176 |
| 160 | 3300032126 | Ga0307415_100047481 | Ga0307415_1000474813 | 176 |
| 161 | 3300032126 | Ga0307415_100084281 | Ga0307415_1000842813 | 176 |
| 162 | 3300032126 | Ga0307415_100208577 | Ga0307415_1002085772 | 176 |
| 163 | 3300037418 | Ga0395900_0524162 | Ga0395900_0524162_409_981 | 176 |
| 164 | 3300038443 | Ga0395901_0140619 | Ga0395901_0140619_1110_1682 | 176 |
| 165 | 3300048903 | Ga0496100_0011427 | Ga0496100_0011427_1008_1595 | 176 |
| 166 | 3300048904 | Ga0496101_0018098 | Ga0496101_0018098_2931_3518 | 176 |
| 167 | 3300048910 | Ga0496107_0026565 | Ga0496107_0026565_935_1522 | 176 |
| 168 | 3300048911 | Ga0496108_0003313 | Ga0496108_0003313_4644_5216 | 176 |
| 169 | 3300048915 | Ga0496112_0256355 | Ga0496112_0256355_981_1553 | 176 |
| 170 | 3300048917 | Ga0496114_0025387 | Ga0496114_0025387_1675_2262 | 176 |
| 171 | 3300048918 | Ga0496115_0036347 | Ga0496115_0036347_251_838 | 176 |
| 172 | 3300049652 | Ga0501202_052270 | Ga0501202_052270_120_737 | 176 |
| 173 | 3300049661 | Ga0501217_024251 | Ga0501217_024251_444_1061 | 176 |
| 174 | 3300049679 | Ga0501249_023216 | Ga0501249_023216_381_953 | 176 |
| 175 | 3300049760 | Ga0501263_012155 | Ga0501263_012155_120_737 | 176 |
| 176 | 3300049765 | Ga0501268_019677 | Ga0501268_019677_159_731 | 176 |
| 177 | 3300049767 | Ga0501270_025924 | Ga0501270_025924_37_654 | 176 |
| 178 | 3300049770 | Ga0501273_026821 | Ga0501273_026821_51_668 | 176 |
| 179 | 3300001977 | JGI24746J21847_1007014 | JGI24746J21847_10070142 | 177 |
| 180 | 3300002076 | JGI24749J21850_1003945 | JGI24749J21850_10039452 | 177 |
| 181 | 3300002459 | JGI24751J29686_10013044 | JGI24751J29686_100130441 | 177 |
| 182 | 3300002459 | JGI24751J29686_10019850 | JGI24751J29686_100198502 | 177 |
| 183 | 3300005290 | Ga0065712_10518209 | Ga0065712_105182091 | 177 |
| 184 | 3300005293 | Ga0065715_10034224 | Ga0065715_100342242 | 177 |
| 185 | 3300005327 | Ga0070658_10000001 | Ga0070658_1000000197 | 177 |
| 186 | 3300005328 | Ga0070676_10054542 | Ga0070676_100545423 | 177 |
| 187 | 3300005331 | Ga0070670_100011203 | Ga0070670_1000112034 | 177 |
| 188 | 3300005333 | Ga0070677_10000559 | Ga0070677_1000055911 | 177 |
| 189 | 3300005333 | Ga0070677_10001594 | Ga0070677_100015943 | 177 |
| 190 | 3300005339 | Ga0070660_100000362 | Ga0070660_1000003629 | 177 |
| 191 | 3300005344 | Ga0070661_100859825 | Ga0070661_1008598251 | 177 |
| 192 | 3300005345 | Ga0070692_10000109 | Ga0070692_100001097 | 177 |
| 193 | 3300005345 | Ga0070692_10381253 | Ga0070692_103812532 | 177 |
| 194 | 3300005347 | Ga0070668_100051510 | Ga0070668_1000515102 | 177 |
| 195 | 3300005353 | Ga0070669_100043886 | Ga0070669_1000438863 | 177 |
| 196 | 3300005353 | Ga0070669_100132466 | Ga0070669_1001324661 | 177 |
| 197 | 3300005353 | Ga0070669_100386014 | Ga0070669_1003860142 | 177 |
| 198 | 3300005354 | Ga0070675_100005534 | Ga0070675_10000553416 | 177 |
| 199 | 3300005364 | Ga0070673_100007906 | Ga0070673_1000079064 | 177 |
| 200 | 3300005366 | Ga0070659_100007247 | Ga0070659_1000072472 | 177 |
| 201 | 3300005366 | Ga0070659_100526543 | Ga0070659_1005265432 | 177 |
| 202 | 3300005367 | Ga0070667_100007799 | Ga0070667_1000077993 | 177 |
| 203 | 3300005438 | Ga0070701_10098188 | Ga0070701_100981883 | 177 |
| 204 | 3300005455 | Ga0070663_100080728 | Ga0070663_1000807283 | 177 |
| 205 | 3300005456 | Ga0070678_100290808 | Ga0070678_1002908082 | 177 |
| 206 | 3300005457 | Ga0070662_100054296 | Ga0070662_1000542963 | 177 |
| 207 | 3300005459 | Ga0068867_100575591 | Ga0068867_1005755911 | 177 |
| 208 | 3300005539 | Ga0068853_100002896 | Ga0068853_1000028969 | 177 |
| 209 | 3300005543 | Ga0070672_100010331 | Ga0070672_1000103313 | 177 |
| 210 | 3300005577 | Ga0068857_100081151 | Ga0068857_1000811512 | 177 |
| 211 | 3300005577 | Ga0068857_100087141 | Ga0068857_1000871412 | 177 |
| 212 | 3300005617 | Ga0068859_100096889 | Ga0068859_1000968894 | 177 |
| 213 | 3300005618 | Ga0068864_100128234 | Ga0068864_1001282341 | 177 |
| 214 | 3300005618 | Ga0068864_100542762 | Ga0068864_1005427621 | 177 |
| 215 | 3300005618 | Ga0068864_100547688 | Ga0068864_1005476882 | 177 |
| 216 | 3300005718 | Ga0068866_10720806 | Ga0068866_107208062 | 177 |
| 217 | 3300005719 | Ga0068861_100062401 | Ga0068861_1000624013 | 177 |
| 218 | 3300005834 | Ga0068851_10241896 | Ga0068851_102418962 | 177 |
| 219 | 3300005840 | Ga0068870_10135302 | Ga0068870_101353022 | 177 |
| 220 | 3300005842 | Ga0068858_100389940 | Ga0068858_1003899402 | 177 |
| 221 | 3300005844 | Ga0068862_100331441 | Ga0068862_1003314411 | 177 |
| 222 | 3300006881 | Ga0068865_100113827 | Ga0068865_1001138273 | 177 |
| 223 | 3300006931 | Ga0097620_100096892 | Ga0097620_1000968922 | 177 |
| 224 | 3300009093 | Ga0105240_10207214 | Ga0105240_102072142 | 177 |
| 225 | 3300009148 | Ga0105243_10091117 | Ga0105243_100911172 | 177 |
| 226 | 3300009176 | Ga0105242_10791674 | Ga0105242_107916741 | 177 |
| 227 | 3300009177 | Ga0105248_10070066 | Ga0105248_100700663 | 177 |
| 228 | 3300009177 | Ga0105248_10812550 | Ga0105248_108125501 | 177 |
| 229 | 3300009551 | Ga0105238_10254491 | Ga0105238_102544913 | 177 |
| 230 | 3300009553 | Ga0105249_10009121 | Ga0105249_100091212 | 177 |
| 231 | 3300009553 | Ga0105249_10191647 | Ga0105249_101916473 | 177 |
| 232 | 3300013100 | Ga0157373_10198853 | Ga0157373_101988532 | 177 |
| 233 | 3300013104 | Ga0157370_10316070 | Ga0157370_103160702 | 177 |
| 234 | 3300013105 | Ga0157369_10000412 | Ga0157369_1000041261 | 177 |
| 235 | 3300013105 | Ga0157369_10158145 | Ga0157369_101581452 | 177 |
| 236 | 3300013306 | Ga0163162_10036415 | Ga0163162_100364152 | 177 |
| 237 | 3300013306 | Ga0163162_10048710 | Ga0163162_100487104 | 177 |
| 238 | 3300013307 | Ga0157372_10683143 | Ga0157372_106831432 | 177 |
| 239 | 3300013308 | Ga0157375_10001588 | Ga0157375_100015888 | 177 |
| 240 | 3300013308 | Ga0157375_10426749 | Ga0157375_104267492 | 177 |
| 241 | 3300014325 | Ga0163163_10173343 | Ga0163163_101733431 | 177 |
| 242 | 3300014325 | Ga0163163_11036801 | Ga0163163_110368012 | 177 |
| 243 | 3300014326 | Ga0157380_10014156 | Ga0157380_100141564 | 177 |
| 244 | 3300014326 | Ga0157380_10782261 | Ga0157380_107822611 | 177 |
| 245 | 3300017792 | Ga0163161_10025240 | Ga0163161_100252405 | 177 |
| 246 | 3300021358 | Ga0213873_10000008 | Ga0213873_10000008197 | 177 |
| 247 | 3300021384 | Ga0213876_10000005 | Ga0213876_10000005406 | 177 |
| 248 | 3300021384 | Ga0213876_10000120 | Ga0213876_1000012074 | 177 |
| 249 | 3300021384 | Ga0213876_10020039 | Ga0213876_100200394 | 177 |
| 250 | 3300025315 | Ga0207697_10004971 | Ga0207697_100049717 | 177 |
| 251 | 3300025321 | Ga0207656_10214057 | Ga0207656_102140571 | 177 |
| 252 | 3300025893 | Ga0207682_10000576 | Ga0207682_100005765 | 177 |
| 253 | 3300025893 | Ga0207682_10002227 | Ga0207682_100022273 | 177 |
| 254 | 3300025907 | Ga0207645_10062165 | Ga0207645_100621652 | 177 |
| 255 | 3300025908 | Ga0207643_10065468 | Ga0207643_100654683 | 177 |
| 256 | 3300025909 | Ga0207705_10000002 | Ga0207705_100000021782 | 177 |
| 257 | 3300025919 | Ga0207657_10000084 | Ga0207657_100000842 | 177 |
| 258 | 3300025919 | Ga0207657_10026027 | Ga0207657_100260272 | 177 |
| 259 | 3300025923 | Ga0207681_10001934 | Ga0207681_1000193415 | 177 |
| 260 | 3300025923 | Ga0207681_10356867 | Ga0207681_103568672 | 177 |
| 261 | 3300025925 | Ga0207650_10007152 | Ga0207650_100071528 | 177 |
| 262 | 3300025925 | Ga0207650_10019611 | Ga0207650_100196113 | 177 |
| 263 | 3300025926 | Ga0207659_10001721 | Ga0207659_100017218 | 177 |
| 264 | 3300025932 | Ga0207690_10003423 | Ga0207690_100034239 | 177 |
| 265 | 3300025932 | Ga0207690_10667300 | Ga0207690_106673002 | 177 |
| 266 | 3300025933 | Ga0207706_10000187 | Ga0207706_1000018757 | 177 |
| 267 | 3300025937 | Ga0207669_10098652 | Ga0207669_100986521 | 177 |
| 268 | 3300025938 | Ga0207704_10428205 | Ga0207704_104282052 | 177 |
| 269 | 3300025941 | Ga0207711_10210724 | Ga0207711_102107242 | 177 |
| 270 | 3300025949 | Ga0207667_10191589 | Ga0207667_101915892 | 177 |
| 271 | 3300025972 | Ga0207668_10004109 | Ga0207668_100041093 | 177 |
| 272 | 3300025981 | Ga0207640_10464037 | Ga0207640_104640372 | 177 |
| 273 | 3300025986 | Ga0207658_10069373 | Ga0207658_100693733 | 177 |
| 274 | 3300025986 | Ga0207658_10186760 | Ga0207658_101867603 | 177 |
| 275 | 3300026041 | Ga0207639_10003166 | Ga0207639_1000316617 | 177 |
| 276 | 3300026067 | Ga0207678_10022045 | Ga0207678_100220452 | 177 |
| 277 | 3300026089 | Ga0207648_10661010 | Ga0207648_106610101 | 177 |
| 278 | 3300026095 | Ga0207676_10481489 | Ga0207676_104814892 | 177 |
| 279 | 3300026116 | Ga0207674_10007205 | Ga0207674_100072056 | 177 |
| 280 | 3300026116 | Ga0207674_10142334 | Ga0207674_101423342 | 177 |
| 281 | 3300026118 | Ga0207675_100006920 | Ga0207675_10000692013 | 177 |
| 282 | 3300026121 | Ga0207683_10019836 | Ga0207683_100198362 | 177 |
| 283 | 3300027552 | Ga0209982_1035857 | Ga0209982_10358571 | 177 |
| 284 | 3300027665 | Ga0209983_1004609 | Ga0209983_10046092 | 177 |
| 285 | 3300027876 | Ga0209974_10002749 | Ga0209974_100027495 | 177 |
| 286 | 3300031548 | Ga0307408_100183350 | Ga0307408_1001833502 | 177 |
| 287 | 3300031548 | Ga0307408_100226301 | Ga0307408_1002263012 | 177 |
| 288 | 3300031548 | Ga0307408_100564376 | Ga0307408_1005643762 | 177 |
| 289 | 3300031731 | Ga0307405_10049288 | Ga0307405_100492883 | 177 |
| 290 | 3300031731 | Ga0307405_10056175 | Ga0307405_100561753 | 177 |
| 291 | 3300031731 | Ga0307405_10246984 | Ga0307405_102469841 | 177 |
| 292 | 3300031731 | Ga0307405_10422265 | Ga0307405_104222651 | 177 |
| 293 | 3300031731 | Ga0307405_11157019 | Ga0307405_111570191 | 177 |
| 294 | 3300031824 | Ga0307413_10008193 | Ga0307413_100081934 | 177 |
| 295 | 3300031824 | Ga0307413_10045237 | Ga0307413_100452373 | 177 |
| 296 | 3300031824 | Ga0307413_10109699 | Ga0307413_101096992 | 177 |
| 297 | 3300031824 | Ga0307413_10346005 | Ga0307413_103460051 | 177 |
| 298 | 3300031824 | Ga0307413_10426672 | Ga0307413_104266722 | 177 |
| 299 | 3300031824 | Ga0307413_10427126 | Ga0307413_104271261 | 177 |
| 300 | 3300031852 | Ga0307410_10006176 | Ga0307410_1000617613 | 177 |
| 301 | 3300031852 | Ga0307410_10039243 | Ga0307410_100392434 | 177 |
| 302 | 3300031852 | Ga0307410_10259039 | Ga0307410_102590392 | 177 |
| 303 | 3300031852 | Ga0307410_10319245 | Ga0307410_103192452 | 177 |
| 304 | 3300031852 | Ga0307410_10508093 | Ga0307410_105080931 | 177 |
| 305 | 3300031903 | Ga0307407_10019616 | Ga0307407_100196162 | 177 |
| 306 | 3300031903 | Ga0307407_10026515 | Ga0307407_100265153 | 177 |
| 307 | 3300031903 | Ga0307407_10287324 | Ga0307407_102873242 | 177 |
| 308 | 3300031911 | Ga0307412_10021294 | Ga0307412_100212942 | 177 |
| 309 | 3300031911 | Ga0307412_10040176 | Ga0307412_100401764 | 177 |
| 310 | 3300031911 | Ga0307412_10148765 | Ga0307412_101487653 | 177 |
| 311 | 3300031911 | Ga0307412_10510954 | Ga0307412_105109542 | 177 |
| 312 | 3300031995 | Ga0307409_100005979 | Ga0307409_1000059792 | 177 |
| 313 | 3300031995 | Ga0307409_100022990 | Ga0307409_1000229904 | 177 |
| 314 | 3300031995 | Ga0307409_100028822 | Ga0307409_1000288223 | 177 |
| 315 | 3300031995 | Ga0307409_100193461 | Ga0307409_1001934612 | 177 |
| 316 | 3300031995 | Ga0307409_100422285 | Ga0307409_1004222851 | 177 |
| 317 | 3300032002 | Ga0307416_100020106 | Ga0307416_1000201062 | 177 |
| 318 | 3300032002 | Ga0307416_100045268 | Ga0307416_1000452682 | 177 |
| 319 | 3300032002 | Ga0307416_100047106 | Ga0307416_1000471063 | 177 |
| 320 | 3300032002 | Ga0307416_100136749 | Ga0307416_1001367493 | 177 |
| 321 | 3300032002 | Ga0307416_100219344 | Ga0307416_1002193443 | 177 |
| 322 | 3300032002 | Ga0307416_100265480 | Ga0307416_1002654803 | 177 |
| 323 | 3300032002 | Ga0307416_100512370 | Ga0307416_1005123702 | 177 |
| 324 | 3300032002 | Ga0307416_100848208 | Ga0307416_1008482081 | 177 |
| 325 | 3300032004 | Ga0307414_10010008 | Ga0307414_100100084 | 177 |
| 326 | 3300032004 | Ga0307414_10012904 | Ga0307414_100129043 | 177 |
| 327 | 3300032004 | Ga0307414_10467267 | Ga0307414_104672672 | 177 |
| 328 | 3300032004 | Ga0307414_10672670 | Ga0307414_106726701 | 177 |
| 329 | 3300032005 | Ga0307411_10015969 | Ga0307411_100159692 | 177 |
| 330 | 3300032005 | Ga0307411_10016001 | Ga0307411_100160014 | 177 |
| 331 | 3300032005 | Ga0307411_10024467 | Ga0307411_100244674 | 177 |
| 332 | 3300032005 | Ga0307411_10087285 | Ga0307411_100872853 | 177 |
| 333 | 3300032005 | Ga0307411_10290037 | Ga0307411_102900372 | 177 |
| 334 | 3300032005 | Ga0307411_10619979 | Ga0307411_106199791 | 177 |
| 335 | 3300032005 | Ga0307411_10998202 | Ga0307411_109982021 | 177 |
| 336 | 3300032005 | Ga0307411_11000651 | Ga0307411_110006511 | 177 |
| 337 | 3300032126 | Ga0307415_100018828 | Ga0307415_1000188283 | 177 |
| 338 | 3300032126 | Ga0307415_100047202 | Ga0307415_1000472024 | 177 |
| 339 | 3300032126 | Ga0307415_100434101 | Ga0307415_1004341012 | 177 |
| 340 | 3300033180 | Ga0307510_10083889 | Ga0307510_100838892 | 177 |
| 341 | 3300039437 | Ga0436365_0010969 | Ga0436365_0010969_65008_65598 | 177 |
| 342 | 3300039437 | Ga0436365_1858586 | Ga0436365_1858586_60912_61499 | 177 |
| 343 | 3300039453 | Ga0436362_1035670 | Ga0436362_1035670_120394_120981 | 177 |
| 344 | 3300041406 | Ga0439439_0177145 | Ga0439439_0177145_25_594 | 177 |
| 345 | 3300042439 | Ga0439464_0046531 | Ga0439464_0046531_283_852 | 177 |
| 346 | 3300046558 | Ga0495633_0250321 | Ga0495633_0250321_205_774 | 177 |
| 347 | 3300046664 | Ga0495659_0083459 | Ga0495659_0083459_322_891 | 177 |
| 348 | 3300047447 | Ga0495685_074143 | Ga0495685_074143_74_643 | 177 |
| 349 | 3300048904 | Ga0496101_0564616 | Ga0496101_0564616_175_744 | 177 |
| 350 | 3300048913 | Ga0496110_0035000 | Ga0496110_0035000_215_784 | 177 |
| 351 | 3300048917 | Ga0496114_0017208 | Ga0496114_0017208_3488_4057 | 177 |
| 352 | 3300049668 | Ga0501233_021304 | Ga0501233_021304_807_1376 | 177 |
| 353 | 3300049679 | Ga0501249_010157 | Ga0501249_010157_1054_1623 | 177 |
| 354 | 3300001904 | JGI24736J21556_1000017 | JGI24736J21556_100001735 | 178 |
| 355 | 3300005456 | Ga0070678_100848790 | Ga0070678_1008487902 | 178 |
| 356 | 3300005563 | Ga0068855_100068059 | Ga0068855_1000680594 | 178 |
| 357 | 3300009093 | Ga0105240_11555056 | Ga0105240_115550561 | 178 |
| 358 | 3300025949 | Ga0207667_10089869 | Ga0207667_100898693 | 178 |
| 359 | 3300026121 | Ga0207683_10348987 | Ga0207683_103489872 | 178 |
| 360 | 3300046542 | Ga0495597_0075966 | Ga0495597_0075966_488_1048 | 178 |
| 361 | 3300046616 | Ga0495668_0257096 | Ga0495668_0257096_319_885 | 178 |
| 362 | 3300046660 | Ga0495625_0000332 | Ga0495625_0000332_37591_38151 | 178 |
| 363 | 3300046660 | Ga0495625_0330813 | Ga0495625_0330813_376_954 | 178 |
| 364 | 3300053092 | Ga0500583_0208456 | Ga0500583_0208456_377_943 | 178 |
| 365 | 3300053108 | Ga0500562_058796 | Ga0500562_058796_238_804 | 178 |
| 366 | 3300053116 | Ga0500592_011628 | Ga0500592_011628_747_1313 | 178 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1b68-assembly1.cif.gz_A | apolipoprotein e4 (apoe4), 22k fragment | 0.5831 | 37 | 175 |
| 1nfn-assembly1.cif.gz_A | apolipoprotein e3 (apoe3) | 0.575 | 33 | 174 |
| 1b68-assembly1.cif.gz_A | apolipoprotein e4 (apoe4), 22k fragment | 0.5711 | 37 | 175 |
| 7fcs-assembly1.cif.gz_A | crystal structure of the n-terminal domain of mutants of human apolipoprotein-e (apoe) | 0.5674 | 34 | 176 |
| 1nfo-assembly1.cif.gz_A | apolipoprotein e2 (apoe2, d154a mutation) | 0.5588 | 33 | 176 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_K7KZX1_376_557_1.20.120.1770 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.7508 | 21 | 174 | 1.20.120.1770 |
| af_Q59QL0_312_444_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.6594 | 27 | 101 | 3.30.40.10 |
| 1sesB01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Serine-tRNA synthetase, tRNA binding domain | 0.6541 | 91 | 174 | 1.10.287.40 |
| af_K7LU78_450_565_1.20.58.390 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain | 0.6128 | 74 | 174 | 1.20.58.390 |
| af_K7KZX1_376_557_1.20.120.1770 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.5983 | 21 | 174 | 1.20.120.1770 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E4GUV7-F1-model_v4 | Urate oxidase N-terminal domain-containing protein | 0.981 | 108 | 174 |
GO:0016020
|
| AF-A0A7C7S3Q6-F1-model_v4 | deleted | 0.9753 | 25 | 172 |
|
| AF-A0A2E6X907-F1-model_v4 | Urate oxidase N-terminal domain-containing protein | 0.9722 | 41 | 174 |
GO:0016020
|
| AF-A0A2W5X8J5-F1-model_v4 | Urate oxidase N-terminal domain-containing protein | 0.9627 | 27 | 174 |
GO:0016020
|
| AF-A0A520B816-F1-model_v4 | Urate oxidase N-terminal domain-containing protein | 0.962 | 100 | 174 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar