F424005

General Info

Members Datasets Scaffolds Average Seq Length
366 192 732 183

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10203756|Ga0105238_102037562
Length 194
Sequence LTIAKLYNQTLNSAISYNLKHMSPSQIQDEVKLKLNQITDHFKQELGKIRTGRAHPGMLDGVMVEAYGQAMPLKAAASISTPEPQLLQITPFDPNNLTAISDAIRDDQSLGLNPADDGRVVRVQIPPLTEETRQQMVKILHQKVEDAMITARQARHDGLHKAEAAEKAKDISRDELERLEKQVDELKEQEILTV

Samples

Sample ID Description Type Environment
1 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
48 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
49 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
85 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
86 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
87 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
88 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
89 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
92 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
93 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
94 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
95 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
96 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
97 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
98 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
99 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
100 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
101 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
102 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
103 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
104 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
105 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
106 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
107 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
108 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
109 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
110 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
118 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
119 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
120 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
121 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
122 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
123 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
124 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
125 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
126 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
127 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
128 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
129 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
130 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
131 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
132 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
133 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
134 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
137 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
138 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
139 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
140 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
141 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
142 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
143 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
144 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
145 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
146 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
147 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
150 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
151 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
163 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
166 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
167 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
168 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
169 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
170 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
171 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
172 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
173 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
174 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
175 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
176 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
177 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
178 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
179 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
180 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
181 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
182 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
183 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
184 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
185 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
186 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
187 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
188 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
189 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
190 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
191 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
192 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.39
Nodule 0
Rhizoplane 0.27
Rhizosphere 81.69
Stem 0
Stem Tuber 0
Unclassified 19.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105238_10203756 3300009551 Unclassified 1954
2 JGI24739J22299_10027590 3300001989 Bacteria 1984
3 JGI24737J22298_10103880 3300001990 Bacteria 842
4 JGI25406J46586_10118350 3300003203 Unclassified 781
5 rootL2_10060608 3300003322 Bacteria 5844
6 rootH1_10058345 3300003323 Bacteria 42716
7 Ga0070658_10000668 3300005327 Bacteria 29714
8 Ga0070658_10000669 3300005327 Bacteria 29694
9 Ga0070658_10609625 3300005327 Bacteria 946
10 Ga0070658_11022737 3300005327 Unclassified 719
11 Ga0070683_100055970 3300005329 Bacteria 3662
12 Ga0070683_100259663 3300005329 Unclassified 1652
13 Ga0070680_100000491 3300005336 Bacteria 27129
14 Ga0070680_100074724 3300005336 Unclassified 2789
15 Ga0070680_100089625 3300005336 Bacteria 2545
16 Ga0070680_100106842 3300005336 Bacteria 2328
17 Ga0070660_100000185 3300005339 Bacteria 41480
18 Ga0070660_100006264 3300005339 Bacteria 8240
19 Ga0070660_100202310 3300005339 Bacteria 1611
20 Ga0070691_10023135 3300005341 Bacteria 2885
21 Ga0070661_100696599 3300005344 Unclassified 827
22 Ga0070659_100001803 3300005366 Bacteria 15403
23 Ga0070659_100165640 3300005366 Bacteria 1809
24 Ga0070714_100000495 3300005435 Bacteria 28541
25 Ga0070714_100636019 3300005435 Unclassified 1026
26 Ga0070662_100035998 3300005457 Bacteria 3499
27 Ga0070681_10331165 3300005458 Bacteria 1432
28 Ga0070681_10946520 3300005458 Bacteria 780
29 Ga0070679_100000463 3300005530 Bacteria 34512
30 Ga0070679_100005349 3300005530 Bacteria 11881
31 Ga0070679_100006854 3300005530 Bacteria 10623
32 Ga0070679_100012098 3300005530 Bacteria 8242
33 Ga0070679_100029103 3300005530 Bacteria 5449
34 Ga0070679_100216605 3300005530 Bacteria 1877
35 Ga0070679_100396988 3300005530 Unclassified 1325
36 Ga0070679_100527388 3300005530 Unclassified 1125
37 Ga0070684_100059329 3300005535 Bacteria 3345
38 Ga0070684_100115543 3300005535 Bacteria 2410
39 Ga0070684_100745020 3300005535 Bacteria 914
40 Ga0070684_101139823 3300005535 Unclassified 733
41 Ga0068853_100079969 3300005539 Bacteria 2859
42 Ga0068855_100000138 3300005563 Bacteria 92676
43 Ga0068855_100000364 3300005563 Bacteria 56128
44 Ga0068855_100001636 3300005563 Bacteria 28089
45 Ga0068855_100002780 3300005563 Bacteria 21542
46 Ga0068855_100081035 3300005563 Bacteria 3763
47 Ga0068855_100155275 3300005563 Unclassified 2601
48 Ga0068855_100389332 3300005563 Unclassified 1529
49 Ga0068855_100936472 3300005563 Bacteria 913
50 Ga0070664_100012439 3300005564 Bacteria 6917
51 Ga0068857_100000040 3300005577 Bacteria 70513
52 Ga0068857_100000084 3300005577 Bacteria 54402
53 Ga0068857_100010791 3300005577 Bacteria 7952
54 Ga0068857_100068726 3300005577 Bacteria 3153
55 Ga0068854_100180248 3300005578 Unclassified 1650
56 Ga0068856_100000001 3300005614 Bacteria 565602
57 Ga0068856_100590926 3300005614 Bacteria 1131
58 Ga0068852_100000051 3300005616 Bacteria 81538
59 Ga0068852_100032666 3300005616 Bacteria 4312
60 Ga0068861_100378544 3300005719 Bacteria 1250
61 Ga0068860_100008163 3300005843 Bacteria 10424
62 Ga0081455_10000003 3300005937 Bacteria 367763
63 Ga0081455_10000006 3300005937 Bacteria 323066
64 Ga0081539_10003242 3300005985 Bacteria 20471
65 Ga0070717_10140560 3300006028 Bacteria 2082
66 Ga0075365_10000091 3300006038 Bacteria 26191
67 Ga0075365_10000444 3300006038 Bacteria 15407
68 Ga0075365_10002813 3300006038 Bacteria 8712
69 Ga0075365_10092495 3300006038 Unclassified 2062
70 Ga0075368_10000195 3300006042 Bacteria 16678
71 Ga0075368_10001015 3300006042 Bacteria 8783
72 Ga0075363_100000019 3300006048 Bacteria 34359
73 Ga0075364_10000244 3300006051 Bacteria 26177
74 Ga0075362_10163049 3300006177 Bacteria 1074
75 Ga0075367_10000110 3300006178 Bacteria 23417
76 Ga0075367_10000530 3300006178 Bacteria 14413
77 Ga0075369_10003847 3300006186 Bacteria 5505
78 Ga0075366_10013851 3300006195 Bacteria 4596
79 Ga0075366_10297671 3300006195 Bacteria 987
80 Ga0097621_100000001 3300006237 Bacteria 632268
81 Ga0075370_10011017 3300006353 Unclassified 4743
82 Ga0075370_10039406 3300006353 Bacteria 2662
83 Ga0075370_10058625 3300006353 Bacteria 2190
84 Ga0068871_100000005 3300006358 Bacteria 123210
85 Ga0105240_10005031 3300009093 Bacteria 19837
86 Ga0105240_10009236 3300009093 Bacteria 13988
87 Ga0105240_10164684 3300009093 Bacteria 2631
88 Ga0105240_10222403 3300009093 Bacteria 2199
89 Ga0105240_10343694 3300009093 Unclassified 1694
90 Ga0105240_10517449 3300009093 Bacteria 1325
91 Ga0105240_10795662 3300009093 Unclassified 1025
92 Ga0105240_11413322 3300009093 Unclassified 731
93 Ga0105245_10247274 3300009098 Bacteria 1731
94 Ga0105241_10010629 3300009174 Bacteria 6750
95 Ga0105241_10195368 3300009174 Bacteria 1687
96 Ga0105241_10384432 3300009174 Unclassified 1227
97 Ga0105241_10478747 3300009174 Bacteria 1106
98 Ga0105248_10952965 3300009177 Unclassified 969
99 Ga0105237_10000002 3300009545 Bacteria 702357
100 Ga0105237_10317491 3300009545 Unclassified 1561
101 Ga0105238_10001170 3300009551 Bacteria 26379
102 Ga0105238_10002583 3300009551 Bacteria 18043
103 Ga0105238_10689599 3300009551 Unclassified 1033
104 Ga0105032_100003 3300009979 Bacteria 186985
105 Ga0105029_100828 3300009984 Bacteria 1768
106 Ga0105028_100558 3300009993 Unclassified 3989
107 Ga0105239_10017094 3300010375 Bacteria 8017
108 Ga0105239_10138957 3300010375 Bacteria 2706
109 Ga0105239_10616863 3300010375 Bacteria 1238
110 Ga0105246_10050083 3300011119 Bacteria 2864
111 Ga0157373_10051064 3300013100 Bacteria 2945
112 Ga0157373_10108074 3300013100 Bacteria 1956
113 Ga0157373_10236454 3300013100 Unclassified 1291
114 Ga0157371_10556370 3300013102 Unclassified 851
115 Ga0157369_10000024 3300013105 Bacteria 225851
116 Ga0157369_10001762 3300013105 Bacteria 26232
117 Ga0157369_10002588 3300013105 Bacteria 21632
118 Ga0157369_10032578 3300013105 Bacteria 5730
119 Ga0157369_10073368 3300013105 Bacteria 3672
120 Ga0157369_10124526 3300013105 Unclassified 2733
121 Ga0157369_11212749 3300013105 Unclassified 770
122 Ga0157374_10000430 3300013296 Bacteria 38024
123 Ga0157378_10000060 3300013297 Bacteria 95816
124 Ga0163162_10167583 3300013306 Bacteria 2321
125 Ga0163162_11247979 3300013306 Unclassified 844
126 Ga0157372_10000008 3300013307 Bacteria 305449
127 Ga0157372_10002086 3300013307 Bacteria 21727
128 Ga0157372_10017891 3300013307 Bacteria 7615
129 Ga0157372_10075177 3300013307 Bacteria 3811
130 Ga0157372_10096009 3300013307 Bacteria 3378
131 Ga0157372_10099928 3300013307 Bacteria 3310
132 Ga0157372_11483276 3300013307 Unclassified 781
133 Ga0157377_10017769 3300014745 Bacteria 3685
134 Ga0154015_1598308 3300020610 Unclassified 614
135 Ga0207705_10018580 3300025909 Bacteria 4969
136 Ga0207705_10023821 3300025909 Bacteria 4367
137 Ga0207654_10055641 3300025911 Bacteria 2291
138 Ga0207654_10108086 3300025911 Bacteria 1725
139 Ga0207707_10057167 3300025912 Bacteria 3395
140 Ga0207707_10397993 3300025912 Unclassified 1183
141 Ga0207695_10008875 3300025913 Bacteria 12517
142 Ga0207695_10040778 3300025913 Bacteria 4973
143 Ga0207695_10714581 3300025913 Unclassified 882
144 Ga0207695_10949503 3300025913 Unclassified 739
145 Ga0207695_10964302 3300025913 Unclassified 732
146 Ga0207671_10000008 3300025914 Bacteria 798229
147 Ga0207671_10631410 3300025914 Unclassified 853
148 Ga0207660_10000777 3300025917 Bacteria 21196
149 Ga0207660_10076364 3300025917 Unclassified 2450
150 Ga0207660_10085980 3300025917 Bacteria 2321
151 Ga0207660_10122764 3300025917 Bacteria 1969
152 Ga0207660_10266017 3300025917 Bacteria 1357
153 Ga0207657_10010646 3300025919 Bacteria 9162
154 Ga0207657_10056765 3300025919 Bacteria 3376
155 Ga0207652_10001638 3300025921 Bacteria 19644
156 Ga0207652_10005261 3300025921 Bacteria 10506
157 Ga0207652_10012343 3300025921 Bacteria 6902
158 Ga0207652_10032067 3300025921 Bacteria 4413
159 Ga0207652_10036332 3300025921 Unclassified 4165
160 Ga0207652_10308780 3300025921 Unclassified 1428
161 Ga0207652_10309864 3300025921 Bacteria 1425
162 Ga0207694_10001214 3300025924 Bacteria 22378
163 Ga0207694_10038873 3300025924 Bacteria 3659
164 Ga0207694_10329226 3300025924 Unclassified 1262
165 Ga0207694_10986722 3300025924 Unclassified 713
166 Ga0207694_11008114 3300025924 Bacteria 705
167 Ga0207687_10167067 3300025927 Unclassified 1693
168 Ga0207664_10000516 3300025929 Bacteria 27485
169 Ga0207661_10450384 3300025944 Bacteria 1172
170 Ga0207679_10261157 3300025945 Bacteria 1477
171 Ga0207667_10000005 3300025949 Bacteria 715503
172 Ga0207667_10000434 3300025949 Bacteria 56114
173 Ga0207667_10000784 3300025949 Bacteria 41252
174 Ga0207667_10009853 3300025949 Bacteria 11221
175 Ga0207667_10028291 3300025949 Bacteria 6090
176 Ga0207667_10460270 3300025949 Unclassified 1292
177 Ga0207640_10413061 3300025981 Bacteria 1102
178 Ga0207658_10000003 3300025986 Bacteria 1151934
179 Ga0207702_10000062 3300026078 Bacteria 124850
180 Ga0207702_10927766 3300026078 Bacteria 863
181 Ga0207674_10000001 3300026116 Bacteria 616581
182 Ga0207674_10002117 3300026116 Bacteria 25105
183 Ga0207674_10023327 3300026116 Bacteria 6630
184 Ga0207674_10024243 3300026116 Bacteria 6485
185 Ga0207675_100466388 3300026118 Bacteria 1253
186 Ga0207698_10000022 3300026142 Bacteria 131985
187 Ga0207698_10085309 3300026142 Bacteria 2564
188 Ga0209998_10009381 3300027717 Bacteria 2031
189 Ga0209813_10000002 3300027866 Bacteria 215993
190 Ga0209813_10000934 3300027866 Bacteria 6561
191 Ga0268264_10009166 3300028381 Bacteria 8199
192 Ga0265337_1000576 3300028556 Bacteria 19289
193 Ga0265337_1004349 3300028556 Bacteria 5894
194 Ga0265337_1052904 3300028556 Bacteria 1139
195 Ga0265337_1104383 3300028556 Bacteria 771
196 Ga0265326_10000184 3300028558 Bacteria 31647
197 Ga0265326_10006168 3300028558 Bacteria 3743
198 Ga0265326_10012213 3300028558 Bacteria 2528
199 Ga0265334_10001628 3300028573 Bacteria 10793
200 Ga0265334_10004366 3300028573 Bacteria 6284
201 Ga0265334_10027992 3300028573 Bacteria 2267
202 Ga0265318_10125279 3300028577 Bacteria 945
203 Ga0265322_10002027 3300028654 Bacteria 6386
204 Ga0265322_10008588 3300028654 Bacteria 2974
205 Ga0265336_10000075 3300028666 Bacteria 81725
206 Ga0265336_10001511 3300028666 Bacteria 10507
207 Ga0265336_10001853 3300028666 Bacteria 9172
208 Ga0265338_10000195 3300028800 Bacteria 114621
209 Ga0265338_10000340 3300028800 Bacteria 85032
210 Ga0265338_10000412 3300028800 Bacteria 76488
211 Ga0265338_10001208 3300028800 Bacteria 42717
212 Ga0265338_10001293 3300028800 Bacteria 41034
213 Ga0265338_10001463 3300028800 Bacteria 38257
214 Ga0265338_10002516 3300028800 Bacteria 27243
215 Ga0265338_10019167 3300028800 Bacteria 7280
216 Ga0265338_10158009 3300028800 Unclassified 1754
217 Ga0265338_10759298 3300028800 Unclassified 666
218 Ga0265324_10001223 3300029957 Bacteria 15225
219 Ga0265324_10003219 3300029957 Bacteria 7890
220 Ga0265324_10010532 3300029957 Bacteria 3559
221 Ga0314311_1210496 3300030733 Bacteria 2063
222 Ga0316179_1024327 3300030734 Bacteria 28090
223 Ga0316180_1183998 3300030736 Bacteria 2934
224 Ga0316183_1010007 3300030742 Bacteria 20400
225 Ga0316183_1085329 3300030742 Unclassified 2034
226 Ga0316181_1063761 3300030744 Bacteria 284591
227 Ga0316182_1038083 3300030745 Bacteria 7944
228 Ga0316182_1039048 3300030745 Bacteria 11178
229 Ga0316182_1172812 3300030745 Bacteria 50125
230 Ga0316182_1407660 3300030745 Bacteria 9406
231 Ga0265332_10086050 3300031238 Unclassified 1332
232 Ga0265328_10192455 3300031239 Unclassified 773
233 Ga0265320_10016191 3300031240 Unclassified 4188
234 Ga0265320_10063892 3300031240 Bacteria 1750
235 Ga0265325_10103630 3300031241 Bacteria 1390
236 Ga0265325_10182383 3300031241 Unclassified 977
237 Ga0265340_10099821 3300031247 Unclassified 1350
238 Ga0265339_10016298 3300031249 Bacteria 4433
239 Ga0265339_10016999 3300031249 Bacteria 4318
240 Ga0265331_10306055 3300031250 Bacteria 712
241 Ga0265327_10003538 3300031251 Bacteria 14808
242 Ga0265327_10003910 3300031251 Bacteria 13696
243 Ga0265327_10007047 3300031251 Bacteria 8807
244 Ga0265316_10008024 3300031344 Bacteria 9855
245 Ga0265316_10024097 3300031344 Bacteria 5109
246 Ga0265316_10091726 3300031344 Bacteria 2317
247 Ga0265316_10158774 3300031344 Bacteria 1691
248 Ga0265313_10052565 3300031595 Bacteria 1943
249 Ga0265314_10276895 3300031711 Bacteria 951
250 Ga0265342_10494736 3300031712 Bacteria 624
251 Ga0307516_10000003 3300031730 Bacteria 459377
252 Ga0307516_10099426 3300031730 Bacteria 2726
253 Ga0307412_10074807 3300031911 Bacteria 2322
254 Ga0395899_0072714 3300037312 Bacteria 2516
255 Ga0395899_0175344 3300037312 Unclassified 1508
256 Ga0395900_0000520 3300037418 Bacteria 54397
257 Ga0395900_0007057 3300037418 Bacteria 11629
258 Ga0395900_0343264 3300037418 Unclassified 1468
259 Ga0395898_0043006 3300037466 Bacteria 4453
260 Ga0395905_0294374 3300037471 Bacteria 1510
261 Ga0395905_0996178 3300037471 Unclassified 741
262 Ga0395901_0001401 3300038443 Bacteria 25185
263 Ga0395901_0061247 3300038443 Bacteria 3916
264 Ga0395901_0474107 3300038443 Unclassified 1277
265 Ga0439438_017707 3300041405 Bacteria 2043
266 Ga0439447_018362 3300041407 Bacteria 1887
267 Ga0439461_0010680 3300041410 Bacteria 1690
268 Ga0439461_0012884 3300041410 Bacteria 1570
269 Ga0439466_0029061 3300041411 Bacteria 1904
270 Ga0439431_0053227 3300041997 Bacteria 1053
271 Ga0439442_023638 3300042002 Bacteria 1277
272 Ga0439445_0002518 3300042004 Bacteria 4073
273 Ga0439432_001021 3300042006 Bacteria 10592
274 Ga0450911_008373 3300042115 Bacteria 1475
275 Ga0450920_000342 3300042122 Bacteria 7137
276 Ga0450906_004039 3300042145 Bacteria 3104
277 Ga0439446_0000005 3300042156 Bacteria 101649
278 Ga0439446_0000181 3300042156 Bacteria 11104
279 Ga0450909_006297 3300042185 Bacteria 1711
280 Ga0439434_0018592 3300042435 Bacteria 2082
281 Ga0450918_037538 3300042531 Bacteria 864
282 Ga0466965_0000073 3300044683 Bacteria 29903
283 Ga0453684_0472975 3300044712 Bacteria 1391
284 Ga0451576_0078568 3300045051 Unclassified 3434
285 Ga0451576_0485155 3300045051 Unclassified 1298
286 Ga0495629_0055644 3300046459 Bacteria 2766
287 Ga0495638_0000108 3300046460 Bacteria 132914
288 Ga0495638_0000173 3300046460 Bacteria 100531
289 Ga0495641_0197987 3300046461 Bacteria 900
290 Ga0495662_0041780 3300046476 Unclassified 2214
291 Ga0495587_0309753 3300046536 Bacteria 882
292 Ga0495622_0000051 3300046557 Bacteria 105674
293 Ga0495634_0110738 3300046642 Bacteria 1766
294 Ga0495647_0081410 3300046681 Bacteria 1314
295 Ga0495658_0000721 3300046683 Bacteria 17864
296 Ga0495671_0110800 3300046692 Bacteria 1340
297 Ga0495600_0030341 3300046809 Unclassified 3502
298 Ga0495660_0000035 3300046810 Bacteria 199140
299 Ga0495672_0000016 3300047320 Bacteria 500601
300 Ga0496109_0084828 3300048912 Bacteria 2923
301 Ga0496124_0391795 3300048927 Unclassified 967
302 Ga0496125_0305905 3300048928 Unclassified 971
303 Ga0501031_0001772 3300049568 Bacteria 13539
304 Ga0501032_0002880 3300049569 Bacteria 13378
305 Ga0501034_0000333 3300049571 Bacteria 82475
306 Ga0501034_0394654 3300049571 Unclassified 1307
307 Ga0501034_1062986 3300049571 Unclassified 691
308 Ga0501036_0001796 3300049572 Bacteria 16653
309 Ga0501037_0000001 3300049573 Bacteria 753276
310 Ga0501037_0000141 3300049573 Bacteria 67142
311 Ga0501038_0010955 3300049574 Bacteria 8282
312 Ga0501038_0090509 3300049574 Bacteria 2564
313 Ga0501042_0040028 3300049578 Bacteria 3332
314 Ga0501043_0000819 3300049579 Bacteria 27647
315 Ga0501046_0000145 3300049580 Bacteria 74343
316 Ga0501047_0000375 3300049581 Bacteria 50494
317 Ga0501048_0000059 3300049582 Bacteria 54989
318 Ga0501070_0060913 3300049586 Bacteria 3128
319 Ga0501070_0406770 3300049586 Unclassified 1100
320 Ga0501070_1086778 3300049586 Unclassified 617
321 Ga0501071_0907367 3300049587 Bacteria 680
322 Ga0501080_0097130 3300049742 Bacteria 2735
323 Ga0501083_0032911 3300049744 Bacteria 3552
324 Ga0501083_0059167 3300049744 Bacteria 2563
325 Ga0501035_0000821 3300049822 Bacteria 33132
326 nmdc:mga03683_65041_c1 3300050489 Bacteria 1549
327 nmdc:mga00v17_331_c1 3300050491 Bacteria 26647
328 nmdc:mga00v17_856775_c1 3300050491 Unclassified 577
329 nmdc:mga0yw44_1346_c1 3300050492 Bacteria 9731
330 nmdc:mga0yw44_6_c1 3300050492 Bacteria 272478
331 nmdc:mga0yw44_98_c1 3300050492 Bacteria 30535
332 nmdc:mga0k408_13130_c1 3300050493 Bacteria 4537
333 nmdc:mga06z11_1040_c1 3300050494 Bacteria 10098
334 nmdc:mga06z11_10_c1 3300050494 Bacteria 105982
335 nmdc:mga04h51_19745_c1 3300050495 Bacteria 2002
336 nmdc:mga04h51_2_c1 3300050495 Bacteria 215993
337 nmdc:mga07m45_174232_c1 3300050496 Unclassified 1251
338 nmdc:mga07m45_23211_c1 3300050496 Bacteria 3390
339 nmdc:mga07m45_5893_c1 3300050496 Bacteria 6151
340 nmdc:mga07m45_60411_c1 3300050496 Bacteria 2145
341 nmdc:mga07m45_9685_c1 3300050496 Bacteria 5007
342 nmdc:mga0sz30_126660_c1 3300050516 Bacteria 1124
343 nmdc:mga0sz30_2662_c2 3300050516 Bacteria 5448
344 Ga0500643_010132 3300053087 Unclassified 3536
345 Ga0500644_0006597 3300053088 Bacteria 2982
346 Ga0500646_0000001 3300053090 Bacteria 273936
347 Ga0500646_0287929 3300053090 Unclassified 586
348 Ga0500583_0008694 3300053092 Bacteria 3663
349 Ga0500583_0026529 3300053092 Bacteria 2490
350 Ga0500583_0068169 3300053092 Bacteria 1696
351 Ga0500651_0000019 3300053093 Bacteria 141974
352 Ga0500566_0000001 3300053094 Bacteria 1101031
353 Ga0500641_0000001 3300053096 Bacteria 1115973
354 Ga0500650_0021017 3300053098 Bacteria 2871
355 Ga0500569_000004 3300053109 Bacteria 100531
356 Ga0500593_000001 3300053117 Bacteria 784404
357 Ga0500594_0000111 3300053118 Bacteria 23911
358 Ga0500652_000001 3300053131 Bacteria 946868
359 Ga0500559_0006108 3300053136 Bacteria 5454
360 Ga0500561_0000001 3300053137 Bacteria 957685
361 Ga0500588_0000056 3300053146 Bacteria 19233
362 Ga0500604_0022685 3300053151 Unclassified 1784
363 Ga0500616_0000067 3300053153 Bacteria 236311
364 Ga0500616_0009886 3300053153 Bacteria 5746
365 Ga0500616_0047173 3300053153 Bacteria 2288
366 Ga0500611_011446 3300053727 Unclassified 1468
367 Ga0105238_10203756
368 JGI24739J22299_10027590
369 JGI24737J22298_10103880
370 JGI25406J46586_10118350
371 rootL2_10060608
372 rootH1_10058345
373 Ga0070658_10000668
374 Ga0070658_10000669
375 Ga0070658_10609625
376 Ga0070658_11022737
377 Ga0070683_100055970
378 Ga0070683_100259663
379 Ga0070680_100000491
380 Ga0070680_100074724
381 Ga0070680_100089625
382 Ga0070680_100106842
383 Ga0070660_100000185
384 Ga0070660_100006264
385 Ga0070660_100202310
386 Ga0070691_10023135
387 Ga0070661_100696599
388 Ga0070659_100001803
389 Ga0070659_100165640
390 Ga0070714_100000495
391 Ga0070714_100636019
392 Ga0070662_100035998
393 Ga0070681_10331165
394 Ga0070681_10946520
395 Ga0070679_100000463
396 Ga0070679_100005349
397 Ga0070679_100006854
398 Ga0070679_100012098
399 Ga0070679_100029103
400 Ga0070679_100216605
401 Ga0070679_100396988
402 Ga0070679_100527388
403 Ga0070684_100059329
404 Ga0070684_100115543
405 Ga0070684_100745020
406 Ga0070684_101139823
407 Ga0068853_100079969
408 Ga0068855_100000138
409 Ga0068855_100000364
410 Ga0068855_100001636
411 Ga0068855_100002780
412 Ga0068855_100081035
413 Ga0068855_100155275
414 Ga0068855_100389332
415 Ga0068855_100936472
416 Ga0070664_100012439
417 Ga0068857_100000040
418 Ga0068857_100000084
419 Ga0068857_100010791
420 Ga0068857_100068726
421 Ga0068854_100180248
422 Ga0068856_100000001
423 Ga0068856_100590926
424 Ga0068852_100000051
425 Ga0068852_100032666
426 Ga0068861_100378544
427 Ga0068860_100008163
428 Ga0081455_10000003
429 Ga0081455_10000006
430 Ga0081539_10003242
431 Ga0070717_10140560
432 Ga0075365_10000091
433 Ga0075365_10000444
434 Ga0075365_10002813
435 Ga0075365_10092495
436 Ga0075368_10000195
437 Ga0075368_10001015
438 Ga0075363_100000019
439 Ga0075364_10000244
440 Ga0075362_10163049
441 Ga0075367_10000110
442 Ga0075367_10000530
443 Ga0075369_10003847
444 Ga0075366_10013851
445 Ga0075366_10297671
446 Ga0097621_100000001
447 Ga0075370_10011017
448 Ga0075370_10039406
449 Ga0075370_10058625
450 Ga0068871_100000005
451 Ga0105240_10005031
452 Ga0105240_10009236
453 Ga0105240_10164684
454 Ga0105240_10222403
455 Ga0105240_10343694
456 Ga0105240_10517449
457 Ga0105240_10795662
458 Ga0105240_11413322
459 Ga0105245_10247274
460 Ga0105241_10010629
461 Ga0105241_10195368
462 Ga0105241_10384432
463 Ga0105241_10478747
464 Ga0105248_10952965
465 Ga0105237_10000002
466 Ga0105237_10317491
467 Ga0105238_10001170
468 Ga0105238_10002583
469 Ga0105238_10689599
470 Ga0105032_100003
471 Ga0105029_100828
472 Ga0105028_100558
473 Ga0105239_10017094
474 Ga0105239_10138957
475 Ga0105239_10616863
476 Ga0105246_10050083
477 Ga0157373_10051064
478 Ga0157373_10108074
479 Ga0157373_10236454
480 Ga0157371_10556370
481 Ga0157369_10000024
482 Ga0157369_10001762
483 Ga0157369_10002588
484 Ga0157369_10032578
485 Ga0157369_10073368
486 Ga0157369_10124526
487 Ga0157369_11212749
488 Ga0157374_10000430
489 Ga0157378_10000060
490 Ga0163162_10167583
491 Ga0163162_11247979
492 Ga0157372_10000008
493 Ga0157372_10002086
494 Ga0157372_10017891
495 Ga0157372_10075177
496 Ga0157372_10096009
497 Ga0157372_10099928
498 Ga0157372_11483276
499 Ga0157377_10017769
500 Ga0154015_1598308
501 Ga0207705_10018580
502 Ga0207705_10023821
503 Ga0207654_10055641
504 Ga0207654_10108086
505 Ga0207707_10057167
506 Ga0207707_10397993
507 Ga0207695_10008875
508 Ga0207695_10040778
509 Ga0207695_10714581
510 Ga0207695_10949503
511 Ga0207695_10964302
512 Ga0207671_10000008
513 Ga0207671_10631410
514 Ga0207660_10000777
515 Ga0207660_10076364
516 Ga0207660_10085980
517 Ga0207660_10122764
518 Ga0207660_10266017
519 Ga0207657_10010646
520 Ga0207657_10056765
521 Ga0207652_10001638
522 Ga0207652_10005261
523 Ga0207652_10012343
524 Ga0207652_10032067
525 Ga0207652_10036332
526 Ga0207652_10308780
527 Ga0207652_10309864
528 Ga0207694_10001214
529 Ga0207694_10038873
530 Ga0207694_10329226
531 Ga0207694_10986722
532 Ga0207694_11008114
533 Ga0207687_10167067
534 Ga0207664_10000516
535 Ga0207661_10450384
536 Ga0207679_10261157
537 Ga0207667_10000005
538 Ga0207667_10000434
539 Ga0207667_10000784
540 Ga0207667_10009853
541 Ga0207667_10028291
542 Ga0207667_10460270
543 Ga0207640_10413061
544 Ga0207658_10000003
545 Ga0207702_10000062
546 Ga0207702_10927766
547 Ga0207674_10000001
548 Ga0207674_10002117
549 Ga0207674_10023327
550 Ga0207674_10024243
551 Ga0207675_100466388
552 Ga0207698_10000022
553 Ga0207698_10085309
554 Ga0209998_10009381
555 Ga0209813_10000002
556 Ga0209813_10000934
557 Ga0268264_10009166
558 Ga0265337_1000576
559 Ga0265337_1004349
560 Ga0265337_1052904
561 Ga0265337_1104383
562 Ga0265326_10000184
563 Ga0265326_10006168
564 Ga0265326_10012213
565 Ga0265334_10001628
566 Ga0265334_10004366
567 Ga0265334_10027992
568 Ga0265318_10125279
569 Ga0265322_10002027
570 Ga0265322_10008588
571 Ga0265336_10000075
572 Ga0265336_10001511
573 Ga0265336_10001853
574 Ga0265338_10000195
575 Ga0265338_10000340
576 Ga0265338_10000412
577 Ga0265338_10001208
578 Ga0265338_10001293
579 Ga0265338_10001463
580 Ga0265338_10002516
581 Ga0265338_10019167
582 Ga0265338_10158009
583 Ga0265338_10759298
584 Ga0265324_10001223
585 Ga0265324_10003219
586 Ga0265324_10010532
587 Ga0314311_1210496
588 Ga0316179_1024327
589 Ga0316180_1183998
590 Ga0316183_1010007
591 Ga0316183_1085329
592 Ga0316181_1063761
593 Ga0316182_1038083
594 Ga0316182_1039048
595 Ga0316182_1172812
596 Ga0316182_1407660
597 Ga0265332_10086050
598 Ga0265328_10192455
599 Ga0265320_10016191
600 Ga0265320_10063892
601 Ga0265325_10103630
602 Ga0265325_10182383
603 Ga0265340_10099821
604 Ga0265339_10016298
605 Ga0265339_10016999
606 Ga0265331_10306055
607 Ga0265327_10003538
608 Ga0265327_10003910
609 Ga0265327_10007047
610 Ga0265316_10008024
611 Ga0265316_10024097
612 Ga0265316_10091726
613 Ga0265316_10158774
614 Ga0265313_10052565
615 Ga0265314_10276895
616 Ga0265342_10494736
617 Ga0307516_10000003
618 Ga0307516_10099426
619 Ga0307412_10074807
620 Ga0395899_0072714
621 Ga0395899_0175344
622 Ga0395900_0000520
623 Ga0395900_0007057
624 Ga0395900_0343264
625 Ga0395898_0043006
626 Ga0395905_0294374
627 Ga0395905_0996178
628 Ga0395901_0001401
629 Ga0395901_0061247
630 Ga0395901_0474107
631 Ga0439438_017707
632 Ga0439447_018362
633 Ga0439461_0010680
634 Ga0439461_0012884
635 Ga0439466_0029061
636 Ga0439431_0053227
637 Ga0439442_023638
638 Ga0439445_0002518
639 Ga0439432_001021
640 Ga0450911_008373
641 Ga0450920_000342
642 Ga0450906_004039
643 Ga0439446_0000005
644 Ga0439446_0000181
645 Ga0450909_006297
646 Ga0439434_0018592
647 Ga0450918_037538
648 Ga0466965_0000073
649 Ga0453684_0472975
650 Ga0451576_0078568
651 Ga0451576_0485155
652 Ga0495629_0055644
653 Ga0495638_0000108
654 Ga0495638_0000173
655 Ga0495641_0197987
656 Ga0495662_0041780
657 Ga0495587_0309753
658 Ga0495622_0000051
659 Ga0495634_0110738
660 Ga0495647_0081410
661 Ga0495658_0000721
662 Ga0495671_0110800
663 Ga0495600_0030341
664 Ga0495660_0000035
665 Ga0495672_0000016
666 Ga0496109_0084828
667 Ga0496124_0391795
668 Ga0496125_0305905
669 Ga0501031_0001772
670 Ga0501032_0002880
671 Ga0501034_0000333
672 Ga0501034_0394654
673 Ga0501034_1062986
674 Ga0501036_0001796
675 Ga0501037_0000001
676 Ga0501037_0000141
677 Ga0501038_0010955
678 Ga0501038_0090509
679 Ga0501042_0040028
680 Ga0501043_0000819
681 Ga0501046_0000145
682 Ga0501047_0000375
683 Ga0501048_0000059
684 Ga0501070_0060913
685 Ga0501070_0406770
686 Ga0501070_1086778
687 Ga0501071_0907367
688 Ga0501080_0097130
689 Ga0501083_0032911
690 Ga0501083_0059167
691 Ga0501035_0000821
692 nmdc:mga03683_65041_c1
693 nmdc:mga00v17_331_c1
694 nmdc:mga00v17_856775_c1
695 nmdc:mga0yw44_1346_c1
696 nmdc:mga0yw44_6_c1
697 nmdc:mga0yw44_98_c1
698 nmdc:mga0k408_13130_c1
699 nmdc:mga06z11_1040_c1
700 nmdc:mga06z11_10_c1
701 nmdc:mga04h51_19745_c1
702 nmdc:mga04h51_2_c1
703 nmdc:mga07m45_174232_c1
704 nmdc:mga07m45_23211_c1
705 nmdc:mga07m45_5893_c1
706 nmdc:mga07m45_60411_c1
707 nmdc:mga07m45_9685_c1
708 nmdc:mga0sz30_126660_c1
709 nmdc:mga0sz30_2662_c2
710 Ga0500643_010132
711 Ga0500644_0006597
712 Ga0500646_0000001
713 Ga0500646_0287929
714 Ga0500583_0008694
715 Ga0500583_0026529
716 Ga0500583_0068169
717 Ga0500651_0000019
718 Ga0500566_0000001
719 Ga0500641_0000001
720 Ga0500650_0021017
721 Ga0500569_000004
722 Ga0500593_000001
723 Ga0500594_0000111
724 Ga0500652_000001
725 Ga0500559_0006108
726 Ga0500561_0000001
727 Ga0500588_0000056
728 Ga0500604_0022685
729 Ga0500616_0000067
730 Ga0500616_0009886
731 Ga0500616_0047173
732 Ga0500611_011446

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01765

RRF

Ribosome recycling factor

42

194

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lf9-assembly1.cif.gz_A crystal structure of hiv epitope-scaffold 4e10_d0_1is1a_001_c 0.9358 4 184
1y69-assembly1.cif.gz_8 rrf domain i in complex with the 50s ribosomal subunit from deinococcus radiodurans 0.9267 6 184
5mlc-assembly1.cif.gz_9 cryo-em structure of the spinach chloroplast ribosome reveals the location of plastid-specific ribosomal proteins and extensions 0.9109 102 184
5wp3-assembly1.cif.gz_B crystal structure of eed in complex with eb22 0.9095 105 181
3lhp-assembly1.cif.gz_S crystal structure of hiv epitope-scaffold 4e10_d0_1isea_004_n 4e10 fv complex 0.9074 7 181
ID Description Score Start End Superfamily
af_P0A805_31_105_3.30.1360.40 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2; 0.9814 29 104 3.30.1360.40
1iseA01 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor 0.9808 105 184 1.10.132.20
1is1A01 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor 0.9806 105 184 1.10.132.20
1dd5A01 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor 0.9697 104 184 1.10.132.20
af_P0A805_31_105_3.30.1360.40 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2; 0.9687 29 104 3.30.1360.40
ID Description Score Start End GO Terms
AF-A0A2N1SYG6-F1-model_v4 Ribosome-recycling factor (RRF) (Ribosome-releasing factor) 0.9883 1 184 GO:0005737
GO:0006415
GO:0043023
AF-Q7MIG3-F1-model_v4 Ribosome-recycling factor (RRF) (Ribosome-releasing factor) 0.9879 4 184 GO:0002184
GO:0005829
GO:0043023
AF-A0A2N1SYG6-F1-model_v4 Ribosome-recycling factor (RRF) (Ribosome-releasing factor) 0.983 1 184 GO:0005737
GO:0006415
GO:0043023
AF-A0A554WPI2-F1-model_v4 Ribosome-recycling factor (RRF) (Ribosome-releasing factor) 0.981 4 184 GO:0002184
GO:0005829
GO:0043023
AF-A0A6L8FMD9-F1-model_v4 Ribosome-recycling factor (RRF) (Ribosome-releasing factor) 0.9804 12 184 GO:0005737
GO:0006415
GO:0043023

Map