F424008

General Info

Members Datasets Scaffolds Average Seq Length
366 218 366 226

Family's Representative Sequence

Representative Sequence 3300011119|Ga0105246_10087397|Ga0105246_100873972
Length 257
Sequence VPLAQLRAVYALCPAAASGKIKTTASPKTKTMKFGVIVFPGSNCDHDAFYAIANNLGQPAEFIWHDSTTLGDVDAVILPGGFSYGDYLRCGAIAKFSPVMAAVRKFAADGGLVLGVCNGFQILAEAGLLPGALIRNRGLKFICRELRLSVATTNSPYTSEAQKGQVLRLPIAHGEGCYIADERTLDELEAEDRVAFRYIDNANGSLRNIAGVLNRERNVMGMMPHPERATEPLMGSTDGLVVFQSMLQTTLRSVVLA

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
69 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
70 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
110 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
111 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
112 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
113 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
114 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
115 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
116 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
117 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
118 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
119 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
120 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
121 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
122 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
123 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
124 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
125 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
126 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
127 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
129 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
130 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
131 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
132 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
133 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
134 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
135 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
136 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
137 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
138 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
144 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
149 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
152 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
153 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
154 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
155 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
156 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
157 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
158 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
159 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
164 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
165 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
166 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
167 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
168 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
171 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
172 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
173 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
174 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
175 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
178 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
179 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
180 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
199 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
200 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
201 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
202 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
203 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
204 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
205 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
206 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
207 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
208 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
209 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
212 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
213 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
214 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
215 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
216 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
217 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
218 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.64
Rhizosphere 95.36
Stem 0
Stem Tuber 0
Unclassified 3.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10010337 3300005289 Bacteria 5183
2 Ga0065704_10198675 3300005289 Bacteria 1156
3 Ga0065712_10084797 3300005290 Bacteria 2736
4 Ga0065715_10109406 3300005293 Bacteria 2663
5 Ga0070683_100130092 3300005329 Bacteria 2382
6 Ga0068869_100015977 3300005334 Bacteria 5052
7 Ga0068869_100053083 3300005334 Bacteria 2945
8 Ga0070682_100000076 3300005337 Bacteria 90097
9 Ga0070661_100182850 3300005344 Bacteria 1596
10 Ga0070675_100460419 3300005354 Bacteria 1142
11 Ga0070671_100153508 3300005355 Bacteria 1945
12 Ga0070671_100204449 3300005355 Bacteria 1675
13 Ga0070674_100322237 3300005356 Bacteria 1239
14 Ga0070674_100766316 3300005356 Bacteria 830
15 Ga0070673_100120395 3300005364 Bacteria 2189
16 Ga0070659_100595650 3300005366 Bacteria 949
17 Ga0070714_100213729 3300005435 Bacteria 1769
18 Ga0070713_100011564 3300005436 Bacteria 6433
19 Ga0070713_100153050 3300005436 Bacteria 2053
20 Ga0070713_100228133 3300005436 Bacteria 1692
21 Ga0070713_100236561 3300005436 Bacteria 1662
22 Ga0070711_100406187 3300005439 Unclassified 1106
23 Ga0070705_100329788 3300005440 Bacteria 1105
24 Ga0070708_100012631 3300005445 Bacteria 6898
25 Ga0070708_100505502 3300005445 Bacteria 1140
26 Ga0070678_100070250 3300005456 Bacteria 2617
27 Ga0070681_10263957 3300005458 Bacteria 1634
28 Ga0068867_100396642 3300005459 Bacteria 1163
29 Ga0070679_100265936 3300005530 Bacteria 1670
30 Ga0070684_100089238 3300005535 Bacteria 2740
31 Ga0070684_100888811 3300005535 Bacteria 834
32 Ga0070672_100196211 3300005543 Bacteria 1687
33 Ga0070686_100167702 3300005544 Bacteria 1551
34 Ga0070695_100055335 3300005545 Bacteria 2557
35 Ga0070693_100377938 3300005547 Bacteria 976
36 Ga0070665_100288084 3300005548 Bacteria 1644
37 Ga0068855_100006040 3300005563 Bacteria 14772
38 Ga0068855_100188377 3300005563 Bacteria 2329
39 Ga0068857_100036897 3300005577 Bacteria 4329
40 Ga0068854_100075868 3300005578 Bacteria 2469
41 Ga0068856_100023732 3300005614 Bacteria 5966
42 Ga0068856_100030120 3300005614 Bacteria 5305
43 Ga0070702_100072069 3300005615 Bacteria 2044
44 Ga0068852_100013646 3300005616 Bacteria 6223
45 Ga0068859_100273231 3300005617 Bacteria 1782
46 Ga0068864_100652295 3300005618 Bacteria 1025
47 Ga0068863_100026039 3300005841 Bacteria 5581
48 Ga0068858_100263520 3300005842 Bacteria 1639
49 Ga0068860_100014281 3300005843 Bacteria 7787
50 Ga0070717_10029342 3300006028 Bacteria 4412
51 Ga0070717_10052043 3300006028 Bacteria 3372
52 Ga0070717_10231396 3300006028 Bacteria 1627
53 Ga0070717_10452792 3300006028 Bacteria 1157
54 Ga0070716_100273732 3300006173 Bacteria 1161
55 Ga0097621_100189087 3300006237 Bacteria 1782
56 Ga0097621_100543798 3300006237 Bacteria 1056
57 Ga0068871_100030332 3300006358 Bacteria 4257
58 Ga0068871_100082636 3300006358 Bacteria 2664
59 Ga0068871_100280107 3300006358 Bacteria 1458
60 Ga0068871_100721054 3300006358 Unclassified 915
61 Ga0075430_100065019 3300006846 Bacteria 3065
62 Ga0075431_100012289 3300006847 Bacteria 8640
63 Ga0075434_100365921 3300006871 Bacteria 1463
64 Ga0075434_100987874 3300006871 Bacteria 856
65 Ga0075429_100230489 3300006880 Bacteria 1622
66 Ga0068865_100024552 3300006881 Bacteria 3956
67 Ga0097620_100273216 3300006931 Bacteria 1782
68 Ga0105240_10261350 3300009093 Bacteria 1997
69 Ga0105240_10585222 3300009093 Bacteria 1231
70 Ga0105240_11192156 3300009093 Bacteria 807
71 Ga0105245_10000655 3300009098 Bacteria 31466
72 Ga0105247_10066709 3300009101 Bacteria 2241
73 Ga0114129_10370475 3300009147 Bacteria 1893
74 Ga0105241_10132131 3300009174 Bacteria 2022
75 Ga0105241_10644307 3300009174 Bacteria 962
76 Ga0105242_10325475 3300009176 Bacteria 1411
77 Ga0105242_11078746 3300009176 Bacteria 816
78 Ga0105248_10474888 3300009177 Bacteria 1409
79 Ga0105248_10655208 3300009177 Bacteria 1185
80 Ga0105248_11012402 3300009177 Bacteria 939
81 Ga0105237_10047260 3300009545 Bacteria 4327
82 Ga0105238_10014361 3300009551 Bacteria 8004
83 Ga0105238_10054568 3300009551 Bacteria 4013
84 Ga0105238_10297078 3300009551 Bacteria 1598
85 Ga0105238_11039664 3300009551 Bacteria 841
86 Ga0105239_10011045 3300010375 Bacteria 10082
87 Ga0105246_10087397 3300011119 Bacteria 2237
88 Ga0157374_10062023 3300013296 Bacteria 3503
89 Ga0157374_10179553 3300013296 Bacteria 2067
90 Ga0157374_11137944 3300013296 Bacteria 801
91 Ga0157378_10185038 3300013297 Bacteria 1961
92 Ga0157378_11249478 3300013297 Bacteria 783
93 Ga0163162_10106055 3300013306 Bacteria 2905
94 Ga0163162_10581060 3300013306 Bacteria 1247
95 Ga0163162_10771288 3300013306 Bacteria 1080
96 Ga0157372_10096622 3300013307 Bacteria 3367
97 Ga0157372_11135783 3300013307 Bacteria 904
98 Ga0157375_10858051 3300013308 Bacteria 1054
99 Ga0163163_10004652 3300014325 Bacteria 11731
100 Ga0163163_10171236 3300014325 Bacteria 2218
101 Ga0163163_10202079 3300014325 Bacteria 2036
102 Ga0163163_10405546 3300014325 Bacteria 1421
103 Ga0157376_10070442 3300014969 Bacteria 2968
104 Ga0157376_10129348 3300014969 Bacteria 2251
105 Ga0157376_10245810 3300014969 Bacteria 1669
106 Ga0157376_10304727 3300014969 Bacteria 1509
107 Ga0157376_10366966 3300014969 Bacteria 1382
108 Ga0163161_10156651 3300017792 Bacteria 1734
109 Ga0213872_10000098 3300021361 Bacteria 80168
110 Ga0213875_10003282 3300021388 Bacteria 9264
111 Ga0213875_10014704 3300021388 Bacteria 3816
112 Ga0213875_10046676 3300021388 Bacteria 2032
113 Ga0213871_10019870 3300021441 Bacteria 1658
114 Ga0207688_10021447 3300025901 Bacteria 3529
115 Ga0207699_10321017 3300025906 Bacteria 1086
116 Ga0207684_10010519 3300025910 Bacteria 8138
117 Ga0207654_10598413 3300025911 Bacteria 787
118 Ga0207707_10324032 3300025912 Bacteria 1330
119 Ga0207695_10114671 3300025913 Bacteria 2669
120 Ga0207693_10688144 3300025915 Bacteria 793
121 Ga0207663_10033113 3300025916 Bacteria 3075
122 Ga0207663_10346302 3300025916 Bacteria 1124
123 Ga0207660_10120735 3300025917 Bacteria 1985
124 Ga0207652_10148227 3300025921 Bacteria 2100
125 Ga0207652_10205411 3300025921 Bacteria 1773
126 Ga0207694_10635777 3300025924 Bacteria 899
127 Ga0207650_10538422 3300025925 Bacteria 978
128 Ga0207687_10026756 3300025927 Bacteria 3865
129 Ga0207700_10010781 3300025928 Bacteria 5794
130 Ga0207700_10249265 3300025928 Bacteria 1516
131 Ga0207664_10224645 3300025929 Bacteria 1630
132 Ga0207644_10058990 3300025931 Bacteria 2775
133 Ga0207690_10110738 3300025932 Bacteria 1977
134 Ga0207706_10005016 3300025933 Bacteria 12363
135 Ga0207686_10073713 3300025934 Bacteria 2203
136 Ga0207686_10127245 3300025934 Bacteria 1743
137 Ga0207670_10093297 3300025936 Bacteria 2133
138 Ga0207704_10037548 3300025938 Bacteria 2798
139 Ga0207704_10279329 3300025938 Bacteria 1269
140 Ga0207711_10002440 3300025941 Bacteria 16590
141 Ga0207661_10070315 3300025944 Bacteria 2857
142 Ga0207661_10156509 3300025944 Bacteria 1974
143 Ga0207667_10040381 3300025949 Bacteria 4968
144 Ga0207667_10221193 3300025949 Bacteria 1940
145 Ga0207651_10105340 3300025960 Bacteria 2103
146 Ga0207640_10130381 3300025981 Bacteria 1817
147 Ga0207677_10241836 3300026023 Bacteria 1461
148 Ga0207703_10488722 3300026035 Bacteria 1154
149 Ga0207639_10538164 3300026041 Bacteria 1071
150 Ga0207678_10011858 3300026067 Bacteria 7653
151 Ga0207702_10009948 3300026078 Bacteria 7975
152 Ga0207702_10266937 3300026078 Bacteria 1613
153 Ga0207641_10734694 3300026088 Bacteria 974
154 Ga0207648_10264967 3300026089 Bacteria 1534
155 Ga0207674_10012594 3300026116 Bacteria 9453
156 Ga0207683_10182441 3300026121 Bacteria 1903
157 Ga0207683_10508539 3300026121 Bacteria 1113
158 Ga0207698_10189695 3300026142 Bacteria 1829
159 Ga0268266_10247743 3300028379 Bacteria 1647
160 Ga0268266_10326263 3300028379 Bacteria 1438
161 Ga0268264_10026692 3300028381 Bacteria 4719
162 Ga0265337_1041205 3300028556 Bacteria 1328
163 Ga0265319_1023996 3300028563 Bacteria 2202
164 Ga0265334_10003908 3300028573 Bacteria 6711
165 Ga0265336_10016307 3300028666 Bacteria 2430
166 Ga0265338_10004596 3300028800 Bacteria 18574
167 Ga0265338_10032007 3300028800 Bacteria 5142
168 Ga0265338_10110685 3300028800 Bacteria 2213
169 Ga0265338_10171380 3300028800 Bacteria 1664
170 Ga0265338_10190421 3300028800 Bacteria 1556
171 Ga0265324_10030566 3300029957 Bacteria 1889
172 Ga0265330_10097453 3300031235 Bacteria 1260
173 Ga0265332_10069341 3300031238 Bacteria 1502
174 Ga0265332_10157057 3300031238 Bacteria 951
175 Ga0265320_10002817 3300031240 Bacteria 11964
176 Ga0265320_10038985 3300031240 Bacteria 2379
177 Ga0265329_10054999 3300031242 Bacteria 1263
178 Ga0265340_10130594 3300031247 Bacteria 1152
179 Ga0265339_10291214 3300031249 Bacteria 780
180 Ga0265331_10061401 3300031250 Bacteria 1774
181 Ga0265331_10119755 3300031250 Bacteria 1204
182 Ga0265316_10002004 3300031344 Bacteria 21457
183 Ga0265316_10011185 3300031344 Bacteria 8116
184 Ga0265316_10035576 3300031344 Bacteria 4034
185 Ga0265316_10040654 3300031344 Bacteria 3726
186 Ga0265316_10077267 3300031344 Bacteria 2557
187 Ga0265316_10119906 3300031344 Bacteria 1987
188 Ga0265316_10174041 3300031344 Bacteria 1605
189 Ga0265316_10265754 3300031344 Bacteria 1257
190 Ga0265313_10002452 3300031595 Bacteria 16000
191 Ga0265313_10215604 3300031595 Bacteria 793
192 Ga0265314_10000559 3300031711 Bacteria 47507
193 Ga0265314_10023072 3300031711 Bacteria 4754
194 Ga0265314_10053814 3300031711 Bacteria 2789
195 Ga0265342_10030606 3300031712 Bacteria 3334
196 Ga0265342_10034703 3300031712 Bacteria 3093
197 Ga0265342_10200221 3300031712 Bacteria 1085
198 Ga0373934_0011132 3300035086 Bacteria 3386
199 Ga0373934_0020406 3300035086 Bacteria 2546
200 Ga0373923_0235164 3300035111 Bacteria 855
201 Ga0373936_0155925 3300035113 Bacteria 992
202 Ga0373953_0176696 3300035117 Bacteria 920
203 Ga0373953_0204095 3300035117 Bacteria 855
204 Ga0373954_0006317 3300035118 Bacteria 5165
205 Ga0373954_0019792 3300035118 Bacteria 3038
206 Ga0373956_0020193 3300035119 Bacteria 2832
207 Ga0373956_0045071 3300035119 Bacteria 1967
208 Ga0373956_0109674 3300035119 Bacteria 1284
209 Ga0373943_0119106 3300035170 Bacteria 1401
210 Ga0373946_0265652 3300035171 Bacteria 841
211 Ga0373955_0006092 3300035172 Bacteria 5478
212 Ga0373955_0089980 3300035172 Bacteria 1748
213 Ga0373955_0167470 3300035172 Bacteria 1299
214 Ga0373955_0191555 3300035172 Bacteria 1216
215 Ga0373931_0098492 3300035691 Bacteria 1641
216 Ga0373927_0006802 3300035695 Bacteria 7779
217 Ga0373927_0055465 3300035695 Bacteria 2562
218 Ga0373927_0334980 3300035695 Bacteria 997
219 Ga0373933_0024843 3300035724 Bacteria 3433
220 Ga0373933_0044957 3300035724 Bacteria 2617
221 Ga0373933_0048153 3300035724 Bacteria 2537
222 Ga0373947_0055282 3300035725 Bacteria 2397
223 Ga0373947_0056676 3300035725 Bacteria 2369
224 Ga0373947_0067876 3300035725 Bacteria 2179
225 Ga0373947_0103753 3300035725 Unclassified 1790
226 Ga0373937_0002089 3300036401 Bacteria 16713
227 Ga0373937_0003860 3300036401 Bacteria 12673
228 Ga0373937_0037061 3300036401 Bacteria 4444
229 Ga0373937_0099697 3300036401 Bacteria 2694
230 Ga0373937_0231610 3300036401 Bacteria 1740
231 Ga0373937_0293158 3300036401 Bacteria 1537
232 Ga0373937_0380778 3300036401 Bacteria 1338
233 Ga0373925_0094401 3300037068 Bacteria 2291
234 Ga0373925_0151423 3300037068 Bacteria 1822
235 Ga0373925_0265421 3300037068 Bacteria 1380
236 Ga0373925_0298459 3300037068 Bacteria 1300
237 Ga0373925_0349335 3300037068 Bacteria 1201
238 Ga0373925_0369294 3300037068 Bacteria 1167
239 Ga0436364_0047706 3300037853 Bacteria 8297
240 Ga0436364_0189438 3300037853 Bacteria 2261
241 Ga0436364_0613094 3300037853 Bacteria 3719
242 Ga0436364_0917857 3300037853 Bacteria 3300
243 Ga0436364_1371593 3300037853 Bacteria 7270
244 Ga0436364_1460161 3300037853 Bacteria 2277
245 Ga0436365_0879830 3300039437 Bacteria 1135
246 Ga0436365_1273747 3300039437 Bacteria 2735
247 Ga0436360_0544705 3300039438 Bacteria 19433
248 Ga0436360_1156883 3300039438 Bacteria 1069
249 Ga0436361_0511602 3300039447 Bacteria 24147
250 Ga0451577_0552692 3300042876 Bacteria 1045
251 Ga0451577_0816469 3300042876 Bacteria 842
252 Ga0453683_0279178 3300044673 Bacteria 1067
253 Ga0453683_0352211 3300044673 Bacteria 946
254 Ga0466963_0137894 3300044694 Bacteria 1689
255 Ga0466963_0388402 3300044694 Bacteria 984
256 Ga0466964_0024807 3300044706 Bacteria 2338
257 Ga0453684_0229044 3300044712 Bacteria 2147
258 Ga0453684_0232413 3300044712 Bacteria 2128
259 Ga0453684_1075535 3300044712 Bacteria 851
260 Ga0453684_1201697 3300044712 Bacteria 796
261 Ga0451576_0048289 3300045051 Bacteria 4472
262 Ga0451576_0346314 3300045051 Bacteria 1556
263 Ga0451576_0669321 3300045051 Bacteria 1091
264 Ga0495592_0032051 3300046454 Bacteria 3969
265 Ga0495651_0083325 3300046462 Bacteria 2411
266 Ga0495651_0132053 3300046462 Bacteria 1821
267 Ga0495653_0292929 3300046463 Bacteria 1064
268 Ga0495580_0002855 3300046472 Bacteria 14867
269 Ga0495580_0048904 3300046472 Bacteria 2991
270 Ga0495580_0056399 3300046472 Bacteria 2766
271 Ga0495580_0057895 3300046472 Bacteria 2727
272 Ga0495580_0214519 3300046472 Bacteria 1324
273 Ga0495580_0248784 3300046472 Bacteria 1217
274 Ga0495582_0119944 3300046473 Bacteria 1482
275 Ga0495662_0008985 3300046476 Bacteria 4907
276 Ga0495664_0033947 3300046477 Bacteria 2999
277 Ga0495594_0158264 3300046499 Bacteria 1287
278 Ga0495608_0048346 3300046511 Bacteria 2827
279 Ga0495608_0104566 3300046511 Bacteria 1823
280 Ga0495608_0239507 3300046511 Bacteria 1134
281 Ga0495628_0041767 3300046516 Bacteria 3660
282 Ga0495628_0333826 3300046516 Bacteria 1117
283 Ga0495630_0075814 3300046517 Bacteria 2533
284 Ga0495630_0259793 3300046517 Bacteria 1327
285 Ga0495630_0506297 3300046517 Bacteria 926
286 Ga0495652_0242286 3300046529 Bacteria 1341
287 Ga0495640_0157471 3300046533 Bacteria 1457
288 Ga0495640_0370915 3300046533 Bacteria 881
289 Ga0495586_0278046 3300046535 Bacteria 958
290 Ga0495587_0032911 3300046536 Bacteria 3131
291 Ga0495645_0081980 3300046543 Bacteria 2314
292 Ga0495645_0300484 3300046543 Bacteria 1049
293 Ga0495645_0454308 3300046543 Bacteria 807
294 Ga0495645_0476582 3300046543 Bacteria 783
295 Ga0495667_0365251 3300046559 Bacteria 911
296 Ga0495634_0083878 3300046642 Bacteria 2079
297 Ga0495635_0030319 3300046663 Bacteria 3758
298 Ga0495657_0102738 3300046675 Bacteria 1819
299 Ga0495599_0012738 3300046678 Bacteria 5187
300 Ga0495599_0307803 3300046678 Bacteria 955
301 Ga0495623_0087739 3300046679 Bacteria 1916
302 Ga0495623_0092387 3300046679 Bacteria 1855
303 Ga0495624_0138440 3300046690 Bacteria 1492
304 Ga0495600_0058171 3300046809 Bacteria 2525
305 Ga0495604_0167742 3300047317 Bacteria 1547
306 Ga0495674_0029201 3300047319 Bacteria 5024
307 Ga0495674_0040429 3300047319 Bacteria 4171
308 Ga0495674_0070042 3300047319 Bacteria 3031
309 Ga0495674_0115577 3300047319 Bacteria 2271
310 Ga0495680_0074190 3300047322 Bacteria 2584
311 Ga0495680_0294414 3300047322 Bacteria 1141
312 Ga0495680_0490685 3300047322 Bacteria 835
313 Ga0495675_0119991 3300047444 Bacteria 1638
314 Ga0495684_0019401 3300047471 Bacteria 5235
315 Ga0495684_0035347 3300047471 Bacteria 3832
316 Ga0495684_0068364 3300047471 Bacteria 2701
317 Ga0495602_0252410 3300048088 Bacteria 1314
318 Ga0495602_0265128 3300048088 Bacteria 1272
319 Ga0495602_0455417 3300048088 Bacteria 902
320 Ga0496102_0169896 3300048905 Unclassified 2053
321 Ga0496105_0089109 3300048908 Bacteria 2549
322 Ga0496106_0690219 3300048909 Bacteria 814
323 Ga0496109_0418385 3300048912 Bacteria 1266
324 Ga0496109_0710040 3300048912 Unclassified 943
325 Ga0496115_0251738 3300048918 Bacteria 1454
326 Ga0501031_0001437 3300049568 Bacteria 14766
327 Ga0501032_0000600 3300049569 Bacteria 29121
328 Ga0501033_0079910 3300049570 Bacteria 2399
329 Ga0501033_0183131 3300049570 Bacteria 1501
330 Ga0501034_0007299 3300049571 Bacteria 11784
331 Ga0501036_0000278 3300049572 Bacteria 35218
332 Ga0501037_0004529 3300049573 Bacteria 10101
333 Ga0501037_0037302 3300049573 Bacteria 3583
334 Ga0501038_0006456 3300049574 Bacteria 10856
335 Ga0501038_0062135 3300049574 Bacteria 3192
336 Ga0501039_0100079 3300049575 Bacteria 2262
337 Ga0501043_0002571 3300049579 Bacteria 15351
338 Ga0501043_0043409 3300049579 Bacteria 3534
339 Ga0501046_0014256 3300049580 Bacteria 6713
340 Ga0501047_0001847 3300049581 Bacteria 20412
341 Ga0501047_0009660 3300049581 Bacteria 9117
342 Ga0501048_0006742 3300049582 Bacteria 8725
343 Ga0501067_0007373 3300049583 Bacteria 6109
344 Ga0501068_0004174 3300049584 Bacteria 7835
345 Ga0501069_0004054 3300049585 Bacteria 7564
346 Ga0501070_0029614 3300049586 Bacteria 4588
347 Ga0501070_0044857 3300049586 Bacteria 3677
348 Ga0501071_0317499 3300049587 Bacteria 1183
349 Ga0501072_0004159 3300049588 Bacteria 10955
350 Ga0501073_0023963 3300049589 Bacteria 4382
351 Ga0501074_0027339 3300049590 Bacteria 4136
352 Ga0501076_0101674 3300049592 Bacteria 2317
353 Ga0501077_0009035 3300049593 Bacteria 6187
354 Ga0501079_0011730 3300049741 Bacteria 6693
355 Ga0501080_0017796 3300049742 Bacteria 6577
356 Ga0501035_0067631 3300049822 Bacteria 3169
357 Ga0501044_0025675 3300049823 Bacteria 6245
358 Ga0501044_0876708 3300049823 Unclassified 773
359 nmdc:mga05p37_327073_c1 3300050507 Bacteria 1812
360 nmdc:mga09592_309099_c1 3300050508 Bacteria 1370
361 nmdc:mga0qj67_41192_c1 3300050509 Bacteria 3632
362 nmdc:mga06r32_33077_c1 3300050510 Bacteria 4869
363 Ga0495619_0052306 3300053085 Bacteria 2700
364 Ga0495619_0390042 3300053085 Bacteria 962
365 Ga0501084_0006852 3300054114 Bacteria 9379
366 Ga0501082_0023394 3300060353 Bacteria 5329

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035119 Ga0373956_0109674 Ga0373956_0109674_241_867 206
2 3300005614 Ga0068856_100023732 Ga0068856_1000237323 212
3 3300026078 Ga0207702_10009948 Ga0207702_100099485 212
4 3300048912 Ga0496109_0418385 Ga0496109_0418385_323_967 212
5 3300048918 Ga0496115_0251738 Ga0496115_0251738_165_803 212
6 3300049823 Ga0501044_0876708 Ga0501044_0876708_80_727 212
7 3300044712 Ga0453684_0232413 Ga0453684_0232413_277_957 215
8 3300035117 Ga0373953_0176696 Ga0373953_0176696_254_910 216
9 3300006846 Ga0075430_100065019 Ga0075430_1000650192 221
10 3300006847 Ga0075431_100012289 Ga0075431_1000122898 221
11 3300006880 Ga0075429_100230489 Ga0075429_1002304892 221
12 3300009147 Ga0114129_10370475 Ga0114129_103704754 221
13 3300009177 Ga0105248_10655208 Ga0105248_106552081 221
14 3300014325 Ga0163163_10202079 Ga0163163_102020792 221
15 3300031344 Ga0265316_10174041 Ga0265316_101740412 221
16 3300050507 nmdc:mga05p37_327073_c1 nmdc:mga05p37_327073_c1_170_850 221
17 3300050508 nmdc:mga09592_309099_c1 nmdc:mga09592_309099_c1_269_949 221
18 3300050509 nmdc:mga0qj67_41192_c1 nmdc:mga0qj67_41192_c1_688_1368 221
19 3300050510 nmdc:mga06r32_33077_c1 nmdc:mga06r32_33077_c1_3931_4611 221
20 3300005329 Ga0070683_100130092 Ga0070683_1001300922 222
21 3300005334 Ga0068869_100015977 Ga0068869_1000159778 222
22 3300005334 Ga0068869_100053083 Ga0068869_1000530831 222
23 3300005344 Ga0070661_100182850 Ga0070661_1001828502 222
24 3300005354 Ga0070675_100460419 Ga0070675_1004604192 222
25 3300005355 Ga0070671_100153508 Ga0070671_1001535082 222
26 3300005364 Ga0070673_100120395 Ga0070673_1001203952 222
27 3300005366 Ga0070659_100595650 Ga0070659_1005956502 222
28 3300005435 Ga0070714_100213729 Ga0070714_1002137292 222
29 3300005436 Ga0070713_100011564 Ga0070713_1000115643 222
30 3300005436 Ga0070713_100153050 Ga0070713_1001530502 222
31 3300005436 Ga0070713_100228133 Ga0070713_1002281332 222
32 3300005436 Ga0070713_100236561 Ga0070713_1002365612 222
33 3300005456 Ga0070678_100070250 Ga0070678_1000702502 222
34 3300005458 Ga0070681_10263957 Ga0070681_102639572 222
35 3300005459 Ga0068867_100396642 Ga0068867_1003966422 222
36 3300005530 Ga0070679_100265936 Ga0070679_1002659362 222
37 3300005535 Ga0070684_100089238 Ga0070684_1000892383 222
38 3300005535 Ga0070684_100888811 Ga0070684_1008888111 222
39 3300005543 Ga0070672_100196211 Ga0070672_1001962112 222
40 3300005545 Ga0070695_100055335 Ga0070695_1000553353 222
41 3300005547 Ga0070693_100377938 Ga0070693_1003779382 222
42 3300005563 Ga0068855_100006040 Ga0068855_10000604011 222
43 3300005563 Ga0068855_100188377 Ga0068855_1001883772 222
44 3300005577 Ga0068857_100036897 Ga0068857_1000368976 222
45 3300005578 Ga0068854_100075868 Ga0068854_1000758682 222
46 3300005614 Ga0068856_100030120 Ga0068856_1000301202 222
47 3300005615 Ga0070702_100072069 Ga0070702_1000720692 222
48 3300005616 Ga0068852_100013646 Ga0068852_1000136462 222
49 3300005617 Ga0068859_100273231 Ga0068859_1002732311 222
50 3300005618 Ga0068864_100652295 Ga0068864_1006522951 222
51 3300005842 Ga0068858_100263520 Ga0068858_1002635202 222
52 3300005843 Ga0068860_100014281 Ga0068860_1000142814 222
53 3300006028 Ga0070717_10029342 Ga0070717_100293423 222
54 3300006028 Ga0070717_10052043 Ga0070717_100520433 222
55 3300006028 Ga0070717_10452792 Ga0070717_104527922 222
56 3300006173 Ga0070716_100273732 Ga0070716_1002737321 222
57 3300006237 Ga0097621_100189087 Ga0097621_1001890871 222
58 3300006237 Ga0097621_100543798 Ga0097621_1005437981 222
59 3300006358 Ga0068871_100030332 Ga0068871_1000303325 222
60 3300006358 Ga0068871_100280107 Ga0068871_1002801071 222
61 3300006358 Ga0068871_100721054 Ga0068871_1007210541 222
62 3300006871 Ga0075434_100987874 Ga0075434_1009878741 222
63 3300006881 Ga0068865_100024552 Ga0068865_1000245523 222
64 3300006931 Ga0097620_100273216 Ga0097620_1002732161 222
65 3300009093 Ga0105240_10261350 Ga0105240_102613502 222
66 3300009093 Ga0105240_10585222 Ga0105240_105852222 222
67 3300009093 Ga0105240_11192156 Ga0105240_111921561 222
68 3300009098 Ga0105245_10000655 Ga0105245_1000065521 222
69 3300009101 Ga0105247_10066709 Ga0105247_100667092 222
70 3300009174 Ga0105241_10132131 Ga0105241_101321312 222
71 3300009174 Ga0105241_10644307 Ga0105241_106443071 222
72 3300009176 Ga0105242_10325475 Ga0105242_103254751 222
73 3300009176 Ga0105242_11078746 Ga0105242_110787462 222
74 3300009177 Ga0105248_10474888 Ga0105248_104748882 222
75 3300009177 Ga0105248_11012402 Ga0105248_110124021 222
76 3300009545 Ga0105237_10047260 Ga0105237_100472602 222
77 3300009551 Ga0105238_10014361 Ga0105238_100143612 222
78 3300009551 Ga0105238_10054568 Ga0105238_100545682 222
79 3300009551 Ga0105238_10297078 Ga0105238_102970783 222
80 3300009551 Ga0105238_11039664 Ga0105238_110396642 222
81 3300010375 Ga0105239_10011045 Ga0105239_100110458 222
82 3300013296 Ga0157374_10062023 Ga0157374_100620232 222
83 3300013296 Ga0157374_11137944 Ga0157374_111379441 222
84 3300013297 Ga0157378_10185038 Ga0157378_101850381 222
85 3300013297 Ga0157378_11249478 Ga0157378_112494781 222
86 3300013306 Ga0163162_10581060 Ga0163162_105810601 222
87 3300013306 Ga0163162_10771288 Ga0163162_107712881 222
88 3300013307 Ga0157372_10096622 Ga0157372_100966224 222
89 3300013307 Ga0157372_11135783 Ga0157372_111357832 222
90 3300013308 Ga0157375_10858051 Ga0157375_108580512 222
91 3300014325 Ga0163163_10171236 Ga0163163_101712362 222
92 3300014325 Ga0163163_10405546 Ga0163163_104055463 222
93 3300014969 Ga0157376_10129348 Ga0157376_101293484 222
94 3300014969 Ga0157376_10304727 Ga0157376_103047272 222
95 3300014969 Ga0157376_10366966 Ga0157376_103669662 222
96 3300017792 Ga0163161_10156651 Ga0163161_101566512 222
97 3300021361 Ga0213872_10000098 Ga0213872_1000009841 222
98 3300021388 Ga0213875_10014704 Ga0213875_100147042 222
99 3300021388 Ga0213875_10046676 Ga0213875_100466762 222
100 3300021441 Ga0213871_10019870 Ga0213871_100198702 222
101 3300025911 Ga0207654_10598413 Ga0207654_105984131 222
102 3300025912 Ga0207707_10324032 Ga0207707_103240322 222
103 3300025913 Ga0207695_10114671 Ga0207695_101146712 222
104 3300025916 Ga0207663_10033113 Ga0207663_100331132 222
105 3300025917 Ga0207660_10120735 Ga0207660_101207352 222
106 3300025921 Ga0207652_10148227 Ga0207652_101482272 222
107 3300025921 Ga0207652_10205411 Ga0207652_102054112 222
108 3300025924 Ga0207694_10635777 Ga0207694_106357771 222
109 3300025925 Ga0207650_10538422 Ga0207650_105384222 222
110 3300025927 Ga0207687_10026756 Ga0207687_100267562 222
111 3300025928 Ga0207700_10010781 Ga0207700_100107813 222
112 3300025928 Ga0207700_10249265 Ga0207700_102492652 222
113 3300025929 Ga0207664_10224645 Ga0207664_102246452 222
114 3300025931 Ga0207644_10058990 Ga0207644_100589902 222
115 3300025932 Ga0207690_10110738 Ga0207690_101107383 222
116 3300025934 Ga0207686_10073713 Ga0207686_100737132 222
117 3300025934 Ga0207686_10127245 Ga0207686_101272451 222
118 3300025938 Ga0207704_10037548 Ga0207704_100375482 222
119 3300025938 Ga0207704_10279329 Ga0207704_102793292 222
120 3300025941 Ga0207711_10002440 Ga0207711_1000244012 222
121 3300025944 Ga0207661_10070315 Ga0207661_100703152 222
122 3300025944 Ga0207661_10156509 Ga0207661_101565092 222
123 3300025949 Ga0207667_10040381 Ga0207667_100403814 222
124 3300025949 Ga0207667_10221193 Ga0207667_102211932 222
125 3300025960 Ga0207651_10105340 Ga0207651_101053402 222
126 3300026023 Ga0207677_10241836 Ga0207677_102418362 222
127 3300026035 Ga0207703_10488722 Ga0207703_104887222 222
128 3300026041 Ga0207639_10538164 Ga0207639_105381642 222
129 3300026078 Ga0207702_10266937 Ga0207702_102669372 222
130 3300026089 Ga0207648_10264967 Ga0207648_102649672 222
131 3300026116 Ga0207674_10012594 Ga0207674_100125942 222
132 3300026121 Ga0207683_10508539 Ga0207683_105085392 222
133 3300026142 Ga0207698_10189695 Ga0207698_101896952 222
134 3300028379 Ga0268266_10326263 Ga0268266_103262632 222
135 3300028381 Ga0268264_10026692 Ga0268264_100266923 222
136 3300028800 Ga0265338_10032007 Ga0265338_100320072 222
137 3300031235 Ga0265330_10097453 Ga0265330_100974531 222
138 3300031238 Ga0265332_10069341 Ga0265332_100693412 222
139 3300031238 Ga0265332_10157057 Ga0265332_101570572 222
140 3300031240 Ga0265320_10002817 Ga0265320_100028173 222
141 3300031242 Ga0265329_10054999 Ga0265329_100549992 222
142 3300031247 Ga0265340_10130594 Ga0265340_101305942 222
143 3300031249 Ga0265339_10291214 Ga0265339_102912141 222
144 3300031250 Ga0265331_10061401 Ga0265331_100614012 222
145 3300031250 Ga0265331_10119755 Ga0265331_101197552 222
146 3300031344 Ga0265316_10002004 Ga0265316_1000200414 222
147 3300031344 Ga0265316_10011185 Ga0265316_100111852 222
148 3300031344 Ga0265316_10035576 Ga0265316_100355763 222
149 3300031344 Ga0265316_10040654 Ga0265316_100406542 222
150 3300031344 Ga0265316_10077267 Ga0265316_100772675 222
151 3300031344 Ga0265316_10119906 Ga0265316_101199063 222
152 3300031595 Ga0265313_10002452 Ga0265313_100024528 222
153 3300031595 Ga0265313_10215604 Ga0265313_102156041 222
154 3300031711 Ga0265314_10000559 Ga0265314_1000055911 222
155 3300031711 Ga0265314_10023072 Ga0265314_100230723 222
156 3300031712 Ga0265342_10030606 Ga0265342_100306061 222
157 3300031712 Ga0265342_10034703 Ga0265342_100347032 222
158 3300031712 Ga0265342_10200221 Ga0265342_102002211 222
159 3300035086 Ga0373934_0011132 Ga0373934_0011132_1842_2516 222
160 3300035086 Ga0373934_0020406 Ga0373934_0020406_1250_1942 222
161 3300035113 Ga0373936_0155925 Ga0373936_0155925_217_891 222
162 3300035117 Ga0373953_0204095 Ga0373953_0204095_49_738 222
163 3300035118 Ga0373954_0006317 Ga0373954_0006317_2742_3416 222
164 3300035118 Ga0373954_0019792 Ga0373954_0019792_2139_2813 222
165 3300035119 Ga0373956_0020193 Ga0373956_0020193_1002_1670 222
166 3300035119 Ga0373956_0045071 Ga0373956_0045071_1062_1736 222
167 3300035172 Ga0373955_0006092 Ga0373955_0006092_4755_5429 222
168 3300035172 Ga0373955_0089980 Ga0373955_0089980_526_1200 222
169 3300035172 Ga0373955_0167470 Ga0373955_0167470_576_1244 222
170 3300035172 Ga0373955_0191555 Ga0373955_0191555_266_955 222
171 3300035695 Ga0373927_0006802 Ga0373927_0006802_323_1015 222
172 3300035695 Ga0373927_0055465 Ga0373927_0055465_564_1250 222
173 3300035695 Ga0373927_0334980 Ga0373927_0334980_197_871 222
174 3300035724 Ga0373933_0024843 Ga0373933_0024843_1511_2179 222
175 3300035724 Ga0373933_0044957 Ga0373933_0044957_1594_2268 222
176 3300035724 Ga0373933_0048153 Ga0373933_0048153_1281_1955 222
177 3300035725 Ga0373947_0055282 Ga0373947_0055282_922_1614 222
178 3300035725 Ga0373947_0056676 Ga0373947_0056676_1176_1850 222
179 3300036401 Ga0373937_0002089 Ga0373937_0002089_1741_2415 222
180 3300036401 Ga0373937_0003860 Ga0373937_0003860_5936_6610 222
181 3300036401 Ga0373937_0037061 Ga0373937_0037061_1416_2108 222
182 3300036401 Ga0373937_0099697 Ga0373937_0099697_82_756 222
183 3300036401 Ga0373937_0231610 Ga0373937_0231610_238_924 222
184 3300036401 Ga0373937_0293158 Ga0373937_0293158_738_1406 222
185 3300037068 Ga0373925_0094401 Ga0373925_0094401_1027_1695 222
186 3300037068 Ga0373925_0151423 Ga0373925_0151423_307_993 222
187 3300037068 Ga0373925_0265421 Ga0373925_0265421_199_867 222
188 3300037068 Ga0373925_0349335 Ga0373925_0349335_236_904 222
189 3300037068 Ga0373925_0369294 Ga0373925_0369294_257_931 222
190 3300037853 Ga0436364_0613094 Ga0436364_0613094_2752_3450 222
191 3300037853 Ga0436364_1371593 Ga0436364_1371593_5602_6270 222
192 3300037853 Ga0436364_1460161 Ga0436364_1460161_1098_1781 222
193 3300039437 Ga0436365_0879830 Ga0436365_0879830_452_1120 222
194 3300039437 Ga0436365_1273747 Ga0436365_1273747_1036_1704 222
195 3300039438 Ga0436360_0544705 Ga0436360_0544705_1329_2006 222
196 3300039438 Ga0436360_1156883 Ga0436360_1156883_60_737 222
197 3300039447 Ga0436361_0511602 Ga0436361_0511602_1208_1885 222
198 3300042876 Ga0451577_0552692 Ga0451577_0552692_202_873 222
199 3300042876 Ga0451577_0816469 Ga0451577_0816469_164_832 222
200 3300044673 Ga0453683_0279178 Ga0453683_0279178_14_682 222
201 3300044673 Ga0453683_0352211 Ga0453683_0352211_129_797 222
202 3300044694 Ga0466963_0137894 Ga0466963_0137894_909_1589 222
203 3300044694 Ga0466963_0388402 Ga0466963_0388402_258_926 222
204 3300044712 Ga0453684_0229044 Ga0453684_0229044_169_840 222
205 3300044712 Ga0453684_1201697 Ga0453684_1201697_22_693 222
206 3300045051 Ga0451576_0048289 Ga0451576_0048289_1525_2193 222
207 3300045051 Ga0451576_0346314 Ga0451576_0346314_339_1010 222
208 3300045051 Ga0451576_0669321 Ga0451576_0669321_153_821 222
209 3300046454 Ga0495592_0032051 Ga0495592_0032051_2833_3501 222
210 3300046462 Ga0495651_0083325 Ga0495651_0083325_1250_1918 222
211 3300046462 Ga0495651_0132053 Ga0495651_0132053_180_848 222
212 3300046463 Ga0495653_0292929 Ga0495653_0292929_234_902 222
213 3300046472 Ga0495580_0002855 Ga0495580_0002855_13852_14520 222
214 3300046472 Ga0495580_0048904 Ga0495580_0048904_1602_2270 222
215 3300046472 Ga0495580_0056399 Ga0495580_0056399_1679_2365 222
216 3300046472 Ga0495580_0057895 Ga0495580_0057895_1570_2244 222
217 3300046472 Ga0495580_0248784 Ga0495580_0248784_329_997 222
218 3300046473 Ga0495582_0119944 Ga0495582_0119944_460_1152 222
219 3300046476 Ga0495662_0008985 Ga0495662_0008985_1963_2631 222
220 3300046477 Ga0495664_0033947 Ga0495664_0033947_1698_2366 222
221 3300046511 Ga0495608_0048346 Ga0495608_0048346_1195_1863 222
222 3300046511 Ga0495608_0104566 Ga0495608_0104566_785_1459 222
223 3300046511 Ga0495608_0239507 Ga0495608_0239507_91_759 222
224 3300046516 Ga0495628_0041767 Ga0495628_0041767_2141_2809 222
225 3300046516 Ga0495628_0333826 Ga0495628_0333826_29_727 222
226 3300046517 Ga0495630_0075814 Ga0495630_0075814_638_1306 222
227 3300046517 Ga0495630_0259793 Ga0495630_0259793_468_1136 222
228 3300046517 Ga0495630_0506297 Ga0495630_0506297_14_706 222
229 3300046529 Ga0495652_0242286 Ga0495652_0242286_660_1328 222
230 3300046533 Ga0495640_0370915 Ga0495640_0370915_63_731 222
231 3300046535 Ga0495586_0278046 Ga0495586_0278046_211_879 222
232 3300046536 Ga0495587_0032911 Ga0495587_0032911_2197_2865 222
233 3300046543 Ga0495645_0081980 Ga0495645_0081980_1233_1901 222
234 3300046543 Ga0495645_0300484 Ga0495645_0300484_205_873 222
235 3300046543 Ga0495645_0454308 Ga0495645_0454308_96_764 222
236 3300046543 Ga0495645_0476582 Ga0495645_0476582_94_762 222
237 3300046559 Ga0495667_0365251 Ga0495667_0365251_159_833 222
238 3300046642 Ga0495634_0083878 Ga0495634_0083878_776_1444 222
239 3300046663 Ga0495635_0030319 Ga0495635_0030319_1035_1703 222
240 3300046675 Ga0495657_0102738 Ga0495657_0102738_676_1344 222
241 3300046678 Ga0495599_0012738 Ga0495599_0012738_3055_3723 222
242 3300046678 Ga0495599_0307803 Ga0495599_0307803_193_867 222
243 3300046679 Ga0495623_0087739 Ga0495623_0087739_253_921 222
244 3300046679 Ga0495623_0092387 Ga0495623_0092387_880_1548 222
245 3300046690 Ga0495624_0138440 Ga0495624_0138440_519_1190 222
246 3300046809 Ga0495600_0058171 Ga0495600_0058171_1647_2315 222
247 3300047319 Ga0495674_0029201 Ga0495674_0029201_2923_3591 222
248 3300047319 Ga0495674_0070042 Ga0495674_0070042_266_934 222
249 3300047319 Ga0495674_0115577 Ga0495674_0115577_466_1152 222
250 3300047322 Ga0495680_0074190 Ga0495680_0074190_783_1451 222
251 3300047322 Ga0495680_0294414 Ga0495680_0294414_15_683 222
252 3300047322 Ga0495680_0490685 Ga0495680_0490685_34_702 222
253 3300047444 Ga0495675_0119991 Ga0495675_0119991_541_1209 222
254 3300047471 Ga0495684_0019401 Ga0495684_0019401_3960_4628 222
255 3300047471 Ga0495684_0035347 Ga0495684_0035347_2222_2896 222
256 3300047471 Ga0495684_0068364 Ga0495684_0068364_373_1065 222
257 3300048088 Ga0495602_0252410 Ga0495602_0252410_28_702 222
258 3300048088 Ga0495602_0265128 Ga0495602_0265128_33_701 222
259 3300048088 Ga0495602_0455417 Ga0495602_0455417_33_707 222
260 3300048909 Ga0496106_0690219 Ga0496106_0690219_54_728 222
261 3300049570 Ga0501033_0183131 Ga0501033_0183131_216_908 222
262 3300049573 Ga0501037_0037302 Ga0501037_0037302_2328_3020 222
263 3300049574 Ga0501038_0062135 Ga0501038_0062135_1496_2188 222
264 3300049579 Ga0501043_0043409 Ga0501043_0043409_381_1073 222
265 3300049581 Ga0501047_0001847 Ga0501047_0001847_13000_13692 222
266 3300049586 Ga0501070_0029614 Ga0501070_0029614_33_725 222
267 3300053085 Ga0495619_0052306 Ga0495619_0052306_677_1345 222
268 3300053085 Ga0495619_0390042 Ga0495619_0390042_271_945 222
269 3300005445 Ga0070708_100505502 Ga0070708_1005055022 223
270 3300036401 Ga0373937_0380778 Ga0373937_0380778_460_1131 223
271 3300005445 Ga0070708_100012631 Ga0070708_1000126313 224
272 3300026067 Ga0207678_10011858 Ga0207678_100118582 224
273 3300037853 Ga0436364_0189438 Ga0436364_0189438_857_1537 224
274 3300044712 Ga0453684_1075535 Ga0453684_1075535_66_740 224
275 3300049568 Ga0501031_0001437 Ga0501031_0001437_4753_5427 224
276 3300049569 Ga0501032_0000600 Ga0501032_0000600_22475_23149 224
277 3300049570 Ga0501033_0079910 Ga0501033_0079910_1517_2191 224
278 3300049571 Ga0501034_0007299 Ga0501034_0007299_3252_3926 224
279 3300049572 Ga0501036_0000278 Ga0501036_0000278_10793_11467 224
280 3300049573 Ga0501037_0004529 Ga0501037_0004529_4740_5414 224
281 3300049574 Ga0501038_0006456 Ga0501038_0006456_3565_4239 224
282 3300049575 Ga0501039_0100079 Ga0501039_0100079_367_1041 224
283 3300049579 Ga0501043_0002571 Ga0501043_0002571_10665_11339 224
284 3300049580 Ga0501046_0014256 Ga0501046_0014256_4729_5403 224
285 3300049581 Ga0501047_0009660 Ga0501047_0009660_2183_2857 224
286 3300049582 Ga0501048_0006742 Ga0501048_0006742_6229_6903 224
287 3300049583 Ga0501067_0007373 Ga0501067_0007373_3830_4504 224
288 3300049584 Ga0501068_0004174 Ga0501068_0004174_3802_4476 224
289 3300049585 Ga0501069_0004054 Ga0501069_0004054_2204_2878 224
290 3300049586 Ga0501070_0044857 Ga0501070_0044857_1478_2152 224
291 3300049587 Ga0501071_0317499 Ga0501071_0317499_119_793 224
292 3300049588 Ga0501072_0004159 Ga0501072_0004159_1606_2280 224
293 3300049589 Ga0501073_0023963 Ga0501073_0023963_1526_2200 224
294 3300049590 Ga0501074_0027339 Ga0501074_0027339_1280_1954 224
295 3300049592 Ga0501076_0101674 Ga0501076_0101674_1250_1924 224
296 3300049593 Ga0501077_0009035 Ga0501077_0009035_4939_5613 224
297 3300049741 Ga0501079_0011730 Ga0501079_0011730_5341_6015 224
298 3300049742 Ga0501080_0017796 Ga0501080_0017796_2652_3326 224
299 3300049822 Ga0501035_0067631 Ga0501035_0067631_842_1516 224
300 3300049823 Ga0501044_0025675 Ga0501044_0025675_2320_2994 224
301 3300054114 Ga0501084_0006852 Ga0501084_0006852_1606_2280 224
302 3300060353 Ga0501082_0023394 Ga0501082_0023394_337_1011 224
303 3300005544 Ga0070686_100167702 Ga0070686_1001677022 225
304 3300005841 Ga0068863_100026039 Ga0068863_1000260393 225
305 3300011119 Ga0105246_10087397 Ga0105246_100873972 225
306 3300013296 Ga0157374_10179553 Ga0157374_101795532 225
307 3300013306 Ga0163162_10106055 Ga0163162_101060552 225
308 3300014325 Ga0163163_10004652 Ga0163163_100046529 225
309 3300014969 Ga0157376_10245810 Ga0157376_102458102 225
310 3300021388 Ga0213875_10003282 Ga0213875_100032825 225
311 3300025916 Ga0207663_10346302 Ga0207663_103463022 225
312 3300025936 Ga0207670_10093297 Ga0207670_100932971 225
313 3300026088 Ga0207641_10734694 Ga0207641_107346941 225
314 3300035171 Ga0373946_0265652 Ga0373946_0265652_146_826 225
315 3300037853 Ga0436364_0047706 Ga0436364_0047706_5072_5758 225
316 3300037853 Ga0436364_0917857 Ga0436364_0917857_2358_3047 225
317 3300046499 Ga0495594_0158264 Ga0495594_0158264_224_904 225
318 3300046533 Ga0495640_0157471 Ga0495640_0157471_703_1383 225
319 3300047317 Ga0495604_0167742 Ga0495604_0167742_207_887 225
320 3300047319 Ga0495674_0040429 Ga0495674_0040429_92_772 225
321 3300005548 Ga0070665_100288084 Ga0070665_1002880843 226
322 3300028379 Ga0268266_10247743 Ga0268266_102477433 226
323 3300031344 Ga0265316_10265754 Ga0265316_102657542 227
324 3300005289 Ga0065704_10198675 Ga0065704_101986752 231
325 3300005337 Ga0070682_100000076 Ga0070682_10000007692 231
326 3300005440 Ga0070705_100329788 Ga0070705_1003297882 231
327 3300025910 Ga0207684_10010519 Ga0207684_100105197 231
328 3300028556 Ga0265337_1041205 Ga0265337_10412053 231
329 3300028563 Ga0265319_1023996 Ga0265319_10239962 231
330 3300028573 Ga0265334_10003908 Ga0265334_100039085 231
331 3300028666 Ga0265336_10016307 Ga0265336_100163073 231
332 3300028800 Ga0265338_10004596 Ga0265338_100045969 231
333 3300028800 Ga0265338_10110685 Ga0265338_101106853 231
334 3300028800 Ga0265338_10171380 Ga0265338_101713802 231
335 3300028800 Ga0265338_10190421 Ga0265338_101904212 231
336 3300029957 Ga0265324_10030566 Ga0265324_100305662 231
337 3300031240 Ga0265320_10038985 Ga0265320_100389853 231
338 3300031711 Ga0265314_10053814 Ga0265314_100538141 231
339 3300005355 Ga0070671_100204449 Ga0070671_1002044492 236
340 3300005356 Ga0070674_100322237 Ga0070674_1003222372 236
341 3300014969 Ga0157376_10070442 Ga0157376_100704424 236
342 3300026121 Ga0207683_10182441 Ga0207683_101824412 236
343 3300035725 Ga0373947_0103753 Ga0373947_0103753_449_1159 236
344 3300005289 Ga0065704_10010337 Ga0065704_100103375 237
345 3300005290 Ga0065712_10084797 Ga0065712_100847971 237
346 3300005293 Ga0065715_10109406 Ga0065715_101094064 237
347 3300005356 Ga0070674_100766316 Ga0070674_1007663161 237
348 3300005439 Ga0070711_100406187 Ga0070711_1004061872 237
349 3300006028 Ga0070717_10231396 Ga0070717_102313962 237
350 3300006358 Ga0068871_100082636 Ga0068871_1000826363 237
351 3300006871 Ga0075434_100365921 Ga0075434_1003659212 237
352 3300025901 Ga0207688_10021447 Ga0207688_100214474 237
353 3300025906 Ga0207699_10321017 Ga0207699_103210171 237
354 3300025915 Ga0207693_10688144 Ga0207693_106881441 237
355 3300025933 Ga0207706_10005016 Ga0207706_100050165 237
356 3300025981 Ga0207640_10130381 Ga0207640_101303812 237
357 3300035111 Ga0373923_0235164 Ga0373923_0235164_79_792 237
358 3300035170 Ga0373943_0119106 Ga0373943_0119106_183_896 237
359 3300035691 Ga0373931_0098492 Ga0373931_0098492_327_1040 237
360 3300035725 Ga0373947_0067876 Ga0373947_0067876_261_974 237
361 3300037068 Ga0373925_0298459 Ga0373925_0298459_227_940 237
362 3300044706 Ga0466964_0024807 Ga0466964_0024807_57_797 237
363 3300046472 Ga0495580_0214519 Ga0495580_0214519_498_1211 237
364 3300048905 Ga0496102_0169896 Ga0496102_0169896_455_1168 237
365 3300048908 Ga0496105_0089109 Ga0496105_0089109_752_1465 237
366 3300048912 Ga0496109_0710040 Ga0496109_0710040_15_776 237

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13507

GATase_5

CobB/CobQ-like glutamine amidotransferase domain

31

239

0.93

PF01965

DJ-1_PfpI

DJ-1/PfpI family

57

134

0.85

PF07685

GATase_3

CobB/CobQ-like glutamine amidotransferase domain

42

132

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d54-assembly3.cif.gz_D structure of purlqs from thermotoga maritima 0.9309 2 226
3d54-assembly3.cif.gz_D structure of purlqs from thermotoga maritima 0.9097 2 226
6lyl-assembly1.cif.gz_A crystal structure of s1052d mutant of formylglycinamidine synthetase 0.8654 2 222
4lgy-assembly1.cif.gz_A importance of hydrophobic cavities in allosteric regulation of formylglycinamide synthetase: insight from xenon trapping and statistical coupling analysis 0.8471 2 227
4l78-assembly1.cif.gz_A xenon trapping and statistical coupling analysis uncover regions important for structure and function of multidomain protein stpurl 0.8428 2 227
ID Description Score Start End Superfamily
af_Q59042_1_229_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9568 1 226 3.40.50.880
af_Q2FZJ1_1_219_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9497 1 226 3.40.50.880
af_P9WHL5_1_222_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9472 2 226 3.40.50.880
af_Q2FZJ1_1_219_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9413 1 226 3.40.50.880
af_Q59042_1_229_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9405 1 226 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A1Q8BNV2-F1-model_v4 Phosphoribosylformylglycinamidine synthase I 0.9887 72 233 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0016787
AF-A0A2V6F1K3-F1-model_v4 Phosphoribosylformylglycinamidine synthase I 0.9829 117 230 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0016787
AF-A0A2V6NQQ8-F1-model_v4 Phosphoribosylformylglycinamidine synthase I 0.9808 122 235 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0016787
AF-A0A533Y5Y1-F1-model_v4 Phosphoribosylformylglycinamidine synthase I 0.9799 146 234 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0016787
AF-X1CA12-F1-model_v4 Uncharacterized protein 0.9794 81 215 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0016787

Feature Viewer

pLDDT pTM Quality
93.37 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map