F424022

General Info

Members Datasets Scaffolds Average Seq Length
366 149 345 547

Family's Representative Sequence

Representative Sequence 3300015261|Ga0182006_1000212|Ga0182006_100021225
Length 575
Sequence MTYTRWTKLSLALTTAITLAATGGNAAAQATGVKKKGPPRIEVPRQAKPFLWENATVYFVLTDRFNNAFTGNDLAYGREKDAAPLRGFMGGDLAGLINKINDGYFDALGVNAIWLTPPVEQIHAGTDEGTGKSYGFHGYWARDFTTVDANLGTENDFRNFVEAAHARGIRVILDVVMNHTGPVTRIDPVWPQDWVRTDPTCTYKDAKTTIDCTLVKNLPDIRTDSDAEVELPPQLVEKWRREGRYTQQMKELDEFFAKTGYPRAPRYYLMKWHADWIRKFGVDGFRADTVKHVEPKVWKELRTVADAAYEDWKHANPDKKLGDKFYMTAEVYNYDIAHGQTHDLGGGTIANYYQQGFDSLINFGLVRDANQDYEALFSSYSNLLHGGALQGYSVLNYIDSHDYEPPFDAARKRPFESATKLLLAPGAAQIYYGDETARQLDVLEATGDAKLRSFMNWDELAQNTQRDGYKVGDVYTHWSKLGQFRRAHVAVGAGVHQQLQAQPYVFKRTYDKDGLRDQVVVALDLPTDKASAIKVHGVFANGQKVRDYYSGKSAVVRGGSVNFGTRNPIVLIGQE

Samples

Sample ID Description Type Environment
1 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
2 2643221638 Duganella sp. Root336D2 Isolate Unclassified
3 2643221645 Massilia sp. Root351 Isolate Unclassified
4 2643221664 Massilia sp. Root418 Isolate Unclassified
5 2738541280 Massilia sp. GV090 Isolate Unclassified
6 2738541297 Duganella sp. GV083 Isolate Unclassified
7 2738541300 Massilia sp. GV016 Isolate Unclassified
8 2738541357 Duganella sp. GV053 Isolate Unclassified
9 2738543003 Duganella sp. GV066 Isolate Unclassified
10 2738543018 Massilia sp. GV045 Isolate Unclassified
11 2738543026 Duganella sp. GV089 Isolate Unclassified
12 2738543029 Duganella sp. GV039 Isolate Unclassified
13 2738543030 Massilia sp. GV097 Isolate Unclassified
14 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
15 2821131069 Duganella sp. 1224 Isolate Unclassified
16 2842711865 Duganella sp. R-73148 Isolate Unclassified
17 2857553236 Duganella sp. R-74557 Isolate Unclassified
18 2857558681 Duganella sp. R-74565 Isolate Unclassified
19 2857564685 Duganella sp. R-74599 Isolate Unclassified
20 2904424332 Duganella sp. 1411 Isolate Rhizosphere
21 2919476304 Duganella sp. 3397 Isolate Unclassified
22 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
23 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
24 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
25 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
26 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
27 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
28 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
29 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
30 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
31 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
32 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
33 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
34 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
35 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
36 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
37 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
38 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
43 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
46 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
47 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
48 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
49 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
50 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
51 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
52 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
56 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
59 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
64 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
65 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
66 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
67 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
68 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
69 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
70 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
71 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
72 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
73 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
74 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
75 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
76 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
77 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
78 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
79 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
80 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
81 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
82 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
83 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
84 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
85 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
86 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
87 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
88 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
89 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
90 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
91 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
92 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
93 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
94 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
95 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
96 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
97 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
98 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
99 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
100 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
101 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
102 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
103 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
104 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
105 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
106 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
107 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
108 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
109 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
110 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
111 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
112 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
113 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
114 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
115 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
116 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
117 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
118 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
119 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
120 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
121 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
122 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
123 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
124 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
125 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
126 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
127 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
128 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
129 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
130 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
131 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
132 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
133 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
134 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
135 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
138 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
139 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
140 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
141 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
142 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
143 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
144 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
145 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
146 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
147 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
148 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
149 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.26
Metatranscriptomes 0
Isolates 5.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.22
Nodule 0.55
Rhizoplane 0.82
Rhizosphere 70.49
Stem 0
Stem Tuber 0
Unclassified 7.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1001029 3300002739 Bacteria 5093
2 JGI25158J39367_1001195 3300002739 Bacteria 4684
3 JGI25152J39213_1000031 3300002773 Bacteria 96812
4 JGI25150J39212_1000687 3300002774 Bacteria 12280
5 JGI25150J39212_1002321 3300002774 Bacteria 4786
6 JGI25159J45721_1001833 3300002987 Bacteria 8502
7 JGI25159J45721_1007992 3300002987 Bacteria 2960
8 JGI25153J46596_10003599 3300003215 Bacteria 8604
9 JGI25160J50197_1011203 3300003354 Bacteria 3193
10 JGI25161J50226_1000750 3300003374 Bacteria 12419
11 JGI25161J50226_1004236 3300003374 Bacteria 3049
12 Ga0055529_1000166 3300003763 Bacteria 90973
13 Ga0055526_1000020 3300003771 Bacteria 188230
14 Ga0055526_1000031 3300003771 Bacteria 143136
15 Ga0055526_1001093 3300003771 Bacteria 19735
16 Ga0055526_1001462 3300003771 Bacteria 16769
17 Ga0055526_1002192 3300003771 Bacteria 13396
18 Ga0055537_1000071 3300003773 Bacteria 73402
19 Ga0055537_1002848 3300003773 Bacteria 5546
20 Ga0055524_1000015 3300003775 Bacteria 246493
21 Ga0055524_1000419 3300003775 Bacteria 35715
22 Ga0055524_1000721 3300003775 Bacteria 22672
23 Ga0055524_1008293 3300003775 Bacteria 4327
24 Ga0055534_1000156 3300003784 Bacteria 50992
25 Ga0055528_1000166 3300003790 Bacteria 55409
26 Ga0055528_1005246 3300003790 Bacteria 6080
27 Ga0055530_10001560 3300003791 Bacteria 16441
28 Ga0055530_10008925 3300003791 Bacteria 3930
29 Ga0055530_10009242 3300003791 Bacteria 3819
30 Ga0055531_10002206 3300003794 Bacteria 13241
31 Ga0055543_1000603 3300004625 Bacteria 19476
32 Ga0055543_1001410 3300004625 Bacteria 9555
33 Ga0065165_1000522 3300005262 Bacteria 58802
34 Ga0065165_1000706 3300005262 Bacteria 47386
35 Ga0065165_1002889 3300005262 Bacteria 13213
36 Ga0075362_10025482 3300006177 Bacteria 2519
37 Ga0075431_100114442 3300006847 Bacteria 2785
38 Ga0075429_100088683 3300006880 Bacteria 2696
39 Ga0099826_10000003 3300006948 Bacteria 1067817
40 Ga0105244_10000476 3300009036 Bacteria 36389
41 Ga0105244_10000852 3300009036 Bacteria 25714
42 Ga0157371_10000001 3300013102 Bacteria 1162285
43 Ga0182006_1000212 3300015261 Bacteria 57379
44 Ga0182006_1038599 3300015261 Bacteria 1887
45 Ga0182005_1000018 3300015265 Bacteria 324307
46 Ga0213872_10000002 3300021361 Bacteria 554092
47 Ga0209436_100637 3300025208 Bacteria 14904
48 Ga0209436_101919 3300025208 Bacteria 6699
49 Ga0207425_1000001 3300025245 Bacteria 2525432
50 Ga0207425_1000060 3300025245 Bacteria 139031
51 Ga0207425_1000340 3300025245 Bacteria 32414
52 Ga0209646_1000028 3300025246 Bacteria 387986
53 Ga0209129_1000093 3300025258 Bacteria 173163
54 Ga0209129_1001421 3300025258 Bacteria 13383
55 Ga0209565_1000006 3300025263 Bacteria 897294
56 Ga0209565_1001276 3300025263 Bacteria 11692
57 Ga0209565_1002018 3300025263 Bacteria 7833
58 Ga0209565_1002157 3300025263 Bacteria 7402
59 Ga0209565_1009267 3300025263 Bacteria 2514
60 Ga0209455_1000049 3300025272 Bacteria 374414
61 Ga0209673_1000004 3300025273 Bacteria 896155
62 Ga0209673_1005482 3300025273 Bacteria 6360
63 Ga0209130_1000044 3300025284 Bacteria 241110
64 Ga0209130_1000587 3300025284 Bacteria 35429
65 Ga0209675_1000006 3300025291 Bacteria 732267
66 Ga0209675_1009409 3300025291 Bacteria 3457
67 Ga0209564_1000006 3300025295 Bacteria 1100927
68 Ga0209564_1000038 3300025295 Bacteria 414357
69 Ga0209564_1000064 3300025295 Bacteria 316431
70 Ga0209564_1000134 3300025295 Bacteria 188346
71 Ga0209564_1012656 3300025295 Bacteria 3657
72 Ga0209758_1000055 3300025297 Bacteria 336183
73 Ga0209050_1000085 3300025298 Bacteria 263219
74 Ga0209050_1000092 3300025298 Bacteria 252702
75 Ga0209050_1001588 3300025298 Bacteria 23522
76 Ga0209050_1003195 3300025298 Bacteria 12409
77 Ga0209256_1000005 3300025299 Bacteria 1315082
78 Ga0209256_1000080 3300025299 Bacteria 224592
79 Ga0209256_1000505 3300025299 Bacteria 57384
80 Ga0209256_1003301 3300025299 Bacteria 11500
81 Ga0209257_1000010 3300025304 Bacteria 1158682
82 Ga0209257_1010590 3300025304 Bacteria 4632
83 Ga0207655_1010030 3300025728 Bacteria 5802
84 Ga0207655_1010883 3300025728 Bacteria 5470
85 Ga0209282_1000002 3300027666 Bacteria 1067825
86 Ga0316180_1026174 3300030736 Bacteria 3363
87 Ga0316182_1003627 3300030745 Bacteria 3168
88 Ga0307408_100000416 3300031548 Bacteria 38287
89 Ga0307408_100000676 3300031548 Bacteria 28288
90 Ga0307408_100005967 3300031548 Bacteria 8112
91 Ga0307416_100008395 3300032002 Bacteria 6661
92 Ga0436361_0491527 3300039447 Bacteria 29855
93 Ga0450904_000024 3300042139 Bacteria 36540
94 Ga0466965_0014363 3300044683 Bacteria 3746
95 Ga0495617_000002 3300046452 Bacteria 710121
96 Ga0495617_000007 3300046452 Bacteria 369986
97 Ga0495617_000182 3300046452 Bacteria 39771
98 Ga0495627_000006 3300046453 Bacteria 581750
99 Ga0495627_000111 3300046453 Bacteria 101652
100 Ga0495627_020100 3300046453 Bacteria 2229
101 Ga0495603_0025769 3300046455 Bacteria 3555
102 Ga0495590_0000004 3300046457 Bacteria 402091
103 Ga0495591_000062 3300046458 Bacteria 124615
104 Ga0495629_0017667 3300046459 Bacteria 5113
105 Ga0495638_0000023 3300046460 Bacteria 363063
106 Ga0495638_0002976 3300046460 Bacteria 13525
107 Ga0495653_0000037 3300046463 Bacteria 120575
108 Ga0495650_0000177 3300046471 Bacteria 139376
109 Ga0495650_0000421 3300046471 Bacteria 69019
110 Ga0495650_0000538 3300046471 Bacteria 54090
111 Ga0495650_0003131 3300046471 Bacteria 12385
112 Ga0495650_0007528 3300046471 Bacteria 6523
113 Ga0495650_0011442 3300046471 Bacteria 4858
114 Ga0495650_0025523 3300046471 Bacteria 2767
115 Ga0495582_0076672 3300046473 Bacteria 1853
116 Ga0495605_0000003 3300046474 Bacteria 491502
117 Ga0495605_0000092 3300046474 Bacteria 115315
118 Ga0495605_0021111 3300046474 Bacteria 3453
119 Ga0495605_0023271 3300046474 Bacteria 3260
120 Ga0495639_0010708 3300046475 Bacteria 3948
121 Ga0495584_0000017 3300046491 Bacteria 149686
122 Ga0495584_0000563 3300046491 Bacteria 24971
123 Ga0495584_0001668 3300046491 Bacteria 13039
124 Ga0495584_0002968 3300046491 Bacteria 9425
125 Ga0495584_0005986 3300046491 Bacteria 6407
126 Ga0495584_0010265 3300046491 Bacteria 4812
127 Ga0495585_0000006 3300046492 Bacteria 320556
128 Ga0495585_0000190 3300046492 Bacteria 65291
129 Ga0495585_0000693 3300046492 Bacteria 30632
130 Ga0495585_0001476 3300046492 Bacteria 18383
131 Ga0495585_0003370 3300046492 Bacteria 10813
132 Ga0495585_0004962 3300046492 Bacteria 8507
133 Ga0495585_0017322 3300046492 Bacteria 4163
134 Ga0495585_0017596 3300046492 Bacteria 4128
135 Ga0495585_0021710 3300046492 Bacteria 3686
136 Ga0495594_0000164 3300046499 Bacteria 31802
137 Ga0495594_0042039 3300046499 Bacteria 2502
138 Ga0495596_0002049 3300046500 Bacteria 11067
139 Ga0495596_0009210 3300046500 Bacteria 4353
140 Ga0495607_0001147 3300046501 Bacteria 23982
141 Ga0495607_0005798 3300046501 Bacteria 8786
142 Ga0495607_0006054 3300046501 Bacteria 8565
143 Ga0495607_0008714 3300046501 Bacteria 6909
144 Ga0495607_0018867 3300046501 Bacteria 4386
145 Ga0495607_0035943 3300046501 Bacteria 2991
146 Ga0495583_0000056 3300046506 Bacteria 200858
147 Ga0495583_0000088 3300046506 Bacteria 164073
148 Ga0495583_0000520 3300046506 Bacteria 54664
149 Ga0495583_0000606 3300046506 Bacteria 48615
150 Ga0495583_0001319 3300046506 Bacteria 25783
151 Ga0495583_0003620 3300046506 Bacteria 11566
152 Ga0495583_0005805 3300046506 Bacteria 8246
153 Ga0495583_0016159 3300046506 Bacteria 4024
154 Ga0495606_0000024 3300046507 Bacteria 262080
155 Ga0495606_0000146 3300046507 Bacteria 122515
156 Ga0495606_0000713 3300046507 Bacteria 51369
157 Ga0495606_0002464 3300046507 Bacteria 21461
158 Ga0495606_0003498 3300046507 Bacteria 16631
159 Ga0495606_0004309 3300046507 Bacteria 14321
160 Ga0495606_0025820 3300046507 Bacteria 4198
161 Ga0495606_0028670 3300046507 Bacteria 3923
162 Ga0495610_0000004 3300046512 Bacteria 1006135
163 Ga0495610_0001277 3300046512 Bacteria 22507
164 Ga0495610_0002208 3300046512 Bacteria 16475
165 Ga0495610_0009365 3300046512 Bacteria 6197
166 Ga0495610_0014437 3300046512 Bacteria 4638
167 Ga0495616_0000139 3300046513 Bacteria 63327
168 Ga0495616_0001555 3300046513 Bacteria 15813
169 Ga0495616_0002276 3300046513 Bacteria 12839
170 Ga0495616_0009053 3300046513 Bacteria 5845
171 Ga0495616_0009747 3300046513 Bacteria 5596
172 Ga0495616_0020263 3300046513 Bacteria 3620
173 Ga0495620_0001718 3300046515 Bacteria 12941
174 Ga0495631_0001197 3300046518 Bacteria 16041
175 Ga0495631_0001258 3300046518 Bacteria 15668
176 Ga0495632_0000556 3300046519 Bacteria 34798
177 Ga0495637_0000019 3300046520 Bacteria 185953
178 Ga0495637_0001002 3300046520 Bacteria 17820
179 Ga0495637_0006001 3300046520 Bacteria 6139
180 Ga0495643_0000182 3300046522 Bacteria 100196
181 Ga0495643_0000213 3300046522 Bacteria 89236
182 Ga0495643_0000479 3300046522 Bacteria 50776
183 Ga0495643_0000496 3300046522 Bacteria 49653
184 Ga0495643_0019951 3300046522 Bacteria 3873
185 Ga0495643_0020663 3300046522 Bacteria 3792
186 Ga0495644_0000286 3300046523 Bacteria 23323
187 Ga0495644_0001439 3300046523 Bacteria 9719
188 Ga0495648_0000007 3300046524 Bacteria 347305
189 Ga0495648_0000084 3300046524 Bacteria 120611
190 Ga0495648_0000193 3300046524 Bacteria 70395
191 Ga0495648_0000478 3300046524 Bacteria 43049
192 Ga0495648_0001510 3300046524 Bacteria 22791
193 Ga0495648_0004299 3300046524 Bacteria 12208
194 Ga0495648_0005230 3300046524 Bacteria 10851
195 Ga0495648_0005467 3300046524 Bacteria 10546
196 Ga0495648_0005887 3300046524 Bacteria 10079
197 Ga0495648_0022904 3300046524 Bacteria 4288
198 Ga0495666_0006924 3300046526 Bacteria 5695
199 Ga0495666_0024378 3300046526 Bacteria 2988
200 Ga0495642_0000217 3300046528 Bacteria 33101
201 Ga0495642_0001321 3300046528 Bacteria 11099
202 Ga0495642_0002536 3300046528 Bacteria 7387
203 Ga0495642_0003374 3300046528 Bacteria 6306
204 Ga0495654_0000004 3300046530 Bacteria 515304
205 Ga0495654_0006586 3300046530 Bacteria 6577
206 Ga0495654_0024824 3300046530 Bacteria 3093
207 Ga0495665_0012834 3300046531 Bacteria 4533
208 Ga0495587_0025622 3300046536 Bacteria 3603
209 Ga0495609_0000748 3300046538 Bacteria 24694
210 Ga0495609_0001363 3300046538 Bacteria 16458
211 Ga0495609_0007004 3300046538 Bacteria 5682
212 Ga0495597_0000022 3300046542 Bacteria 150986
213 Ga0495597_0000339 3300046542 Bacteria 41939
214 Ga0495597_0000517 3300046542 Bacteria 31992
215 Ga0495597_0000841 3300046542 Bacteria 24132
216 Ga0495597_0014102 3300046542 Bacteria 3811
217 Ga0495597_0038234 3300046542 Bacteria 2151
218 Ga0495622_0000003 3300046557 Bacteria 268681
219 Ga0495622_0000558 3300046557 Bacteria 22373
220 Ga0495622_0005886 3300046557 Bacteria 5693
221 Ga0495622_0014446 3300046557 Bacteria 3665
222 Ga0495633_0000113 3300046558 Bacteria 109307
223 Ga0495633_0000706 3300046558 Bacteria 30500
224 Ga0495633_0000875 3300046558 Bacteria 26041
225 Ga0495633_0001056 3300046558 Bacteria 22407
226 Ga0495633_0003887 3300046558 Bacteria 9745
227 Ga0495633_0006104 3300046558 Bacteria 7215
228 Ga0495633_0006988 3300046558 Bacteria 6589
229 Ga0495633_0051941 3300046558 Bacteria 1931
230 Ga0495667_0027085 3300046559 Bacteria 3864
231 Ga0495656_0016357 3300046615 Bacteria 2813
232 Ga0495668_0000025 3300046616 Bacteria 304546
233 Ga0495668_0000051 3300046616 Bacteria 214532
234 Ga0495668_0000369 3300046616 Bacteria 59509
235 Ga0495668_0000975 3300046616 Bacteria 31474
236 Ga0495668_0001216 3300046616 Bacteria 26050
237 Ga0495668_0002038 3300046616 Bacteria 17604
238 Ga0495668_0006264 3300046616 Bacteria 7842
239 Ga0495668_0006640 3300046616 Bacteria 7539
240 Ga0495611_0000295 3300046648 Bacteria 33712
241 Ga0495611_0001524 3300046648 Bacteria 11404
242 Ga0495611_0002595 3300046648 Bacteria 8177
243 Ga0495611_0002814 3300046648 Bacteria 7785
244 Ga0495611_0006653 3300046648 Bacteria 4919
245 Ga0495611_0037239 3300046648 Bacteria 2161
246 Ga0495625_0000073 3300046660 Bacteria 165197
247 Ga0495625_0000176 3300046660 Bacteria 99062
248 Ga0495625_0019004 3300046660 Bacteria 5347
249 Ga0495625_0019612 3300046660 Bacteria 5240
250 Ga0495625_0031371 3300046660 Bacteria 3954
251 Ga0495625_0037621 3300046660 Bacteria 3548
252 Ga0495659_0000004 3300046664 Bacteria 143914
253 Ga0495659_0000454 3300046664 Bacteria 15263
254 Ga0495661_0006118 3300046665 Bacteria 8478
255 Ga0495661_0010593 3300046665 Bacteria 6287
256 Ga0495661_0010845 3300046665 Bacteria 6198
257 Ga0495661_0018834 3300046665 Bacteria 4533
258 Ga0495588_0004665 3300046674 Bacteria 6054
259 Ga0495588_0040427 3300046674 Bacteria 2378
260 Ga0495669_0000036 3300046684 Bacteria 95830
261 Ga0495670_0001571 3300046691 Bacteria 11167
262 Ga0495670_0002574 3300046691 Bacteria 8958
263 Ga0495670_0027613 3300046691 Bacteria 2813
264 Ga0495671_0000001 3300046692 Bacteria 1169494
265 Ga0495671_0000067 3300046692 Bacteria 103441
266 Ga0495671_0000649 3300046692 Bacteria 25277
267 Ga0495671_0005172 3300046692 Bacteria 7677
268 Ga0495671_0013391 3300046692 Bacteria 4444
269 Ga0495671_0038161 3300046692 Bacteria 2428
270 Ga0495649_0000196 3300046694 Bacteria 53380
271 Ga0495649_0002359 3300046694 Bacteria 13357
272 Ga0495649_0011192 3300046694 Bacteria 5275
273 Ga0495649_0014550 3300046694 Bacteria 4506
274 Ga0495589_0000079 3300046794 Bacteria 89713
275 Ga0495589_0017302 3300046794 Bacteria 3700
276 Ga0495589_0028250 3300046794 Bacteria 2831
277 Ga0495589_0032658 3300046794 Bacteria 2617
278 Ga0495600_0042382 3300046809 Bacteria 2967
279 Ga0495660_0000812 3300046810 Bacteria 23337
280 Ga0495660_0003703 3300046810 Bacteria 9384
281 Ga0495660_0003869 3300046810 Bacteria 9150
282 Ga0495660_0004102 3300046810 Bacteria 8886
283 Ga0495660_0006807 3300046810 Bacteria 6740
284 Ga0495660_0018419 3300046810 Bacteria 4015
285 Ga0495581_0006101 3300047315 Bacteria 6986
286 Ga0495636_0000815 3300047318 Bacteria 11485
287 Ga0495636_0003650 3300047318 Bacteria 5977
288 Ga0495636_0010855 3300047318 Bacteria 3602
289 Ga0495672_0000041 3300047320 Bacteria 267545
290 Ga0495672_0000045 3300047320 Bacteria 255145
291 Ga0495672_0000154 3300047320 Bacteria 100095
292 Ga0495672_0000168 3300047320 Bacteria 95544
293 Ga0495672_0009208 3300047320 Bacteria 7188
294 Ga0495672_0024822 3300047320 Bacteria 3853
295 Ga0495676_0000092 3300047321 Bacteria 66361
296 Ga0495676_0031410 3300047321 Bacteria 4492
297 Ga0495683_0000515 3300047323 Bacteria 29668
298 Ga0495683_0002733 3300047323 Bacteria 10511
299 Ga0495683_0006564 3300047323 Bacteria 6347
300 Ga0495683_0014323 3300047323 Bacteria 4131
301 Ga0495683_0018458 3300047323 Bacteria 3606
302 Ga0495683_0047270 3300047323 Bacteria 2160
303 Ga0495687_000133 3300047443 Bacteria 113757
304 Ga0495687_000199 3300047443 Bacteria 86090
305 Ga0495677_0000353 3300047445 Bacteria 19875
306 Ga0495677_0003146 3300047445 Bacteria 6436
307 Ga0495679_002062 3300047446 Bacteria 10615
308 Ga0495679_004908 3300047446 Bacteria 6034
309 Ga0495685_000013 3300047447 Bacteria 79924
310 Ga0495673_0000006 3300047469 Bacteria 908691
311 Ga0495673_0000014 3300047469 Bacteria 599202
312 Ga0495673_0000017 3300047469 Bacteria 574970
313 Ga0495686_0000809 3300047472 Bacteria 40533
314 Ga0495686_0007169 3300047472 Bacteria 8394
315 Ga0495593_0012635 3300047673 Bacteria 4823
316 Ga0495626_0001988 3300048091 Bacteria 15092
317 Ga0495626_0006075 3300048091 Bacteria 6935
318 Ga0495626_0010303 3300048091 Bacteria 5000
319 Ga0496102_0000088 3300048905 Bacteria 129762
320 Ga0496103_0004715 3300048906 Bacteria 8248
321 Ga0496103_0022866 3300048906 Bacteria 3767
322 Ga0496116_0025674 3300048919 Bacteria 4327
323 Ga0496116_0027975 3300048919 Bacteria 4094
324 Ga0496121_0048521 3300048924 Bacteria 3611
325 Ga0496122_0073318 3300048925 Bacteria 2428
326 Ga0496123_0005463 3300048926 Bacteria 12794
327 Ga0496124_0021565 3300048927 Bacteria 5934
328 Ga0496124_0024410 3300048927 Bacteria 5497
329 Ga0496124_0033602 3300048927 Bacteria 4511
330 Ga0496126_0013988 3300048929 Bacteria 8134
331 Ga0495678_000042 3300049459 Bacteria 174125
332 Ga0495678_000070 3300049459 Bacteria 131437
333 Ga0495678_000105 3300049459 Bacteria 103599
334 Ga0495678_000301 3300049459 Bacteria 53830
335 Ga0495678_001392 3300049459 Bacteria 19229
336 Ga0495678_001508 3300049459 Bacteria 18125
337 Ga0495678_021377 3300049459 Bacteria 2850
338 Ga0495682_0000126 3300049460 Bacteria 66245
339 Ga0495682_0010464 3300049460 Bacteria 3590
340 Ga0495682_0015259 3300049460 Bacteria 2911
341 Ga0501269_000082 3300049766 Bacteria 29720
342 nmdc:mga09592_23143_c1 3300050508 Bacteria 5129
343 Ga0500618_000172 3300053125 Bacteria 53899
344 Ga0500618_006624 3300053125 Bacteria 3380
345 Ga0500586_000026 3300053145 Bacteria 26838

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300002987 JGI25159J45721_1007992 JGI25159J45721_10079922 439
2 3300050508 nmdc:mga09592_23143_c1 nmdc:mga09592_23143_c1_3338_4906 508
3 3300044683 Ga0466965_0014363 Ga0466965_0014363_1174_2847 511
4 3300046674 Ga0495588_0040427 Ga0495588_0040427_602_2257 511
5 3300046809 Ga0495600_0042382 Ga0495600_0042382_1073_2728 511
6 3300047673 Ga0495593_0012635 Ga0495593_0012635_2707_4362 511
7 3300046660 Ga0495625_0037621 Ga0495625_0037621_1328_2983 512
8 3300046459 Ga0495629_0017667 Ga0495629_0017667_459_2114 518
9 3300046506 Ga0495583_0001319 Ga0495583_0001319_19837_21495 518
10 3300046522 Ga0495643_0000213 Ga0495643_0000213_49363_51021 518
11 3300047321 Ga0495676_0031410 Ga0495676_0031410_837_2492 518
12 3300048929 Ga0496126_0013988 Ga0496126_0013988_743_2407 518
13 3300003771 Ga0055526_1000031 Ga0055526_100003143 519
14 3300025295 Ga0209564_1000038 Ga0209564_1000038140 519
15 3300046453 Ga0495627_020100 Ga0495627_020100_367_2040 519
16 3300046455 Ga0495603_0025769 Ga0495603_0025769_159_1814 519
17 3300046474 Ga0495605_0000003 Ga0495605_0000003_462081_463739 519
18 3300046491 Ga0495584_0005986 Ga0495584_0005986_1109_2764 519
19 3300046499 Ga0495594_0000164 Ga0495594_0000164_7360_9015 519
20 3300046501 Ga0495607_0035943 Ga0495607_0035943_519_2177 519
21 3300046512 Ga0495610_0000004 Ga0495610_0000004_485132_486805 519
22 3300046524 Ga0495648_0001510 Ga0495648_0001510_1752_3425 519
23 3300046526 Ga0495666_0024378 Ga0495666_0024378_272_1927 519
24 3300046542 Ga0495597_0000339 Ga0495597_0000339_16389_18050 519
25 3300046616 Ga0495668_0000369 Ga0495668_0000369_25653_27326 519
26 3300046648 Ga0495611_0002595 Ga0495611_0002595_6103_7758 519
27 3300046692 Ga0495671_0038161 Ga0495671_0038161_655_2316 519
28 3300047318 Ga0495636_0003650 Ga0495636_0003650_3644_5299 519
29 3300047469 Ga0495673_0000006 Ga0495673_0000006_41626_43296 519
30 3300003771 Ga0055526_1000020 Ga0055526_100002053 520
31 3300025246 Ga0209646_1000028 Ga0209646_100002818 520
32 3300025295 Ga0209564_1000006 Ga0209564_1000006183 520
33 3300046457 Ga0495590_0000004 Ga0495590_0000004_301244_302944 520
34 3300046471 Ga0495650_0000421 Ga0495650_0000421_34197_35864 520
35 3300046520 Ga0495637_0006001 Ga0495637_0006001_3192_4853 520
36 3300046522 Ga0495643_0000496 Ga0495643_0000496_33201_34901 520
37 3300046542 Ga0495597_0000022 Ga0495597_0000022_134515_136215 520
38 3300046810 Ga0495660_0004102 Ga0495660_0004102_1811_3511 520
39 3300048919 Ga0496116_0025674 Ga0496116_0025674_2683_4290 520
40 3300009036 Ga0105244_10000852 Ga0105244_1000085211 521
41 3300025728 Ga0207655_1010883 Ga0207655_10108832 521
42 3300046491 Ga0495584_0000563 Ga0495584_0000563_9403_11079 521
43 3300046492 Ga0495585_0000693 Ga0495585_0000693_14935_16611 521
44 3300046500 Ga0495596_0009210 Ga0495596_0009210_1388_3064 521
45 3300046507 Ga0495606_0000024 Ga0495606_0000024_154933_156591 521
46 3300046512 Ga0495610_0001277 Ga0495610_0001277_5438_7096 521
47 3300046513 Ga0495616_0002276 Ga0495616_0002276_4166_5842 521
48 3300046558 Ga0495633_0000113 Ga0495633_0000113_87500_89251 521
49 3300046558 Ga0495633_0006104 Ga0495633_0006104_2650_4326 521
50 3300046616 Ga0495668_0000051 Ga0495668_0000051_28969_30627 521
51 3300048091 Ga0495626_0001988 Ga0495626_0001988_3036_4700 521
52 3300048927 Ga0496124_0024410 Ga0496124_0024410_269_1927 521
53 3300046474 Ga0495605_0021111 Ga0495605_0021111_1214_2887 522
54 3300046500 Ga0495596_0002049 Ga0495596_0002049_3743_5416 522
55 3300046524 Ga0495648_0004299 Ga0495648_0004299_3106_4779 522
56 3300046538 Ga0495609_0007004 Ga0495609_0007004_1236_2909 522
57 3300046558 Ga0495633_0003887 Ga0495633_0003887_2228_3910 522
58 3300046660 Ga0495625_0031371 Ga0495625_0031371_590_2290 522
59 3300047323 Ga0495683_0006564 Ga0495683_0006564_4189_5862 522
60 3300047469 Ga0495673_0000014 Ga0495673_0000014_434167_435816 522
61 3300053145 Ga0500586_000026 Ga0500586_000026_4692_6347 522
62 3300025245 Ga0207425_1000340 Ga0207425_100034016 524
63 3300042139 Ga0450904_000024 Ga0450904_000024_22943_24625 524
64 3300046463 Ga0495653_0000037 Ga0495653_0000037_89553_91247 524
65 3300046512 Ga0495610_0002208 Ga0495610_0002208_6389_8062 524
66 3300046522 Ga0495643_0000182 Ga0495643_0000182_24305_25978 524
67 3300046524 Ga0495648_0005467 Ga0495648_0005467_7884_9557 524
68 3300046660 Ga0495625_0019612 Ga0495625_0019612_3374_5047 524
69 3300046694 Ga0495649_0002359 Ga0495649_0002359_9950_11623 524
70 3300047320 Ga0495672_0000154 Ga0495672_0000154_24302_25975 524
71 3300049459 Ga0495678_000301 Ga0495678_000301_29805_31478 524
72 3300046536 Ga0495587_0025622 Ga0495587_0025622_304_1959 525
73 3300046542 Ga0495597_0014102 Ga0495597_0014102_182_1837 525
74 3300046557 Ga0495622_0014446 Ga0495622_0014446_22_1677 525
75 3300046559 Ga0495667_0027085 Ga0495667_0027085_170_1825 525
76 3300046492 Ga0495585_0017322 Ga0495585_0017322_1463_3142 526
77 3300046507 Ga0495606_0000146 Ga0495606_0000146_13128_14840 526
78 3300046515 Ga0495620_0001718 Ga0495620_0001718_7013_8692 526
79 3300046526 Ga0495666_0006924 Ga0495666_0006924_125_1780 526
80 3300046528 Ga0495642_0003374 Ga0495642_0003374_2611_4290 526
81 3300046531 Ga0495665_0012834 Ga0495665_0012834_1867_3522 526
82 3300046648 Ga0495611_0006653 Ga0495611_0006653_1416_3095 526
83 3300046810 Ga0495660_0018419 Ga0495660_0018419_1228_2907 526
84 3300047315 Ga0495581_0006101 Ga0495581_0006101_1938_3593 526
85 3300047323 Ga0495683_0047270 Ga0495683_0047270_53_1732 526
86 3300006847 Ga0075431_100114442 Ga0075431_1001144422 527
87 3300006880 Ga0075429_100088683 Ga0075429_1000886832 527
88 3300048924 Ga0496121_0048521 Ga0496121_0048521_1868_3577 527
89 3300046452 Ga0495617_000007 Ga0495617_000007_56877_58514 528
90 3300046471 Ga0495650_0025523 Ga0495650_0025523_441_2108 528
91 3300046492 Ga0495585_0003370 Ga0495585_0003370_4269_5945 528
92 3300046506 Ga0495583_0000520 Ga0495583_0000520_48023_49669 528
93 3300046506 Ga0495583_0003620 Ga0495583_0003620_2418_4064 528
94 3300046507 Ga0495606_0003498 Ga0495606_0003498_12378_14084 528
95 3300046507 Ga0495606_0028670 Ga0495606_0028670_1828_3477 528
96 3300046558 Ga0495633_0000706 Ga0495633_0000706_13516_15192 528
97 3300046691 Ga0495670_0001571 Ga0495670_0001571_3759_5435 528
98 3300048925 Ga0496122_0073318 Ga0496122_0073318_388_2025 528
99 3300053125 Ga0500618_000172 Ga0500618_000172_5813_7480 528
100 iso_pu_bacteria 2904424332 2904429312 528
101 3300046491 Ga0495584_0000017 Ga0495584_0000017_14418_16067 529
102 3300046501 Ga0495607_0005798 Ga0495607_0005798_3162_4796 529
103 3300046615 Ga0495656_0016357 Ga0495656_0016357_301_1935 529
104 3300046648 Ga0495611_0001524 Ga0495611_0001524_3288_4922 529
105 3300047323 Ga0495683_0014323 Ga0495683_0014323_650_2320 529
106 3300048926 Ga0496123_0005463 Ga0496123_0005463_7628_9331 529
107 3300048927 Ga0496124_0021565 Ga0496124_0021565_3318_5015 529
108 3300049459 Ga0495678_000042 Ga0495678_000042_88740_90437 529
109 3300048091 Ga0495626_0006075 Ga0495626_0006075_4186_5838 530
110 3300048927 Ga0496124_0033602 Ga0496124_0033602_1495_3171 530
111 3300009036 Ga0105244_10000476 Ga0105244_100004767 531
112 3300013102 Ga0157371_10000001 Ga0157371_10000001697 531
113 3300046453 Ga0495627_000006 Ga0495627_000006_97218_98951 531
114 3300046660 Ga0495625_0019004 Ga0495625_0019004_2155_3828 531
115 3300048919 Ga0496116_0027975 Ga0496116_0027975_485_2218 531
116 3300049766 Ga0501269_000082 Ga0501269_000082_22637_24304 531
117 3300015261 Ga0182006_1038599 Ga0182006_10385992 532
118 3300030736 Ga0316180_1026174 Ga0316180_10261742 532
119 3300030745 Ga0316182_1003627 Ga0316182_10036272 532
120 3300046471 Ga0495650_0011442 Ga0495650_0011442_131_1780 532
121 3300046506 Ga0495583_0000088 Ga0495583_0000088_140228_141892 532
122 3300046506 Ga0495583_0005805 Ga0495583_0005805_922_2586 532
123 3300046507 Ga0495606_0000713 Ga0495606_0000713_27815_29473 532
124 3300046507 Ga0495606_0004309 Ga0495606_0004309_2100_3749 532
125 3300046522 Ga0495643_0020663 Ga0495643_0020663_204_1937 532
126 3300046524 Ga0495648_0005230 Ga0495648_0005230_6843_8507 532
127 3300046538 Ga0495609_0000748 Ga0495609_0000748_15625_17358 532
128 3300046810 Ga0495660_0003703 Ga0495660_0003703_2942_4675 532
129 3300047318 Ga0495636_0010855 Ga0495636_0010855_690_2354 532
130 3300048905 Ga0496102_0000088 Ga0496102_0000088_95503_97167 532
131 3300048906 Ga0496103_0004715 Ga0496103_0004715_1626_3290 532
132 3300048906 Ga0496103_0022866 Ga0496103_0022866_129_1796 532
133 3300049459 Ga0495678_001508 Ga0495678_001508_16422_18083 532
134 iso_pu_bacteria 2808606418 2809144496 532
135 iso_pu_bacteria 2857564685 2857565623 532
136 3300003763 Ga0055529_1000166 Ga0055529_100016654 533
137 3300006177 Ga0075362_10025482 Ga0075362_100254822 533
138 3300021361 Ga0213872_10000002 Ga0213872_10000002304 533
139 3300025272 Ga0209455_1000049 Ga0209455_1000049275 533
140 3300039447 Ga0436361_0491527 Ga0436361_0491527_20493_22142 533
141 3300046522 Ga0495643_0000479 Ga0495643_0000479_33247_34908 533
142 3300046528 Ga0495642_0002536 Ga0495642_0002536_4383_6035 533
143 3300046557 Ga0495622_0005886 Ga0495622_0005886_2599_4266 533
144 3300046558 Ga0495633_0051941 Ga0495633_0051941_188_1840 533
145 3300046665 Ga0495661_0010593 Ga0495661_0010593_2938_4590 533
146 3300046674 Ga0495588_0004665 Ga0495588_0004665_2851_4518 533
147 3300047321 Ga0495676_0000092 Ga0495676_0000092_16285_17952 533
148 iso_pu_bacteria 2738541297 2738825243 533
149 iso_pu_bacteria 2738541357 2739149040 533
150 iso_pu_bacteria 2738543003 2739190959 533
151 iso_pu_bacteria 2738543026 2739317436 533
152 iso_pu_bacteria 2738543029 2739335677 533
153 3300031548 Ga0307408_100000416 Ga0307408_10000041613 534
154 3300046471 Ga0495650_0000177 Ga0495650_0000177_92263_93921 534
155 3300046506 Ga0495583_0016159 Ga0495583_0016159_1568_3250 534
156 3300046616 Ga0495668_0006264 Ga0495668_0006264_3069_4727 534
157 iso_pu_bacteria 2919476304 2919480545 534
158 3300004625 Ga0055543_1001410 Ga0055543_10014102 535
159 3300005262 Ga0065165_1000522 Ga0065165_100052227 535
160 3300025284 Ga0209130_1000044 Ga0209130_100004448 535
161 iso_pu_bacteria 2643221554 2643787509 535
162 iso_pu_bacteria 2643221638 2644213622 535
163 iso_pu_bacteria 2643221645 2644253759 535
164 iso_pu_bacteria 2643221664 2644356539 535
165 iso_pu_bacteria 2738541280 2738738832 535
166 iso_pu_bacteria 2738541300 2738844724 535
167 iso_pu_bacteria 2738543018 2739276249 535
168 iso_pu_bacteria 2738543030 2739345227 535
169 iso_pu_bacteria 2821131069 2821133833 535
170 iso_pu_bacteria 2842711865 2842716707 535
171 iso_pu_bacteria 2857553236 2857553933 535
172 iso_pu_bacteria 2857558681 2857560265 535
173 3300046460 Ga0495638_0000023 Ga0495638_0000023_346485_348152 536
174 3300046471 Ga0495650_0003131 Ga0495650_0003131_3182_4849 536
175 3300046471 Ga0495650_0007528 Ga0495650_0007528_2571_4229 536
176 3300046475 Ga0495639_0010708 Ga0495639_0010708_35_1702 536
177 3300046501 Ga0495607_0006054 Ga0495607_0006054_2724_4391 536
178 3300046506 Ga0495583_0000606 Ga0495583_0000606_32035_33702 536
179 3300046520 Ga0495637_0001002 Ga0495637_0001002_3586_5244 536
180 3300046524 Ga0495648_0000084 Ga0495648_0000084_104033_105700 536
181 3300046528 Ga0495642_0001321 Ga0495642_0001321_3645_5312 536
182 3300046530 Ga0495654_0000004 Ga0495654_0000004_207576_209234 536
183 3300046542 Ga0495597_0000841 Ga0495597_0000841_14208_15878 536
184 3300046557 Ga0495622_0000003 Ga0495622_0000003_39117_40778 536
185 3300046557 Ga0495622_0000558 Ga0495622_0000558_14902_16569 536
186 3300046558 Ga0495633_0001056 Ga0495633_0001056_14901_16568 536
187 3300046660 Ga0495625_0000073 Ga0495625_0000073_14852_16519 536
188 3300049459 Ga0495678_021377 Ga0495678_021377_366_2033 536
189 3300053125 Ga0500618_006624 Ga0500618_006624_566_2242 536
190 3300005262 Ga0065165_1000706 Ga0065165_100070615 537
191 3300015261 Ga0182006_1000212 Ga0182006_100021225 537
192 3300015265 Ga0182005_1000018 Ga0182005_1000018174 537
193 3300046452 Ga0495617_000002 Ga0495617_000002_538221_539891 537
194 3300046453 Ga0495627_000111 Ga0495627_000111_68467_70137 537
195 3300046471 Ga0495650_0000538 Ga0495650_0000538_33840_35504 537
196 3300046474 Ga0495605_0000092 Ga0495605_0000092_79467_81137 537
197 3300046492 Ga0495585_0001476 Ga0495585_0001476_6008_7672 537
198 3300046501 Ga0495607_0001147 Ga0495607_0001147_19281_20951 537
199 3300046513 Ga0495616_0000139 Ga0495616_0000139_26752_28413 537
200 3300046518 Ga0495631_0001258 Ga0495631_0001258_9946_11631 537
201 3300046519 Ga0495632_0000556 Ga0495632_0000556_5061_6731 537
202 3300046523 Ga0495644_0001439 Ga0495644_0001439_6057_7727 537
203 3300046524 Ga0495648_0000193 Ga0495648_0000193_39269_40939 537
204 3300046524 Ga0495648_0005887 Ga0495648_0005887_4997_6667 537
205 3300046524 Ga0495648_0022904 Ga0495648_0022904_1752_3416 537
206 3300046528 Ga0495642_0000217 Ga0495642_0000217_28254_29924 537
207 3300046530 Ga0495654_0006586 Ga0495654_0006586_2066_3730 537
208 3300046616 Ga0495668_0000025 Ga0495668_0000025_70971_72629 537
209 3300046616 Ga0495668_0000975 Ga0495668_0000975_3141_4811 537
210 3300046616 Ga0495668_0001216 Ga0495668_0001216_11597_13282 537
211 3300046616 Ga0495668_0006640 Ga0495668_0006640_1133_2797 537
212 3300046648 Ga0495611_0037239 Ga0495611_0037239_364_2034 537
213 3300046660 Ga0495625_0000176 Ga0495625_0000176_73647_75314 537
214 3300046665 Ga0495661_0006118 Ga0495661_0006118_2299_3969 537
215 3300046684 Ga0495669_0000036 Ga0495669_0000036_3456_5123 537
216 3300046692 Ga0495671_0000067 Ga0495671_0000067_68344_70014 537
217 3300046692 Ga0495671_0005172 Ga0495671_0005172_4867_6552 537
218 3300046694 Ga0495649_0011192 Ga0495649_0011192_1359_3026 537
219 3300046794 Ga0495589_0000079 Ga0495589_0000079_46727_48400 537
220 3300046794 Ga0495589_0017302 Ga0495589_0017302_1732_3399 537
221 3300046794 Ga0495589_0028250 Ga0495589_0028250_368_2038 537
222 3300047320 Ga0495672_0000168 Ga0495672_0000168_61704_63374 537
223 3300047323 Ga0495683_0018458 Ga0495683_0018458_1665_3332 537
224 3300047443 Ga0495687_000133 Ga0495687_000133_38942_40615 537
225 3300047446 Ga0495679_002062 Ga0495679_002062_7692_9377 537
226 3300047469 Ga0495673_0000017 Ga0495673_0000017_155709_157373 537
227 3300047472 Ga0495686_0000809 Ga0495686_0000809_4897_6555 537
228 3300048091 Ga0495626_0010303 Ga0495626_0010303_2103_3770 537
229 3300049459 Ga0495678_000105 Ga0495678_000105_34691_36361 537
230 3300025728 Ga0207655_1010030 Ga0207655_10100301 538
231 3300046452 Ga0495617_000182 Ga0495617_000182_15403_17100 538
232 3300046458 Ga0495591_000062 Ga0495591_000062_41064_42740 538
233 3300046460 Ga0495638_0002976 Ga0495638_0002976_4776_6437 538
234 3300046473 Ga0495582_0076672 Ga0495582_0076672_55_1728 538
235 3300046474 Ga0495605_0023271 Ga0495605_0023271_1025_2686 538
236 3300046491 Ga0495584_0001668 Ga0495584_0001668_8519_10195 538
237 3300046491 Ga0495584_0002968 Ga0495584_0002968_3075_4736 538
238 3300046491 Ga0495584_0010265 Ga0495584_0010265_2636_4309 538
239 3300046492 Ga0495585_0000006 Ga0495585_0000006_175779_177473 538
240 3300046492 Ga0495585_0000190 Ga0495585_0000190_48529_50226 538
241 3300046492 Ga0495585_0004962 Ga0495585_0004962_3074_4735 538
242 3300046492 Ga0495585_0017596 Ga0495585_0017596_427_2088 538
243 3300046492 Ga0495585_0021710 Ga0495585_0021710_1677_3338 538
244 3300046499 Ga0495594_0042039 Ga0495594_0042039_480_2153 538
245 3300046501 Ga0495607_0008714 Ga0495607_0008714_1276_2937 538
246 3300046501 Ga0495607_0018867 Ga0495607_0018867_1448_3124 538
247 3300046506 Ga0495583_0000056 Ga0495583_0000056_51910_53571 538
248 3300046512 Ga0495610_0009365 Ga0495610_0009365_3202_4878 538
249 3300046512 Ga0495610_0014437 Ga0495610_0014437_179_1840 538
250 3300046513 Ga0495616_0001555 Ga0495616_0001555_1839_3536 538
251 3300046513 Ga0495616_0009053 Ga0495616_0009053_2486_4147 538
252 3300046513 Ga0495616_0009747 Ga0495616_0009747_130_1803 538
253 3300046513 Ga0495616_0020263 Ga0495616_0020263_805_2466 538
254 3300046518 Ga0495631_0001197 Ga0495631_0001197_3510_5186 538
255 3300046520 Ga0495637_0000019 Ga0495637_0000019_107813_109489 538
256 3300046522 Ga0495643_0019951 Ga0495643_0019951_944_2620 538
257 3300046523 Ga0495644_0000286 Ga0495644_0000286_18258_19919 538
258 3300046524 Ga0495648_0000007 Ga0495648_0000007_185917_187614 538
259 3300046524 Ga0495648_0000478 Ga0495648_0000478_25247_26908 538
260 3300046538 Ga0495609_0001363 Ga0495609_0001363_3467_5128 538
261 3300046542 Ga0495597_0000517 Ga0495597_0000517_1556_3229 538
262 3300046558 Ga0495633_0000875 Ga0495633_0000875_23526_25202 538
263 3300046558 Ga0495633_0006988 Ga0495633_0006988_407_2068 538
264 3300046616 Ga0495668_0002038 Ga0495668_0002038_14239_15915 538
265 3300046648 Ga0495611_0000295 Ga0495611_0000295_29884_31560 538
266 3300046648 Ga0495611_0002814 Ga0495611_0002814_3640_5301 538
267 3300046664 Ga0495659_0000454 Ga0495659_0000454_3435_5096 538
268 3300046665 Ga0495661_0010845 Ga0495661_0010845_1650_3326 538
269 3300046665 Ga0495661_0018834 Ga0495661_0018834_188_1852 538
270 3300046691 Ga0495670_0002574 Ga0495670_0002574_2798_4474 538
271 3300046691 Ga0495670_0027613 Ga0495670_0027613_574_2238 538
272 3300046692 Ga0495671_0000001 Ga0495671_0000001_1133556_1135223 538
273 3300046692 Ga0495671_0013391 Ga0495671_0013391_1153_2814 538
274 3300046694 Ga0495649_0000196 Ga0495649_0000196_4395_6071 538
275 3300046794 Ga0495589_0032658 Ga0495589_0032658_76_1737 538
276 3300046810 Ga0495660_0003869 Ga0495660_0003869_5363_7039 538
277 3300047318 Ga0495636_0000815 Ga0495636_0000815_5034_6695 538
278 3300047320 Ga0495672_0000041 Ga0495672_0000041_80068_81744 538
279 3300047320 Ga0495672_0009208 Ga0495672_0009208_1706_3367 538
280 3300047320 Ga0495672_0024822 Ga0495672_0024822_1059_2720 538
281 3300047323 Ga0495683_0000515 Ga0495683_0000515_3459_5135 538
282 3300047323 Ga0495683_0002733 Ga0495683_0002733_912_2573 538
283 3300047443 Ga0495687_000199 Ga0495687_000199_10317_11978 538
284 3300047445 Ga0495677_0000353 Ga0495677_0000353_13170_14846 538
285 3300047445 Ga0495677_0003146 Ga0495677_0003146_2310_3971 538
286 3300047446 Ga0495679_004908 Ga0495679_004908_3581_5257 538
287 3300047447 Ga0495685_000013 Ga0495685_000013_23557_25218 538
288 3300049459 Ga0495678_000070 Ga0495678_000070_61614_63290 538
289 3300049459 Ga0495678_001392 Ga0495678_001392_8323_9984 538
290 3300049460 Ga0495682_0000126 Ga0495682_0000126_46167_47828 538
291 3300049460 Ga0495682_0010464 Ga0495682_0010464_1085_2746 538
292 3300049460 Ga0495682_0015259 Ga0495682_0015259_497_2158 538
293 3300002739 JGI25158J39367_1001029 JGI25158J39367_10010294 539
294 3300002739 JGI25158J39367_1001195 JGI25158J39367_10011952 539
295 3300002773 JGI25152J39213_1000031 JGI25152J39213_100003122 539
296 3300002774 JGI25150J39212_1000687 JGI25150J39212_10006878 539
297 3300002774 JGI25150J39212_1002321 JGI25150J39212_10023215 539
298 3300002987 JGI25159J45721_1001833 JGI25159J45721_10018335 539
299 3300003215 JGI25153J46596_10003599 JGI25153J46596_100035995 539
300 3300003354 JGI25160J50197_1011203 JGI25160J50197_10112032 539
301 3300003374 JGI25161J50226_1000750 JGI25161J50226_10007507 539
302 3300003374 JGI25161J50226_1004236 JGI25161J50226_10042362 539
303 3300003771 Ga0055526_1001093 Ga0055526_10010939 539
304 3300003771 Ga0055526_1001462 Ga0055526_100146210 539
305 3300003771 Ga0055526_1002192 Ga0055526_10021925 539
306 3300003773 Ga0055537_1000071 Ga0055537_100007135 539
307 3300003773 Ga0055537_1002848 Ga0055537_10028485 539
308 3300003775 Ga0055524_1000015 Ga0055524_1000015100 539
309 3300003775 Ga0055524_1000419 Ga0055524_10004196 539
310 3300003775 Ga0055524_1000721 Ga0055524_10007215 539
311 3300003775 Ga0055524_1008293 Ga0055524_10082933 539
312 3300003784 Ga0055534_1000156 Ga0055534_100015618 539
313 3300003790 Ga0055528_1000166 Ga0055528_100016618 539
314 3300003790 Ga0055528_1005246 Ga0055528_10052465 539
315 3300003791 Ga0055530_10001560 Ga0055530_100015607 539
316 3300003791 Ga0055530_10008925 Ga0055530_100089252 539
317 3300003791 Ga0055530_10009242 Ga0055530_100092424 539
318 3300003794 Ga0055531_10002206 Ga0055531_100022067 539
319 3300004625 Ga0055543_1000603 Ga0055543_10006036 539
320 3300005262 Ga0065165_1002889 Ga0065165_10028894 539
321 3300006948 Ga0099826_10000003 Ga0099826_10000003318 539
322 3300025208 Ga0209436_100637 Ga0209436_1006376 539
323 3300025208 Ga0209436_101919 Ga0209436_1019192 539
324 3300025245 Ga0207425_1000001 Ga0207425_10000012285 539
325 3300025245 Ga0207425_1000060 Ga0207425_1000060101 539
326 3300025258 Ga0209129_1000093 Ga0209129_100009367 539
327 3300025258 Ga0209129_1001421 Ga0209129_100142111 539
328 3300025263 Ga0209565_1000006 Ga0209565_100000619 539
329 3300025263 Ga0209565_1001276 Ga0209565_10012766 539
330 3300025263 Ga0209565_1002018 Ga0209565_10020186 539
331 3300025263 Ga0209565_1002157 Ga0209565_10021574 539
332 3300025263 Ga0209565_1009267 Ga0209565_10092672 539
333 3300025273 Ga0209673_1000004 Ga0209673_1000004810 539
334 3300025273 Ga0209673_1005482 Ga0209673_10054825 539
335 3300025284 Ga0209130_1000587 Ga0209130_100058716 539
336 3300025291 Ga0209675_1000006 Ga0209675_100000618 539
337 3300025291 Ga0209675_1009409 Ga0209675_10094092 539
338 3300025295 Ga0209564_1000064 Ga0209564_1000064259 539
339 3300025295 Ga0209564_1000134 Ga0209564_100013495 539
340 3300025295 Ga0209564_1012656 Ga0209564_10126562 539
341 3300025297 Ga0209758_1000055 Ga0209758_100005567 539
342 3300025298 Ga0209050_1000085 Ga0209050_1000085190 539
343 3300025298 Ga0209050_1000092 Ga0209050_100009295 539
344 3300025298 Ga0209050_1001588 Ga0209050_10015885 539
345 3300025298 Ga0209050_1003195 Ga0209050_10031958 539
346 3300025299 Ga0209256_1000005 Ga0209256_1000005101 539
347 3300025299 Ga0209256_1000080 Ga0209256_100008022 539
348 3300025299 Ga0209256_1000505 Ga0209256_10005057 539
349 3300025299 Ga0209256_1003301 Ga0209256_10033016 539
350 3300025304 Ga0209257_1000010 Ga0209257_1000010913 539
351 3300025304 Ga0209257_1010590 Ga0209257_10105903 539
352 3300027666 Ga0209282_1000002 Ga0209282_1000002679 539
353 3300031548 Ga0307408_100000676 Ga0307408_1000006765 539
354 3300031548 Ga0307408_100005967 Ga0307408_1000059674 539
355 3300032002 Ga0307416_100008395 Ga0307416_1000083954 539
356 3300046507 Ga0495606_0002464 Ga0495606_0002464_8160_9848 539
357 3300046507 Ga0495606_0025820 Ga0495606_0025820_1788_3470 539
358 3300046530 Ga0495654_0024824 Ga0495654_0024824_635_2314 539
359 3300046542 Ga0495597_0038234 Ga0495597_0038234_55_1734 539
360 3300046664 Ga0495659_0000004 Ga0495659_0000004_19937_21616 539
361 3300046692 Ga0495671_0000649 Ga0495671_0000649_17240_18919 539
362 3300046694 Ga0495649_0014550 Ga0495649_0014550_965_2608 539
363 3300046810 Ga0495660_0000812 Ga0495660_0000812_15785_17464 539
364 3300046810 Ga0495660_0006807 Ga0495660_0006807_3708_5387 539
365 3300047320 Ga0495672_0000045 Ga0495672_0000045_144208_145887 539
366 3300047472 Ga0495686_0007169 Ga0495686_0007169_6124_7803 539

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00128

Alpha-amylase

Alpha amylase, catalytic domain

91

439

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
8im8-assembly4.cif.gz_D crystal structure of periplasmic alpha-amylase (mals) from e.coli 0.7883 19 485
4e2o-assembly1.cif.gz_A crystal structure of alpha-amylase from geobacillus thermoleovorans, gta, complexed with acarbose 0.7579 27 539
4e2o-assembly1.cif.gz_A crystal structure of alpha-amylase from geobacillus thermoleovorans, gta, complexed with acarbose 0.7518 27 539
5a2c-assembly1.cif.gz_A crystal structure of anoxybacillus alpha-amylase provides insights into a new glycosyl hydrolase subclass 0.7482 27 538
5a2c-assembly1.cif.gz_A crystal structure of anoxybacillus alpha-amylase provides insights into a new glycosyl hydrolase subclass 0.7408 27 538
ID Description Score Start End Superfamily
af_P25718_429_642_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.8693 241 459 3.20.20.80
af_P25718_429_642_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.839 241 459 3.20.20.80
4e2oA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.7908 27 456 3.20.20.80
4e2oA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.7828 27 456 3.20.20.80
1ji1A03 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.7769 457 539 2.60.40.1180
ID Description Score Start End GO Terms
AF-A0A060CN75-F1-model_v4 Alpha-amylase 0.9723 116 290 GO:0004556
GO:0005975
GO:0043169
AF-A0A7Y3F2G4-F1-model_v4 Alpha-amylase 0.97 482 538
AF-A0A3D2R6T9-F1-model_v4 Alpha-amlyase 0.9619 116 236 GO:0005975
GO:0016829
AF-A0A060CN75-F1-model_v4 Alpha-amylase 0.9615 116 290 GO:0004556
GO:0005975
GO:0043169
AF-A0A2R7K5H7-F1-model_v4 Alpha-amlyase 0.9502 154 539 GO:0005975
GO:0016829

Feature Viewer

pLDDT pTM Quality
84.96 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map