F424117

General Info

Members Datasets Scaffolds Average Seq Length
366 113 363 285

Family's Representative Sequence

Representative Sequence 3300046513|Ga0495616_0000193|Ga0495616_0000193_46201_47124
Length 307
Sequence VILPPFRLHRMAQKGTHMSFSSFASFFRGGRRQPVLALLASLLLALALPAHADLMLHPTRIVFEKNQRAAQIELINNGSKPATYRISLVNRRMTEAGQFEAADNAAPDEHFADAMLRFSPRQVTLEPGTAQTVRVMLRKPAELANGEYRSHLQFDRLPDAEGNASIENGGKGADGKGIGVVLNTLIGASVPVIVRHGATSANVSLAGLALKKDETQRLLLALQFEREGSSSVYGDLDVTFTPHGGKPQTLTQVVGIAVYTPNRVRQAALPLAVPAGVALANGTIEVRYRERPEAGGKLLAQANLELP

Samples

Sample ID Description Type Environment
1 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
2 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
3 2738541337 Pelomonas sp. BT06 Isolate Unclassified
4 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
12 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
13 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
14 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
15 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
16 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
18 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
19 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
20 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
21 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
22 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
23 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
24 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
25 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
26 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
27 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
28 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
29 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
30 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
31 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
32 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
33 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
34 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
35 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
36 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
37 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
38 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
39 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
40 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
41 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
42 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
43 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
44 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
45 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
46 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
47 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
48 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
49 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
50 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
51 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
52 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
53 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
54 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
55 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
56 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
57 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
58 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
59 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
60 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
61 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
62 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
63 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
64 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
65 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
66 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
67 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
68 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
69 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
70 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
71 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
72 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
73 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
74 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
75 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
76 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
77 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
78 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
79 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
80 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
81 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
82 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
83 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
84 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
85 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
86 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
87 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
88 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
89 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
90 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
91 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
92 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
93 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
94 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
95 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
96 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
97 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
98 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
99 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
100 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
101 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
102 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
103 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
104 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
105 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
106 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
107 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
108 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
109 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
110 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
111 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
112 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
113 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.91
Metatranscriptomes 0
Isolates 1.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.64
Nodule 0
Rhizoplane 3.28
Rhizosphere 91.53
Stem 0
Stem Tuber 0
Unclassified 3.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10079852 3300003316 Bacteria 3959
2 rootL2_10005034 3300003322 Bacteria 7105
3 rootH1_10011039 3300003316 Bacteria 2289
4 rootH1_10011039 3300003323 Bacteria 8468
5 rootH1_10011041 3300003323 Bacteria 3958
6 Ga0055531_10000064 3300003794 Bacteria 117923
7 Ga0065165_1001239 3300005262 Bacteria 29150
8 Ga0068856_100129579 3300005614 Bacteria 2527
9 Ga0068863_100017903 3300005841 Bacteria 6780
10 Ga0213872_10000058 3300021361 Bacteria 100531
11 Ga0213872_10000150 3300021361 Bacteria 63730
12 Ga0213872_10003619 3300021361 Bacteria 8485
13 Ga0213872_10106640 3300021361 Bacteria 1246
14 Ga0209050_1002657 3300025298 Bacteria 14616
15 Ga0209051_1006872 3300025303 Bacteria 6324
16 Ga0209257_1000094 3300025304 Bacteria 262243
17 Ga0209257_1018582 3300025304 Bacteria 2664
18 Ga0207685_10082614 3300025905 Bacteria 1333
19 Ga0207702_10080273 3300026078 Bacteria 2830
20 Ga0307515_10036843 3300028794 Bacteria 7894
21 Ga0316177_1042130 3300030731 Unclassified 2449
22 Ga0316180_1003511 3300030736 Bacteria 6192
23 Ga0265331_10003453 3300031250 Bacteria 10209
24 Ga0265327_10000012 3300031251 Bacteria 530403
25 Ga0395905_0000719 3300037471 Bacteria 43703
26 Ga0395905_0041799 3300037471 Bacteria 4302
27 Ga0436361_0018388 3300039447 Bacteria 44345
28 Ga0436361_0068556 3300039447 Bacteria 100895
29 Ga0436361_0700482 3300039447 Bacteria 4598
30 Ga0436361_0850324 3300039447 Bacteria 16256
31 Ga0436363_0785503 3300039450 Unclassified 1981
32 Ga0450904_001513 3300042139 Bacteria 3198
33 Ga0466957_0000994 3300044842 Bacteria 14564
34 Ga0495617_000002 3300046452 Bacteria 710121
35 Ga0495617_006501 3300046452 Bacteria 4093
36 Ga0495627_000339 3300046453 Bacteria 44178
37 Ga0495627_009600 3300046453 Bacteria 3552
38 Ga0495627_036739 3300046453 Bacteria 1521
39 Ga0495603_0010744 3300046455 Bacteria 5553
40 Ga0495590_0000007 3300046457 Bacteria 331108
41 Ga0495590_0002842 3300046457 Bacteria 7137
42 Ga0495590_0004702 3300046457 Bacteria 5476
43 Ga0495590_0049214 3300046457 Bacteria 1471
44 Ga0495591_000039 3300046458 Bacteria 156460
45 Ga0495653_0011532 3300046463 Bacteria 7217
46 Ga0495653_0014264 3300046463 Bacteria 6478
47 Ga0495653_0023115 3300046463 Bacteria 5027
48 Ga0495650_0010045 3300046471 Bacteria 5322
49 Ga0495650_0017064 3300046471 Bacteria 3652
50 Ga0495580_0011731 3300046472 Bacteria 6767
51 Ga0495582_0011683 3300046473 Bacteria 4838
52 Ga0495605_0000108 3300046474 Bacteria 104865
53 Ga0495605_0005103 3300046474 Bacteria 7655
54 Ga0495605_0007197 3300046474 Bacteria 6329
55 Ga0495605_0008500 3300046474 Bacteria 5803
56 Ga0495605_0009080 3300046474 Bacteria 5596
57 Ga0495605_0010316 3300046474 Bacteria 5229
58 Ga0495605_0011252 3300046474 Bacteria 4995
59 Ga0495605_0013904 3300046474 Bacteria 4420
60 Ga0495605_0196322 3300046474 Bacteria 881
61 Ga0495584_0000712 3300046491 Bacteria 21938
62 Ga0495584_0002110 3300046491 Bacteria 11395
63 Ga0495584_0003500 3300046491 Bacteria 8625
64 Ga0495584_0005350 3300046491 Bacteria 6802
65 Ga0495584_0005403 3300046491 Bacteria 6767
66 Ga0495584_0006348 3300046491 Bacteria 6194
67 Ga0495584_0013577 3300046491 Bacteria 4157
68 Ga0495584_0018737 3300046491 Bacteria 3518
69 Ga0495584_0020123 3300046491 Bacteria 3391
70 Ga0495585_0001726 3300046492 Bacteria 16648
71 Ga0495585_0002480 3300046492 Bacteria 13169
72 Ga0495585_0010549 3300046492 Bacteria 5496
73 Ga0495585_0011985 3300046492 Bacteria 5117
74 Ga0495585_0012408 3300046492 Bacteria 5021
75 Ga0495585_0041301 3300046492 Bacteria 2587
76 Ga0495585_0127467 3300046492 Bacteria 1342
77 Ga0495585_0134874 3300046492 Bacteria 1296
78 Ga0495585_0144337 3300046492 Bacteria 1244
79 Ga0495585_0152714 3300046492 Bacteria 1203
80 Ga0495594_0009109 3300046499 Bacteria 5124
81 Ga0495594_0028756 3300046499 Bacteria 3000
82 Ga0495594_0096666 3300046499 Bacteria 1660
83 Ga0495596_0002487 3300046500 Bacteria 9880
84 Ga0495596_0003084 3300046500 Bacteria 8604
85 Ga0495596_0007518 3300046500 Bacteria 4912
86 Ga0495596_0010547 3300046500 Bacteria 4020
87 Ga0495596_0011447 3300046500 Bacteria 3828
88 Ga0495596_0014049 3300046500 Bacteria 3377
89 Ga0495596_0016256 3300046500 Bacteria 3093
90 Ga0495596_0065976 3300046500 Bacteria 1407
91 Ga0495596_0133968 3300046500 Bacteria 961
92 Ga0495607_0001375 3300046501 Bacteria 21626
93 Ga0495607_0002023 3300046501 Bacteria 16982
94 Ga0495607_0002838 3300046501 Bacteria 13749
95 Ga0495607_0002914 3300046501 Bacteria 13492
96 Ga0495607_0027946 3300046501 Bacteria 3483
97 Ga0495607_0208870 3300046501 Bacteria 962
98 Ga0495583_0000503 3300046506 Bacteria 56256
99 Ga0495583_0001311 3300046506 Bacteria 25872
100 Ga0495583_0001962 3300046506 Bacteria 18882
101 Ga0495583_0005566 3300046506 Bacteria 8508
102 Ga0495583_0008040 3300046506 Bacteria 6505
103 Ga0495583_0008628 3300046506 Bacteria 6202
104 Ga0495583_0024658 3300046506 Bacteria 3017
105 Ga0495583_0028354 3300046506 Bacteria 2754
106 Ga0495606_0027117 3300046507 Bacteria 4068
107 Ga0495606_0048262 3300046507 Bacteria 2802
108 Ga0495606_0060744 3300046507 Bacteria 2420
109 Ga0495606_0093382 3300046507 Bacteria 1846
110 Ga0495606_0234235 3300046507 Bacteria 1027
111 Ga0495610_0002370 3300046512 Bacteria 15919
112 Ga0495610_0063096 3300046512 Bacteria 1756
113 Ga0495616_0000193 3300046513 Bacteria 50722
114 Ga0495616_0004553 3300046513 Bacteria 8727
115 Ga0495616_0006451 3300046513 Bacteria 7093
116 Ga0495616_0007749 3300046513 Bacteria 6414
117 Ga0495616_0011802 3300046513 Bacteria 4985
118 Ga0495616_0025202 3300046513 Bacteria 3180
119 Ga0495616_0034551 3300046513 Bacteria 2625
120 Ga0495616_0102871 3300046513 Bacteria 1338
121 Ga0495630_0172013 3300046517 Bacteria 1650
122 Ga0495631_0003682 3300046518 Bacteria 8359
123 Ga0495631_0004617 3300046518 Bacteria 7293
124 Ga0495631_0008028 3300046518 Bacteria 5333
125 Ga0495631_0008828 3300046518 Bacteria 5061
126 Ga0495631_0013206 3300046518 Bacteria 4014
127 Ga0495631_0031256 3300046518 Bacteria 2410
128 Ga0495631_0040039 3300046518 Bacteria 2077
129 Ga0495631_0043773 3300046518 Bacteria 1974
130 Ga0495631_0098687 3300046518 Bacteria 1257
131 Ga0495631_0120155 3300046518 Bacteria 1130
132 Ga0495631_0145959 3300046518 Bacteria 1015
133 Ga0495632_0000374 3300046519 Bacteria 42607
134 Ga0495632_0000837 3300046519 Bacteria 27084
135 Ga0495632_0000878 3300046519 Bacteria 26434
136 Ga0495632_0003384 3300046519 Bacteria 11360
137 Ga0495632_0006824 3300046519 Bacteria 7284
138 Ga0495632_0015440 3300046519 Bacteria 4281
139 Ga0495632_0029070 3300046519 Bacteria 2881
140 Ga0495632_0157543 3300046519 Bacteria 1047
141 Ga0495637_0000006 3300046520 Bacteria 435763
142 Ga0495637_0053847 3300046520 Bacteria 1673
143 Ga0495643_0002368 3300046522 Bacteria 15092
144 Ga0495643_0004152 3300046522 Bacteria 10287
145 Ga0495643_0005916 3300046522 Bacteria 8165
146 Ga0495643_0013968 3300046522 Bacteria 4787
147 Ga0495644_0003184 3300046523 Bacteria 6486
148 Ga0495644_0005351 3300046523 Bacteria 5011
149 Ga0495644_0007813 3300046523 Bacteria 4121
150 Ga0495644_0015325 3300046523 Bacteria 2935
151 Ga0495644_0019876 3300046523 Bacteria 2564
152 Ga0495644_0038451 3300046523 Bacteria 1804
153 Ga0495644_0044857 3300046523 Bacteria 1663
154 Ga0495644_0062740 3300046523 Bacteria 1396
155 Ga0495648_0000220 3300046524 Bacteria 65480
156 Ga0495648_0016893 3300046524 Bacteria 5243
157 Ga0495648_0017194 3300046524 Bacteria 5180
158 Ga0495648_0046068 3300046524 Bacteria 2707
159 Ga0495648_0161269 3300046524 Bacteria 1159
160 Ga0495648_0175706 3300046524 Unclassified 1093
161 Ga0495666_0035579 3300046526 Bacteria 2427
162 Ga0495666_0056388 3300046526 Bacteria 1882
163 Ga0495642_0000345 3300046528 Bacteria 25250
164 Ga0495642_0000855 3300046528 Bacteria 14486
165 Ga0495642_0003402 3300046528 Bacteria 6281
166 Ga0495642_0007904 3300046528 Bacteria 4074
167 Ga0495642_0010611 3300046528 Bacteria 3527
168 Ga0495642_0014317 3300046528 Bacteria 3072
169 Ga0495642_0020299 3300046528 Bacteria 2609
170 Ga0495642_0023975 3300046528 Bacteria 2412
171 Ga0495642_0045930 3300046528 Bacteria 1786
172 Ga0495642_0095522 3300046528 Bacteria 1261
173 Ga0495642_0121377 3300046528 Bacteria 1121
174 Ga0495652_0006263 3300046529 Bacteria 11091
175 Ga0495654_0030213 3300046530 Bacteria 2758
176 Ga0495654_0032844 3300046530 Bacteria 2629
177 Ga0495654_0077261 3300046530 Bacteria 1567
178 Ga0495654_0116874 3300046530 Bacteria 1211
179 Ga0495665_0012589 3300046531 Bacteria 4580
180 Ga0495665_0034590 3300046531 Bacteria 2702
181 Ga0495640_0006222 3300046533 Bacteria 9446
182 Ga0495586_0072136 3300046535 Bacteria 1887
183 Ga0495587_0010988 3300046536 Bacteria 5744
184 Ga0495609_0002572 3300046538 Bacteria 11067
185 Ga0495609_0011021 3300046538 Bacteria 4318
186 Ga0495609_0011147 3300046538 Bacteria 4291
187 Ga0495609_0011910 3300046538 Bacteria 4134
188 Ga0495609_0020131 3300046538 Bacteria 3083
189 Ga0495609_0079188 3300046538 Bacteria 1437
190 Ga0495597_0000332 3300046542 Bacteria 42493
191 Ga0495597_0000728 3300046542 Bacteria 26264
192 Ga0495597_0004004 3300046542 Bacteria 8275
193 Ga0495597_0006246 3300046542 Bacteria 6176
194 Ga0495597_0006868 3300046542 Bacteria 5843
195 Ga0495597_0019288 3300046542 Bacteria 3192
196 Ga0495597_0022095 3300046542 Bacteria 2953
197 Ga0495597_0032856 3300046542 Bacteria 2353
198 Ga0495597_0124678 3300046542 Bacteria 1071
199 Ga0495622_0007141 3300046557 Bacteria 5189
200 Ga0495633_0004093 3300046558 Bacteria 9407
201 Ga0495633_0010088 3300046558 Bacteria 5175
202 Ga0495633_0012004 3300046558 Bacteria 4630
203 Ga0495633_0022566 3300046558 Bacteria 3130
204 Ga0495633_0116986 3300046558 Bacteria 1235
205 Ga0495656_0013663 3300046615 Bacteria 3026
206 Ga0495656_0036060 3300046615 Bacteria 2035
207 Ga0495668_0004912 3300046616 Bacteria 9282
208 Ga0495668_0007659 3300046616 Bacteria 6872
209 Ga0495668_0018601 3300046616 Bacteria 4014
210 Ga0495668_0022412 3300046616 Bacteria 3610
211 Ga0495668_0052021 3300046616 Bacteria 2267
212 Ga0495668_0058727 3300046616 Bacteria 2122
213 Ga0495668_0079171 3300046616 Bacteria 1804
214 Ga0495634_0008121 3300046642 Bacteria 7823
215 Ga0495611_0000792 3300046648 Bacteria 17558
216 Ga0495611_0005177 3300046648 Bacteria 5592
217 Ga0495611_0007932 3300046648 Bacteria 4507
218 Ga0495611_0085048 3300046648 Bacteria 1458
219 Ga0495611_0173198 3300046648 Bacteria 1008
220 Ga0495625_0046240 3300046660 Bacteria 3142
221 Ga0495625_0102159 3300046660 Bacteria 1968
222 Ga0495625_0251394 3300046660 Bacteria 1147
223 Ga0495635_0000550 3300046663 Bacteria 23878
224 Ga0495661_0001851 3300046665 Bacteria 16899
225 Ga0495661_0005503 3300046665 Bacteria 8989
226 Ga0495661_0006457 3300046665 Bacteria 8247
227 Ga0495661_0007032 3300046665 Bacteria 7867
228 Ga0495661_0020575 3300046665 Bacteria 4306
229 Ga0495661_0027218 3300046665 Bacteria 3672
230 Ga0495661_0039122 3300046665 Bacteria 2949
231 Ga0495661_0071227 3300046665 Bacteria 2032
232 Ga0495661_0140081 3300046665 Bacteria 1316
233 Ga0495661_0169989 3300046665 Bacteria 1163
234 Ga0495661_0213401 3300046665 Bacteria 1003
235 Ga0495588_0003189 3300046674 Bacteria 7097
236 Ga0495588_0006653 3300046674 Bacteria 5219
237 Ga0495588_0020202 3300046674 Bacteria 3270
238 Ga0495588_0044841 3300046674 Bacteria 2265
239 Ga0495588_0057501 3300046674 Bacteria 2009
240 Ga0495588_0089773 3300046674 Bacteria 1609
241 Ga0495588_0104407 3300046674 Bacteria 1490
242 Ga0495623_0010770 3300046679 Bacteria 5921
243 Ga0495623_0011213 3300046679 Bacteria 5798
244 Ga0495669_0000305 3300046684 Bacteria 27179
245 Ga0495669_0000799 3300046684 Bacteria 13449
246 Ga0495669_0002363 3300046684 Bacteria 7738
247 Ga0495669_0007473 3300046684 Bacteria 4582
248 Ga0495669_0018474 3300046684 Bacteria 2998
249 Ga0495669_0060188 3300046684 Bacteria 1716
250 Ga0495669_0071297 3300046684 Bacteria 1584
251 Ga0495613_0026565 3300046689 Bacteria 4312
252 Ga0495613_0072579 3300046689 Bacteria 2509
253 Ga0495670_0000228 3300046691 Bacteria 25521
254 Ga0495670_0004763 3300046691 Bacteria 6665
255 Ga0495670_0006478 3300046691 Bacteria 5754
256 Ga0495670_0008864 3300046691 Bacteria 4949
257 Ga0495670_0026331 3300046691 Bacteria 2878
258 Ga0495670_0029075 3300046691 Bacteria 2742
259 Ga0495671_0004166 3300046692 Bacteria 8712
260 Ga0495671_0006131 3300046692 Bacteria 6975
261 Ga0495671_0015767 3300046692 Bacteria 4043
262 Ga0495649_0000511 3300046694 Bacteria 33219
263 Ga0495649_0002688 3300046694 Bacteria 12388
264 Ga0495649_0033054 3300046694 Bacteria 2847
265 Ga0495649_0072916 3300046694 Bacteria 1840
266 Ga0495649_0097724 3300046694 Bacteria 1562
267 Ga0495589_0000569 3300046794 Bacteria 25465
268 Ga0495589_0000651 3300046794 Bacteria 22766
269 Ga0495589_0013689 3300046794 Bacteria 4182
270 Ga0495589_0018910 3300046794 Bacteria 3533
271 Ga0495589_0028227 3300046794 Bacteria 2832
272 Ga0495589_0038954 3300046794 Bacteria 2377
273 Ga0495589_0040539 3300046794 Bacteria 2325
274 Ga0495589_0092908 3300046794 Bacteria 1464
275 Ga0495600_0136528 3300046809 Bacteria 1593
276 Ga0495660_0004334 3300046810 Bacteria 8593
277 Ga0495660_0005056 3300046810 Bacteria 7923
278 Ga0495660_0007590 3300046810 Bacteria 6369
279 Ga0495660_0018329 3300046810 Bacteria 4024
280 Ga0495660_0021101 3300046810 Bacteria 3732
281 Ga0495660_0039661 3300046810 Bacteria 2614
282 Ga0495660_0052164 3300046810 Bacteria 2223
283 Ga0495660_0185861 3300046810 Bacteria 1002
284 Ga0495581_0004017 3300047315 Bacteria 8471
285 Ga0495604_0082331 3300047317 Bacteria 2407
286 Ga0495636_0006601 3300047318 Bacteria 4563
287 Ga0495672_0000118 3300047320 Bacteria 124396
288 Ga0495672_0011282 3300047320 Bacteria 6315
289 Ga0495672_0028863 3300047320 Bacteria 3503
290 Ga0495676_0000014 3300047321 Bacteria 203356
291 Ga0495680_0003382 3300047322 Bacteria 15762
292 Ga0495680_0007141 3300047322 Bacteria 10289
293 Ga0495683_0000594 3300047323 Bacteria 27203
294 Ga0495683_0005820 3300047323 Bacteria 6785
295 Ga0495683_0014608 3300047323 Bacteria 4091
296 Ga0495683_0015627 3300047323 Bacteria 3945
297 Ga0495683_0024644 3300047323 Bacteria 3087
298 Ga0495687_000049 3300047443 Bacteria 205432
299 Ga0495687_003380 3300047443 Bacteria 11638
300 Ga0495687_041218 3300047443 Bacteria 2027
301 Ga0495675_0036528 3300047444 Bacteria 3132
302 Ga0495675_0060597 3300047444 Bacteria 2398
303 Ga0495677_0000267 3300047445 Bacteria 22920
304 Ga0495677_0000473 3300047445 Bacteria 17220
305 Ga0495677_0000597 3300047445 Bacteria 14827
306 Ga0495677_0001269 3300047445 Bacteria 10123
307 Ga0495677_0012580 3300047445 Bacteria 3085
308 Ga0495677_0013141 3300047445 Bacteria 3012
309 Ga0495677_0020561 3300047445 Bacteria 2393
310 Ga0495677_0030516 3300047445 Bacteria 1962
311 Ga0495677_0061024 3300047445 Bacteria 1398
312 Ga0495679_003782 3300047446 Bacteria 7183
313 Ga0495679_006072 3300047446 Bacteria 5270
314 Ga0495679_011549 3300047446 Bacteria 3401
315 Ga0495679_019923 3300047446 Bacteria 2346
316 Ga0495679_030933 3300047446 Bacteria 1732
317 Ga0495679_076353 3300047446 Bacteria 957
318 Ga0495685_015429 3300047447 Bacteria 2605
319 Ga0495681_0000494 3300047470 Bacteria 30235
320 Ga0495681_0003130 3300047470 Bacteria 11602
321 Ga0495681_0004522 3300047470 Bacteria 9480
322 Ga0495681_0012874 3300047470 Bacteria 4890
323 Ga0495681_0019850 3300047470 Bacteria 3657
324 Ga0495681_0039252 3300047470 Bacteria 2314
325 Ga0495686_0000140 3300047472 Bacteria 144956
326 Ga0495686_0027765 3300047472 Bacteria 3692
327 Ga0495593_0000527 3300047673 Bacteria 21657
328 Ga0495593_0129919 3300047673 Bacteria 1279
329 Ga0495602_0016918 3300048088 Bacteria 7318
330 Ga0495614_0000102 3300048089 Bacteria 29128
331 Ga0495626_0001987 3300048091 Bacteria 15093
332 Ga0495626_0004110 3300048091 Bacteria 9046
333 Ga0495626_0005528 3300048091 Bacteria 7358
334 Ga0495626_0017056 3300048091 Bacteria 3673
335 Ga0495626_0023357 3300048091 Bacteria 3046
336 Ga0495626_0029390 3300048091 Bacteria 2660
337 Ga0495626_0055190 3300048091 Bacteria 1822
338 Ga0495626_0056250 3300048091 Bacteria 1801
339 Ga0495626_0067790 3300048091 Bacteria 1610
340 Ga0496102_0000098 3300048905 Bacteria 123789
341 Ga0496102_0311262 3300048905 Bacteria 1484
342 Ga0496103_0083395 3300048906 Bacteria 2012
343 Ga0496105_0139990 3300048908 Unclassified 1992
344 Ga0496106_0149116 3300048909 Unclassified 1844
345 Ga0496107_0067249 3300048910 Bacteria 2600
346 Ga0496108_0088429 3300048911 Bacteria 2632
347 Ga0496110_0002669 3300048913 Bacteria 13468
348 Ga0496110_0006620 3300048913 Bacteria 9205
349 Ga0496111_0014982 3300048914 Bacteria 5312
350 Ga0496111_0118898 3300048914 Bacteria 1951
351 Ga0496112_0122929 3300048915 Bacteria 2566
352 Ga0496122_0112726 3300048925 Bacteria 1780
353 Ga0496124_0083190 3300048927 Bacteria 2626
354 Ga0496124_0132298 3300048927 Bacteria 1980
355 Ga0496124_0429965 3300048927 Bacteria 907
356 Ga0495678_000056 3300049459 Bacteria 149598
357 Ga0495678_002201 3300049459 Bacteria 13668
358 Ga0495678_004476 3300049459 Bacteria 8072
359 Ga0495678_006923 3300049459 Bacteria 5950
360 Ga0495678_011366 3300049459 Bacteria 4266
361 Ga0495682_0001378 3300049460 Bacteria 13289
362 Ga0495682_0003556 3300049460 Bacteria 6890
363 Ga0495682_0017682 3300049460 Bacteria 2687

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047318 Ga0495636_0006601 Ga0495636_0006601_18_767 249
2 3300046558 Ga0495633_0022566 Ga0495633_0022566_14_769 251
3 3300046507 Ga0495606_0048262 Ga0495606_0048262_1289_2062 257
4 3300046524 Ga0495648_0175706 Ga0495648_0175706_129_977 258
5 3300048091 Ga0495626_0005528 Ga0495626_0005528_2548_3396 258
6 3300021361 Ga0213872_10003619 Ga0213872_100036196 259
7 3300021361 Ga0213872_10106640 Ga0213872_101066402 259
8 3300030731 Ga0316177_1042130 Ga0316177_10421302 259
9 3300030736 Ga0316180_1003511 Ga0316180_10035117 259
10 3300039447 Ga0436361_0700482 Ga0436361_0700482_3430_4275 259
11 3300039447 Ga0436361_0850324 Ga0436361_0850324_6976_7821 259
12 3300046457 Ga0495590_0049214 Ga0495590_0049214_191_1039 259
13 3300046491 Ga0495584_0013577 Ga0495584_0013577_3056_3904 259
14 3300046500 Ga0495596_0133968 Ga0495596_0133968_25_873 259
15 3300046506 Ga0495583_0008040 Ga0495583_0008040_2728_3576 259
16 3300046513 Ga0495616_0007749 Ga0495616_0007749_1505_2353 259
17 3300046518 Ga0495631_0043773 Ga0495631_0043773_974_1822 259
18 3300046519 Ga0495632_0029070 Ga0495632_0029070_1290_2138 259
19 3300046520 Ga0495637_0053847 Ga0495637_0053847_110_958 259
20 3300046523 Ga0495644_0005351 Ga0495644_0005351_1598_2446 259
21 3300046524 Ga0495648_0017194 Ga0495648_0017194_343_1191 259
22 3300046528 Ga0495642_0007904 Ga0495642_0007904_1856_2704 259
23 3300046528 Ga0495642_0121377 Ga0495642_0121377_78_944 259
24 3300046530 Ga0495654_0077261 Ga0495654_0077261_393_1241 259
25 3300046538 Ga0495609_0079188 Ga0495609_0079188_293_1141 259
26 3300046660 Ga0495625_0251394 Ga0495625_0251394_113_961 259
27 3300046665 Ga0495661_0169989 Ga0495661_0169989_227_1075 259
28 3300046684 Ga0495669_0060188 Ga0495669_0060188_117_965 259
29 3300046691 Ga0495670_0026331 Ga0495670_0026331_1231_2079 259
30 3300046810 Ga0495660_0018329 Ga0495660_0018329_2569_3417 259
31 3300047323 Ga0495683_0014608 Ga0495683_0014608_2537_3385 259
32 3300047446 Ga0495679_030933 Ga0495679_030933_461_1309 259
33 3300048091 Ga0495626_0017056 Ga0495626_0017056_2577_3425 259
34 3300049459 Ga0495678_011366 Ga0495678_011366_2209_3057 259
35 3300046648 Ga0495611_0173198 Ga0495611_0173198_14_796 260
36 3300046542 Ga0495597_0004004 Ga0495597_0004004_3123_3971 262
37 3300046457 Ga0495590_0002842 Ga0495590_0002842_4047_4856 264
38 3300046501 Ga0495607_0002023 Ga0495607_0002023_13347_14216 264
39 3300046513 Ga0495616_0025202 Ga0495616_0025202_1135_2004 264
40 3300046519 Ga0495632_0003384 Ga0495632_0003384_4018_4887 264
41 3300046522 Ga0495643_0002368 Ga0495643_0002368_6603_7484 264
42 3300046665 Ga0495661_0006457 Ga0495661_0006457_3288_4157 264
43 3300047320 Ga0495672_0028863 Ga0495672_0028863_519_1388 264
44 3300047445 Ga0495677_0001269 Ga0495677_0001269_6187_7056 264
45 3300046507 Ga0495606_0234235 Ga0495606_0234235_90_923 266
46 3300046694 Ga0495649_0097724 Ga0495649_0097724_472_1305 266
47 3300005841 Ga0068863_100017903 Ga0068863_1000179033 267
48 3300021361 Ga0213872_10000058 Ga0213872_1000005866 267
49 3300039447 Ga0436361_0068556 Ga0436361_0068556_51211_52056 267
50 3300046474 Ga0495605_0007197 Ga0495605_0007197_2700_3548 267
51 3300046474 Ga0495605_0196322 Ga0495605_0196322_25_843 267
52 3300046491 Ga0495584_0018737 Ga0495584_0018737_1256_2104 267
53 3300046518 Ga0495631_0008828 Ga0495631_0008828_4192_5040 267
54 3300046528 Ga0495642_0020299 Ga0495642_0020299_1487_2335 267
55 3300046530 Ga0495654_0032844 Ga0495654_0032844_1559_2407 267
56 3300046542 Ga0495597_0006246 Ga0495597_0006246_5300_6148 267
57 3300046616 Ga0495668_0007659 Ga0495668_0007659_2468_3316 267
58 3300046665 Ga0495661_0213401 Ga0495661_0213401_164_982 267
59 3300046794 Ga0495589_0013689 Ga0495589_0013689_1583_2431 267
60 3300047320 Ga0495672_0011282 Ga0495672_0011282_4271_5119 267
61 3300048911 Ga0496108_0088429 Ga0496108_0088429_501_1373 267
62 3300048915 Ga0496112_0122929 Ga0496112_0122929_392_1264 267
63 3300046518 Ga0495631_0145959 Ga0495631_0145959_127_942 268
64 3300047445 Ga0495677_0061024 Ga0495677_0061024_119_961 268
65 3300048091 Ga0495626_0056250 Ga0495626_0056250_588_1403 268
66 3300048905 Ga0496102_0000098 Ga0496102_0000098_20390_21205 268
67 3300048910 Ga0496107_0067249 Ga0496107_0067249_1529_2344 268
68 3300048925 Ga0496122_0112726 Ga0496122_0112726_87_899 268
69 3300048927 Ga0496124_0429965 Ga0496124_0429965_62_877 268
70 3300044842 Ga0466957_0000994 Ga0466957_0000994_8592_9422 269
71 3300046463 Ga0495653_0023115 Ga0495653_0023115_1407_2288 269
72 3300046526 Ga0495666_0056388 Ga0495666_0056388_362_1243 269
73 3300047322 Ga0495680_0007141 Ga0495680_0007141_9249_10130 269
74 3300046542 Ga0495597_0032856 Ga0495597_0032856_1197_2027 270
75 3300046522 Ga0495643_0013968 Ga0495643_0013968_1051_1881 272
76 3300048927 Ga0496124_0083190 Ga0496124_0083190_1563_2393 272
77 3300048927 Ga0496124_0132298 Ga0496124_0132298_324_1154 272
78 iso_pu_bacteria 2808606418 2809144361 272
79 3300046452 Ga0495617_000002 Ga0495617_000002_333328_334161 273
80 3300046453 Ga0495627_000339 Ga0495627_000339_39245_40078 273
81 3300046471 Ga0495650_0017064 Ga0495650_0017064_823_1656 273
82 3300046474 Ga0495605_0000108 Ga0495605_0000108_96928_97761 273
83 3300046492 Ga0495585_0010549 Ga0495585_0010549_451_1356 273
84 3300046500 Ga0495596_0011447 Ga0495596_0011447_79_912 273
85 3300046501 Ga0495607_0002838 Ga0495607_0002838_8816_9649 273
86 3300046506 Ga0495583_0005566 Ga0495583_0005566_3475_4380 273
87 3300046513 Ga0495616_0004553 Ga0495616_0004553_4100_4933 273
88 3300046513 Ga0495616_0102871 Ga0495616_0102871_75_980 273
89 3300046518 Ga0495631_0003682 Ga0495631_0003682_6893_7726 273
90 3300046518 Ga0495631_0098687 Ga0495631_0098687_399_1232 273
91 3300046519 Ga0495632_0000878 Ga0495632_0000878_7850_8683 273
92 3300046523 Ga0495644_0015325 Ga0495644_0015325_65_898 273
93 3300046523 Ga0495644_0044857 Ga0495644_0044857_782_1615 273
94 3300046524 Ga0495648_0000220 Ga0495648_0000220_60562_61395 273
95 3300046524 Ga0495648_0046068 Ga0495648_0046068_1091_1924 273
96 3300046528 Ga0495642_0000345 Ga0495642_0000345_17670_18503 273
97 3300046538 Ga0495609_0011910 Ga0495609_0011910_2400_3233 273
98 3300046558 Ga0495633_0116986 Ga0495633_0116986_24_857 273
99 3300046615 Ga0495656_0036060 Ga0495656_0036060_707_1540 273
100 3300046616 Ga0495668_0004912 Ga0495668_0004912_3828_4661 273
101 3300046665 Ga0495661_0005503 Ga0495661_0005503_4701_5534 273
102 3300046665 Ga0495661_0007032 Ga0495661_0007032_4186_5019 273
103 3300046691 Ga0495670_0008864 Ga0495670_0008864_1688_2521 273
104 3300046692 Ga0495671_0004166 Ga0495671_0004166_3795_4628 273
105 3300046794 Ga0495589_0000651 Ga0495589_0000651_4073_4906 273
106 3300046810 Ga0495660_0007590 Ga0495660_0007590_3167_4000 273
107 3300047443 Ga0495687_000049 Ga0495687_000049_182530_183435 273
108 3300047445 Ga0495677_0000597 Ga0495677_0000597_10199_11032 273
109 3300047445 Ga0495677_0030516 Ga0495677_0030516_466_1371 273
110 3300047446 Ga0495679_006072 Ga0495679_006072_3722_4555 273
111 3300048905 Ga0496102_0311262 Ga0496102_0311262_89_922 273
112 3300005262 Ga0065165_1001239 Ga0065165_10012393 274
113 3300046491 Ga0495584_0000712 Ga0495584_0000712_3008_3871 274
114 3300046500 Ga0495596_0007518 Ga0495596_0007518_855_1718 274
115 3300046500 Ga0495596_0010547 Ga0495596_0010547_2383_3243 274
116 3300046500 Ga0495596_0065976 Ga0495596_0065976_58_921 274
117 3300046513 Ga0495616_0034551 Ga0495616_0034551_1539_2402 274
118 3300046518 Ga0495631_0008028 Ga0495631_0008028_3094_3957 274
119 3300046522 Ga0495643_0004152 Ga0495643_0004152_7175_8038 274
120 3300046528 Ga0495642_0003402 Ga0495642_0003402_2486_3349 274
121 3300046528 Ga0495642_0045930 Ga0495642_0045930_25_885 274
122 3300046616 Ga0495668_0022412 Ga0495668_0022412_1402_2265 274
123 3300046648 Ga0495611_0000792 Ga0495611_0000792_10921_11784 274
124 3300046684 Ga0495669_0002363 Ga0495669_0002363_3892_4755 274
125 3300046694 Ga0495649_0000511 Ga0495649_0000511_3218_4081 274
126 3300046694 Ga0495649_0033054 Ga0495649_0033054_1753_2616 274
127 3300046794 Ga0495589_0040539 Ga0495589_0040539_321_1184 274
128 3300046810 Ga0495660_0004334 Ga0495660_0004334_4025_4888 274
129 3300046810 Ga0495660_0021101 Ga0495660_0021101_1375_2238 274
130 3300046810 Ga0495660_0052164 Ga0495660_0052164_1114_1974 274
131 3300047323 Ga0495683_0024644 Ga0495683_0024644_1465_2328 274
132 3300047443 Ga0495687_003380 Ga0495687_003380_3507_4367 274
133 3300047445 Ga0495677_0000267 Ga0495677_0000267_17898_18761 274
134 3300047446 Ga0495679_019923 Ga0495679_019923_209_1072 274
135 3300047472 Ga0495686_0000140 Ga0495686_0000140_54547_55410 274
136 3300047472 Ga0495686_0027765 Ga0495686_0027765_1966_2829 274
137 3300048091 Ga0495626_0001987 Ga0495626_0001987_8422_9285 274
138 3300048091 Ga0495626_0055190 Ga0495626_0055190_493_1356 274
139 3300049459 Ga0495678_000056 Ga0495678_000056_17995_18858 274
140 3300049460 Ga0495682_0003556 Ga0495682_0003556_3172_4035 274
141 3300049460 Ga0495682_0017682 Ga0495682_0017682_248_1111 274
142 iso_pu_bacteria 2643221639 2644217833 274
143 iso_pu_bacteria 2643221646 2644258432 274
144 iso_pu_bacteria 2738541337 2739055033 274
145 3300046457 Ga0495590_0004702 Ga0495590_0004702_3171_4058 275
146 3300046471 Ga0495650_0010045 Ga0495650_0010045_1441_2316 275
147 3300046491 Ga0495584_0020123 Ga0495584_0020123_37_903 275
148 3300046492 Ga0495585_0041301 Ga0495585_0041301_535_1401 275
149 3300046492 Ga0495585_0127467 Ga0495585_0127467_328_1194 275
150 3300046500 Ga0495596_0016256 Ga0495596_0016256_2107_2973 275
151 3300046501 Ga0495607_0208870 Ga0495607_0208870_38_904 275
152 3300046506 Ga0495583_0000503 Ga0495583_0000503_17096_17962 275
153 3300046506 Ga0495583_0024658 Ga0495583_0024658_816_1682 275
154 3300046506 Ga0495583_0028354 Ga0495583_0028354_1029_1904 275
155 3300046512 Ga0495610_0063096 Ga0495610_0063096_312_1178 275
156 3300046513 Ga0495616_0006451 Ga0495616_0006451_3398_4264 275
157 3300046518 Ga0495631_0013206 Ga0495631_0013206_591_1457 275
158 3300046518 Ga0495631_0040039 Ga0495631_0040039_458_1375 275
159 3300046523 Ga0495644_0062740 Ga0495644_0062740_363_1229 275
160 3300046542 Ga0495597_0000332 Ga0495597_0000332_37634_38509 275
161 3300046616 Ga0495668_0018601 Ga0495668_0018601_1261_2127 275
162 3300046674 Ga0495588_0044841 Ga0495588_0044841_1272_2147 275
163 3300046684 Ga0495669_0071297 Ga0495669_0071297_363_1229 275
164 3300046691 Ga0495670_0004763 Ga0495670_0004763_1572_2459 275
165 3300046794 Ga0495589_0000569 Ga0495589_0000569_15407_16282 275
166 3300046794 Ga0495589_0038954 Ga0495589_0038954_883_1749 275
167 3300046810 Ga0495660_0185861 Ga0495660_0185861_78_953 275
168 3300047323 Ga0495683_0005820 Ga0495683_0005820_2929_3795 275
169 3300047443 Ga0495687_041218 Ga0495687_041218_1039_1914 275
170 3300047470 Ga0495681_0039252 Ga0495681_0039252_772_1638 275
171 3300048091 Ga0495626_0029390 Ga0495626_0029390_1431_2297 275
172 3300048913 Ga0496110_0002669 Ga0496110_0002669_4119_4952 275
173 3300048914 Ga0496111_0118898 Ga0496111_0118898_83_916 275
174 3300049459 Ga0495678_002201 Ga0495678_002201_3642_4508 275
175 3300049460 Ga0495682_0001378 Ga0495682_0001378_3642_4508 275
176 3300003323 rootH1_10011041 rootH1_100110414 276
177 3300042139 Ga0450904_001513 Ga0450904_001513_56_961 276
178 3300046453 Ga0495627_009600 Ga0495627_009600_594_1472 276
179 3300046453 Ga0495627_036739 Ga0495627_036739_208_1077 276
180 3300046457 Ga0495590_0000007 Ga0495590_0000007_114800_115672 276
181 3300046458 Ga0495591_000039 Ga0495591_000039_55159_56031 276
182 3300046463 Ga0495653_0011532 Ga0495653_0011532_1132_1998 276
183 3300046472 Ga0495580_0011731 Ga0495580_0011731_2221_3087 276
184 3300046473 Ga0495582_0011683 Ga0495582_0011683_3754_4620 276
185 3300046474 Ga0495605_0008500 Ga0495605_0008500_1432_2310 276
186 3300046474 Ga0495605_0011252 Ga0495605_0011252_349_1221 276
187 3300046491 Ga0495584_0002110 Ga0495584_0002110_6762_7640 276
188 3300046491 Ga0495584_0005350 Ga0495584_0005350_1731_2597 276
189 3300046491 Ga0495584_0006348 Ga0495584_0006348_2971_3849 276
190 3300046492 Ga0495585_0001726 Ga0495585_0001726_11443_12321 276
191 3300046492 Ga0495585_0002480 Ga0495585_0002480_7719_8588 276
192 3300046492 Ga0495585_0011985 Ga0495585_0011985_2727_3599 276
193 3300046492 Ga0495585_0134874 Ga0495585_0134874_223_1101 276
194 3300046492 Ga0495585_0152714 Ga0495585_0152714_105_983 276
195 3300046499 Ga0495594_0028756 Ga0495594_0028756_99_968 276
196 3300046499 Ga0495594_0096666 Ga0495594_0096666_269_1135 276
197 3300046500 Ga0495596_0002487 Ga0495596_0002487_4243_5121 276
198 3300046500 Ga0495596_0003084 Ga0495596_0003084_4233_5111 276
199 3300046500 Ga0495596_0014049 Ga0495596_0014049_337_1203 276
200 3300046501 Ga0495607_0001375 Ga0495607_0001375_2615_3493 276
201 3300046501 Ga0495607_0002914 Ga0495607_0002914_7193_8065 276
202 3300046501 Ga0495607_0027946 Ga0495607_0027946_66_935 276
203 3300046506 Ga0495583_0001311 Ga0495583_0001311_7929_8807 276
204 3300046506 Ga0495583_0001962 Ga0495583_0001962_10921_11793 276
205 3300046506 Ga0495583_0008628 Ga0495583_0008628_2407_3285 276
206 3300046507 Ga0495606_0060744 Ga0495606_0060744_417_1295 276
207 3300046507 Ga0495606_0093382 Ga0495606_0093382_888_1760 276
208 3300046512 Ga0495610_0002370 Ga0495610_0002370_10838_11710 276
209 3300046513 Ga0495616_0011802 Ga0495616_0011802_3101_3979 276
210 3300046517 Ga0495630_0172013 Ga0495630_0172013_653_1519 276
211 3300046518 Ga0495631_0004617 Ga0495631_0004617_4159_5028 276
212 3300046518 Ga0495631_0031256 Ga0495631_0031256_1280_2158 276
213 3300046519 Ga0495632_0000837 Ga0495632_0000837_7619_8497 276
214 3300046519 Ga0495632_0006824 Ga0495632_0006824_3652_4530 276
215 3300046520 Ga0495637_0000006 Ga0495637_0000006_366529_367401 276
216 3300046523 Ga0495644_0007813 Ga0495644_0007813_1426_2304 276
217 3300046523 Ga0495644_0019876 Ga0495644_0019876_1063_1932 276
218 3300046523 Ga0495644_0038451 Ga0495644_0038451_701_1579 276
219 3300046526 Ga0495666_0035579 Ga0495666_0035579_503_1369 276
220 3300046528 Ga0495642_0010611 Ga0495642_0010611_865_1743 276
221 3300046528 Ga0495642_0014317 Ga0495642_0014317_742_1611 276
222 3300046528 Ga0495642_0023975 Ga0495642_0023975_500_1378 276
223 3300046529 Ga0495652_0006263 Ga0495652_0006263_7666_8532 276
224 3300046530 Ga0495654_0116874 Ga0495654_0116874_291_1160 276
225 3300046531 Ga0495665_0012589 Ga0495665_0012589_2638_3504 276
226 3300046531 Ga0495665_0034590 Ga0495665_0034590_64_933 276
227 3300046533 Ga0495640_0006222 Ga0495640_0006222_7548_8417 276
228 3300046535 Ga0495586_0072136 Ga0495586_0072136_654_1520 276
229 3300046538 Ga0495609_0011021 Ga0495609_0011021_124_1002 276
230 3300046542 Ga0495597_0000728 Ga0495597_0000728_17863_18741 276
231 3300046542 Ga0495597_0006868 Ga0495597_0006868_2553_3419 276
232 3300046542 Ga0495597_0019288 Ga0495597_0019288_2115_2993 276
233 3300046558 Ga0495633_0004093 Ga0495633_0004093_7629_8501 276
234 3300046558 Ga0495633_0010088 Ga0495633_0010088_1664_2542 276
235 3300046558 Ga0495633_0012004 Ga0495633_0012004_795_1673 276
236 3300046615 Ga0495656_0013663 Ga0495656_0013663_2033_2911 276
237 3300046616 Ga0495668_0052021 Ga0495668_0052021_293_1171 276
238 3300046616 Ga0495668_0079171 Ga0495668_0079171_622_1488 276
239 3300046642 Ga0495634_0008121 Ga0495634_0008121_1159_2025 276
240 3300046648 Ga0495611_0005177 Ga0495611_0005177_652_1521 276
241 3300046648 Ga0495611_0007932 Ga0495611_0007932_1313_2191 276
242 3300046648 Ga0495611_0085048 Ga0495611_0085048_66_944 276
243 3300046665 Ga0495661_0001851 Ga0495661_0001851_11691_12569 276
244 3300046665 Ga0495661_0039122 Ga0495661_0039122_1858_2706 276
245 3300046665 Ga0495661_0140081 Ga0495661_0140081_339_1211 276
246 3300046674 Ga0495588_0057501 Ga0495588_0057501_449_1318 276
247 3300046674 Ga0495588_0089773 Ga0495588_0089773_607_1473 276
248 3300046679 Ga0495623_0011213 Ga0495623_0011213_4705_5571 276
249 3300046684 Ga0495669_0000305 Ga0495669_0000305_14953_15795 276
250 3300046684 Ga0495669_0007473 Ga0495669_0007473_250_1119 276
251 3300046684 Ga0495669_0018474 Ga0495669_0018474_1194_2072 276
252 3300046691 Ga0495670_0000228 Ga0495670_0000228_16154_17032 276
253 3300046691 Ga0495670_0006478 Ga0495670_0006478_4116_4964 276
254 3300046691 Ga0495670_0029075 Ga0495670_0029075_1206_2084 276
255 3300046692 Ga0495671_0006131 Ga0495671_0006131_4772_5650 276
256 3300046692 Ga0495671_0015767 Ga0495671_0015767_1840_2718 276
257 3300046694 Ga0495649_0072916 Ga0495649_0072916_379_1257 276
258 3300046794 Ga0495589_0018910 Ga0495589_0018910_416_1294 276
259 3300046794 Ga0495589_0028227 Ga0495589_0028227_106_978 276
260 3300046810 Ga0495660_0005056 Ga0495660_0005056_3494_4372 276
261 3300046810 Ga0495660_0039661 Ga0495660_0039661_417_1295 276
262 3300047320 Ga0495672_0000118 Ga0495672_0000118_120434_121306 276
263 3300047323 Ga0495683_0000594 Ga0495683_0000594_3875_4747 276
264 3300047323 Ga0495683_0015627 Ga0495683_0015627_1589_2467 276
265 3300047444 Ga0495675_0036528 Ga0495675_0036528_91_957 276
266 3300047445 Ga0495677_0012580 Ga0495677_0012580_405_1283 276
267 3300047445 Ga0495677_0013141 Ga0495677_0013141_223_1101 276
268 3300047445 Ga0495677_0020561 Ga0495677_0020561_216_1094 276
269 3300047446 Ga0495679_003782 Ga0495679_003782_2028_2906 276
270 3300047446 Ga0495679_011549 Ga0495679_011549_912_1784 276
271 3300047447 Ga0495685_015429 Ga0495685_015429_484_1356 276
272 3300047470 Ga0495681_0003130 Ga0495681_0003130_4778_5656 276
273 3300047470 Ga0495681_0004522 Ga0495681_0004522_4288_5166 276
274 3300047470 Ga0495681_0012874 Ga0495681_0012874_1955_2827 276
275 3300047470 Ga0495681_0019850 Ga0495681_0019850_1149_2027 276
276 3300047673 Ga0495593_0129919 Ga0495593_0129919_35_901 276
277 3300048091 Ga0495626_0004110 Ga0495626_0004110_4443_5312 276
278 3300048091 Ga0495626_0023357 Ga0495626_0023357_1197_2075 276
279 3300049459 Ga0495678_004476 Ga0495678_004476_4225_5103 276
280 3300049459 Ga0495678_006923 Ga0495678_006923_857_1735 276
281 3300003794 Ga0055531_10000064 Ga0055531_10000064113 277
282 3300021361 Ga0213872_10000150 Ga0213872_100001506 277
283 3300025298 Ga0209050_1002657 Ga0209050_10026579 277
284 3300025303 Ga0209051_1006872 Ga0209051_10068722 277
285 3300025304 Ga0209257_1000094 Ga0209257_1000094224 277
286 3300025304 Ga0209257_1018582 Ga0209257_10185823 277
287 3300031250 Ga0265331_10003453 Ga0265331_100034531 277
288 3300031251 Ga0265327_10000012 Ga0265327_10000012166 277
289 3300037471 Ga0395905_0000719 Ga0395905_0000719_14217_15050 277
290 3300037471 Ga0395905_0041799 Ga0395905_0041799_2934_3818 277
291 3300039447 Ga0436361_0018388 Ga0436361_0018388_6104_6949 277
292 3300046452 Ga0495617_006501 Ga0495617_006501_484_1404 277
293 3300046455 Ga0495603_0010744 Ga0495603_0010744_4439_5332 277
294 3300046463 Ga0495653_0014264 Ga0495653_0014264_799_1719 277
295 3300046474 Ga0495605_0005103 Ga0495605_0005103_438_1343 277
296 3300046474 Ga0495605_0009080 Ga0495605_0009080_1477_2349 277
297 3300046474 Ga0495605_0010316 Ga0495605_0010316_275_1168 277
298 3300046474 Ga0495605_0013904 Ga0495605_0013904_475_1395 277
299 3300046491 Ga0495584_0003500 Ga0495584_0003500_2597_3469 277
300 3300046491 Ga0495584_0005403 Ga0495584_0005403_2548_3420 277
301 3300046492 Ga0495585_0012408 Ga0495585_0012408_2569_3441 277
302 3300046492 Ga0495585_0144337 Ga0495585_0144337_203_1123 277
303 3300046499 Ga0495594_0009109 Ga0495594_0009109_2937_3809 277
304 3300046507 Ga0495606_0027117 Ga0495606_0027117_915_1763 277
305 3300046513 Ga0495616_0000193 Ga0495616_0000193_46201_47124 277
306 3300046518 Ga0495631_0120155 Ga0495631_0120155_39_911 277
307 3300046519 Ga0495632_0000374 Ga0495632_0000374_36480_37373 277
308 3300046519 Ga0495632_0015440 Ga0495632_0015440_2207_3079 277
309 3300046519 Ga0495632_0157543 Ga0495632_0157543_41_925 277
310 3300046522 Ga0495643_0005916 Ga0495643_0005916_4004_4876 277
311 3300046523 Ga0495644_0003184 Ga0495644_0003184_1990_2910 277
312 3300046524 Ga0495648_0016893 Ga0495648_0016893_4144_5064 277
313 3300046524 Ga0495648_0161269 Ga0495648_0161269_207_1127 277
314 3300046528 Ga0495642_0000855 Ga0495642_0000855_5985_6878 277
315 3300046528 Ga0495642_0095522 Ga0495642_0095522_226_1098 277
316 3300046530 Ga0495654_0030213 Ga0495654_0030213_976_1896 277
317 3300046536 Ga0495587_0010988 Ga0495587_0010988_4501_5406 277
318 3300046538 Ga0495609_0002572 Ga0495609_0002572_3290_4162 277
319 3300046538 Ga0495609_0011147 Ga0495609_0011147_2382_3302 277
320 3300046538 Ga0495609_0020131 Ga0495609_0020131_331_1224 277
321 3300046542 Ga0495597_0022095 Ga0495597_0022095_227_1147 277
322 3300046542 Ga0495597_0124678 Ga0495597_0124678_102_974 277
323 3300046557 Ga0495622_0007141 Ga0495622_0007141_1659_2531 277
324 3300046616 Ga0495668_0058727 Ga0495668_0058727_734_1654 277
325 3300046660 Ga0495625_0046240 Ga0495625_0046240_1936_2820 277
326 3300046660 Ga0495625_0102159 Ga0495625_0102159_533_1417 277
327 3300046663 Ga0495635_0000550 Ga0495635_0000550_13353_14273 277
328 3300046665 Ga0495661_0020575 Ga0495661_0020575_413_1285 277
329 3300046665 Ga0495661_0027218 Ga0495661_0027218_944_1864 277
330 3300046665 Ga0495661_0071227 Ga0495661_0071227_1105_1998 277
331 3300046674 Ga0495588_0003189 Ga0495588_0003189_2148_3068 277
332 3300046674 Ga0495588_0006653 Ga0495588_0006653_2873_3745 277
333 3300046674 Ga0495588_0020202 Ga0495588_0020202_1531_2424 277
334 3300046674 Ga0495588_0104407 Ga0495588_0104407_451_1371 277
335 3300046679 Ga0495623_0010770 Ga0495623_0010770_2388_3272 277
336 3300046684 Ga0495669_0000799 Ga0495669_0000799_3940_4833 277
337 3300046689 Ga0495613_0026565 Ga0495613_0026565_302_1222 277
338 3300046689 Ga0495613_0072579 Ga0495613_0072579_1345_2265 277
339 3300046694 Ga0495649_0002688 Ga0495649_0002688_7078_7950 277
340 3300046794 Ga0495589_0092908 Ga0495589_0092908_377_1297 277
341 3300046809 Ga0495600_0136528 Ga0495600_0136528_80_952 277
342 3300047315 Ga0495581_0004017 Ga0495581_0004017_2813_3733 277
343 3300047317 Ga0495604_0082331 Ga0495604_0082331_1000_1920 277
344 3300047321 Ga0495676_0000014 Ga0495676_0000014_184612_185484 277
345 3300047322 Ga0495680_0003382 Ga0495680_0003382_4249_5169 277
346 3300047444 Ga0495675_0060597 Ga0495675_0060597_840_1760 277
347 3300047445 Ga0495677_0000473 Ga0495677_0000473_9033_9905 277
348 3300047446 Ga0495679_076353 Ga0495679_076353_14_934 277
349 3300047470 Ga0495681_0000494 Ga0495681_0000494_17552_18424 277
350 3300047673 Ga0495593_0000527 Ga0495593_0000527_16259_17179 277
351 3300048088 Ga0495602_0016918 Ga0495602_0016918_4287_5159 277
352 3300048089 Ga0495614_0000102 Ga0495614_0000102_17202_18122 277
353 3300048091 Ga0495626_0067790 Ga0495626_0067790_567_1439 277
354 3300048906 Ga0496103_0083395 Ga0496103_0083395_142_1014 277
355 3300048908 Ga0496105_0139990 Ga0496105_0139990_256_1128 277
356 3300048909 Ga0496106_0149116 Ga0496106_0149116_813_1685 277
357 3300048913 Ga0496110_0006620 Ga0496110_0006620_4260_5132 277
358 3300048914 Ga0496111_0014982 Ga0496111_0014982_305_1177 277
359 3300003316 rootH1_10079852 rootH1_100798522 278
360 3300003322 rootL2_10005034 rootL2_100050342 278
361 3300003323 rootH1_10011039 rootH1_100110395 278
362 3300005614 Ga0068856_100129579 Ga0068856_1001295792 278
363 3300025905 Ga0207685_10082614 Ga0207685_100826141 278
364 3300026078 Ga0207702_10080273 Ga0207702_100802732 278
365 3300028794 Ga0307515_10036843 Ga0307515_1003684311 278
366 3300039450 Ga0436363_0785503 Ga0436363_0785503_474_1340 278

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00345

PapD_N

Pili and flagellar-assembly chaperone, PapD N-terminal domain

53

195

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f65-assembly4.cif.gz_D the f4 fimbrial chaperone faee does not self-cap its interactive surfaces 0.7315 25 165
3f65-assembly8.cif.gz_H the f4 fimbrial chaperone faee does not self-cap its interactive surfaces 0.7297 25 165
3f65-assembly6.cif.gz_F the f4 fimbrial chaperone faee does not self-cap its interactive surfaces 0.7284 25 165
3o0l-assembly1.cif.gz_B crystal structure of a pfam duf1425 family member (shew_1734) from shewanella sp. pv-4 at 1.81 a resolution 0.6984 173 261
3f6i-assembly2.cif.gz_B structure of the semet labeled f4 fibrial chaperone faee 0.6966 25 165
ID Description Score Start End Superfamily
af_A0A0R4IEX1_1690_1790_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8248 30 167 2.60.40.10
af_Q18438_11_137_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8183 26 168 2.60.40.10
af_Q4G0P3_2817_2929_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8113 39 166 2.60.40.10
af_Q9U2I5_26_123_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8088 25 128 2.60.40.10
3q48B01 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8036 26 165 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A4Q3KHX4-F1-model_v4 deleted 0.9277 26 278
AF-A0A4Q3KHX4-F1-model_v4 deleted 0.9205 26 278
AF-A0A538UB00-F1-model_v4 Uncharacterized protein 0.9104 164 278
AF-A0A2Z3MUU2-F1-model_v4 deleted 0.9083 160 277
AF-A0A165LPI4-F1-model_v4 Pili assembly chaperone N-terminal domain-containing protein 0.9055 24 277

Feature Viewer

pLDDT pTM Quality
82.64 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map