F424130

General Info

Members Datasets Scaffolds Average Seq Length
366 248 730 321

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0101692|Ga0495686_0101692_97_1230
Length 377
Sequence MLCAGANNAADPCETVKTPRFSADGVHARSGWLKCMAGWRDSMHSHRAHLRAGTGSLLMKAVALAIFPGVQALDVAGPLDVFAETNAFVETDRGYRLTLIGAERQPYRASNGMSITPEMTFADKEQAFDLALVAGGPALPTTLPDPRLVDWLGERASRCQQYGSICTGAFALGHAGLIDGKTVTTHWQDAPSLARQFPKAKVEFDRIYLRDGPLLTSAGVTAGIDLALAIVQDDHGPEVALAVARRLVVVAQRQGGQSQFSPYLVPPAEKDSSIARVHAHVMAHLREANGVDVLAQVAGMSPRSFARAFKRETNVTPAEFVESARLDAARNRLEGSDLPLKVVAHESGFGSAEHMRVVFVKRLGITPSHYRASFRKV

Samples

Sample ID Description Type Environment
1 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
10 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
13 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
14 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
15 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
16 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
17 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
18 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
19 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
20 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
21 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
22 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
23 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
24 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
25 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
26 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
27 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
30 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
31 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
32 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
33 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
34 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
35 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
38 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
39 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
40 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
49 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
50 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
51 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
52 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
54 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
55 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
56 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
57 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
58 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
59 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
60 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
61 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
62 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
63 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
64 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
65 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
66 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
67 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
68 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
69 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
70 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
71 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
72 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
73 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
74 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
75 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
76 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
77 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
78 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
79 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
80 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
81 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
82 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
83 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
84 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
85 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
86 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
87 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
88 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
89 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
90 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
91 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
92 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
93 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
94 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
95 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
96 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
97 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
98 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
99 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
100 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
101 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
102 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
103 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
104 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
105 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
106 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
107 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
108 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
109 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
110 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
120 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
121 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
122 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
123 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
124 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
125 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
126 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
129 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
130 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
131 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
132 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
133 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
134 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
135 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
136 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
137 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
138 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
139 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
140 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
141 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
142 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
143 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
144 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
145 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
146 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
147 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
148 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
149 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
150 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
151 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
152 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
153 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
154 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
155 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
156 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
157 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
158 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
159 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
160 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
161 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
162 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
163 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
164 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
165 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
166 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
167 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
168 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
169 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
170 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
171 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
172 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
173 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
174 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
175 2738541293 Rhizobium sp. GV031 Isolate Unclassified
176 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
177 2773857925 Microvirga vignae BR3299 Isolate Unclassified
178 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
179 2791355267 Rhizobium sp. L18 Isolate Nodule
180 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
181 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
182 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
183 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
184 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
185 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
186 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
187 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
188 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
189 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
190 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
191 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
192 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
193 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
194 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
195 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
196 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
197 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
198 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
199 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
200 2904504865 Serratia marcescens 1822 Isolate Unclassified
201 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
202 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
203 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
204 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
205 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
206 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
207 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
208 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
209 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
210 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
211 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
212 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
213 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
214 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
215 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
216 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
217 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
218 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
219 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
220 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
221 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
222 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
223 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
224 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
225 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
226 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
227 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
228 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
229 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
230 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
231 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
232 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
233 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
234 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
235 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
236 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
237 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
238 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
239 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
240 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
241 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
242 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
243 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
244 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
245 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
246 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
247 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
248 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 72.4
Metatranscriptomes 0
Isolates 27.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.84
Nodule 22.68
Rhizoplane 2.46
Rhizosphere 44.81
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495686_0101692 3300047472 Bacteria 1733
2 JGI25162J39368_1000109 3300002737 Bacteria 89947
3 JGI25165J46597_1000368 3300003214 Bacteria 50369
4 rootH2_10199025 3300003320 Bacteria 2948
5 rootL2_10103203 3300003322 Bacteria 1403
6 Ga0070658_10047406 3300005327 Bacteria 3478
7 Ga0070670_100005017 3300005331 Bacteria 11137
8 Ga0070667_100000214 3300005367 Bacteria 67467
9 Ga0070684_100183418 3300005535 Bacteria 1903
10 Ga0068853_100007092 3300005539 Bacteria 8967
11 Ga0068853_100029714 3300005539 Bacteria 4610
12 Ga0068853_100554616 3300005539 Bacteria 1089
13 Ga0070665_100112146 3300005548 Bacteria 2730
14 Ga0070665_100436765 3300005548 Bacteria 1318
15 Ga0068851_10016926 3300005834 Bacteria 3495
16 Ga0081540_1000809 3300005983 Bacteria 28697
17 Ga0075369_10009688 3300006186 Bacteria 3749
18 Ga0099825_1028570 3300006941 Bacteria 2695
19 Ga0099824_1017723 3300006942 Bacteria 6075
20 Ga0099822_1031267 3300006943 Bacteria 3923
21 Ga0099823_1030525 3300006944 Bacteria 4506
22 Ga0105251_10122871 3300009011 Bacteria 1179
23 Ga0105240_10000290 3300009093 Bacteria 97921
24 Ga0105240_10000336 3300009093 Bacteria 87900
25 Ga0105240_10007408 3300009093 Bacteria 15946
26 Ga0105240_10016389 3300009093 Bacteria 10034
27 Ga0105240_10035916 3300009093 Bacteria 6381
28 Ga0105240_10061314 3300009093 Bacteria 4687
29 Ga0105243_10552750 3300009148 Bacteria 1100
30 Ga0105237_10003793 3300009545 Bacteria 17765
31 Ga0105238_10142006 3300009551 Bacteria 2378
32 Ga0105239_10000024 3300010375 Bacteria 256334
33 Ga0105239_10000202 3300010375 Bacteria 87257
34 Ga0105239_10010502 3300010375 Bacteria 10351
35 Ga0157370_10003913 3300013104 Bacteria 17346
36 Ga0157369_10021636 3300013105 Bacteria 7192
37 Ga0157374_10016153 3300013296 Bacteria 6560
38 Ga0157372_10010786 3300013307 Bacteria 9727
39 Ga0157372_10644435 3300013307 Bacteria 1234
40 Ga0163163_10116520 3300014325 Bacteria 2703
41 Ga0157380_10241940 3300014326 Bacteria 1627
42 Ga0182007_10026536 3300015262 Bacteria 2006
43 Ga0182005_1001606 3300015265 Bacteria 8858
44 Ga0213872_10008747 3300021361 Bacteria 4887
45 Ga0209437_100064 3300025233 Bacteria 334360
46 Ga0209677_107107 3300025253 Bacteria 2464
47 Ga0209677_109223 3300025253 Bacteria 1799
48 Ga0209148_1000396 3300025254 Bacteria 51441
49 Ga0209233_1000081 3300025261 Bacteria 336832
50 Ga0209233_1000334 3300025261 Bacteria 48025
51 Ga0209564_1011130 3300025295 Bacteria 4064
52 Ga0209758_1010005 3300025297 Bacteria 5760
53 Ga0209758_1021299 3300025297 Bacteria 3026
54 Ga0209257_1000303 3300025304 Bacteria 107862
55 Ga0207647_10053728 3300025904 Bacteria 2481
56 Ga0207695_10000385 3300025913 Bacteria 99958
57 Ga0207695_10000458 3300025913 Bacteria 88734
58 Ga0207695_10010386 3300025913 Bacteria 11392
59 Ga0207695_10071150 3300025913 Bacteria 3553
60 Ga0207695_10127119 3300025913 Bacteria 2510
61 Ga0207695_10167842 3300025913 Bacteria 2122
62 Ga0207671_10000330 3300025914 Bacteria 69591
63 Ga0207671_10259063 3300025914 Bacteria 1368
64 Ga0207650_10003897 3300025925 Bacteria 10201
65 Ga0207658_10000750 3300025986 Bacteria 27925
66 Ga0207639_10531219 3300026041 Bacteria 1078
67 Ga0207698_10102233 3300026142 Bacteria 2379
68 Ga0209389_1000054 3300027296 Bacteria 108815
69 Ga0209389_1000242 3300027296 Bacteria 35240
70 Ga0209389_1000371 3300027296 Bacteria 26980
71 Ga0209389_1001311 3300027296 Bacteria 17364
72 Ga0209589_1000002 3300027357 Bacteria 708598
73 Ga0209589_1005194 3300027357 Bacteria 22161
74 Ga0209489_100002 3300027361 Bacteria 708609
75 Ga0209489_102751 3300027361 Bacteria 35240
76 Ga0209489_105336 3300027361 Bacteria 22405
77 Ga0209700_100002 3300027363 Bacteria 708598
78 Ga0209700_102860 3300027363 Bacteria 34208
79 Ga0268266_10001576 3300028379 Bacteria 26652
80 Ga0268266_10373160 3300028379 Bacteria 1344
81 Ga0268266_10392246 3300028379 Bacteria 1311
82 Ga0265338_10000385 3300028800 Bacteria 79013
83 Ga0307412_10018329 3300031911 Bacteria 4210
84 Ga0315911_1000006 3300033442 Bacteria 414563
85 Ga0395900_0189882 3300037418 Bacteria 2084
86 Ga0395900_0329671 3300037418 Bacteria 1505
87 Ga0395898_0031633 3300037466 Bacteria 5285
88 Ga0395898_0040300 3300037466 Bacteria 4619
89 Ga0395905_0024873 3300037471 Bacteria 5650
90 Ga0395901_0047484 3300038443 Bacteria 4458
91 Ga0395901_0467373 3300038443 Bacteria 1288
92 Ga0436361_0502315 3300039447 Bacteria 2066
93 Ga0436361_0670517 3300039447 Bacteria 6962
94 Ga0436361_0671798 3300039447 Bacteria 12492
95 Ga0466965_0032514 3300044683 Bacteria 2548
96 Ga0466960_0016699 3300044901 Bacteria 3189
97 Ga0466959_0114678 3300045049 Bacteria 1920
98 Ga0495591_022283 3300046458 Bacteria 2050
99 Ga0495638_0006823 3300046460 Bacteria 8244
100 Ga0495638_0007762 3300046460 Bacteria 7659
101 Ga0495650_0003322 3300046471 Bacteria 11854
102 Ga0495650_0014055 3300046471 Bacteria 4193
103 Ga0495605_0000014 3300046474 Bacteria 305393
104 Ga0495605_0000678 3300046474 Bacteria 25640
105 Ga0495594_0003400 3300046499 Bacteria 8215
106 Ga0495607_0005690 3300046501 Bacteria 8881
107 Ga0495607_0125042 3300046501 Bacteria 1345
108 Ga0495583_0000066 3300046506 Bacteria 191372
109 Ga0495583_0001467 3300046506 Bacteria 23652
110 Ga0495583_0001499 3300046506 Bacteria 23250
111 Ga0495606_0007281 3300046507 Bacteria 9970
112 Ga0495610_0002330 3300046512 Bacteria 16053
113 Ga0495610_0005737 3300046512 Bacteria 8745
114 Ga0495616_0015760 3300046513 Bacteria 4195
115 Ga0495620_0000048 3300046515 Bacteria 106392
116 Ga0495631_0003784 3300046518 Bacteria 8232
117 Ga0495631_0034551 3300046518 Bacteria 2266
118 Ga0495631_0048565 3300046518 Bacteria 1861
119 Ga0495632_0001675 3300046519 Bacteria 18148
120 Ga0495637_0006613 3300046520 Bacteria 5801
121 Ga0495648_0002990 3300046524 Bacteria 15166
122 Ga0495654_0002337 3300046530 Bacteria 12246
123 Ga0495609_0000006 3300046538 Bacteria 431833
124 Ga0495609_0000024 3300046538 Bacteria 264100
125 Ga0495597_0001399 3300046542 Bacteria 17432
126 Ga0495633_0000030 3300046558 Bacteria 197184
127 Ga0495668_0000024 3300046616 Bacteria 359469
128 Ga0495611_0004277 3300046648 Bacteria 6207
129 Ga0495625_0000769 3300046660 Bacteria 44640
130 Ga0495625_0097291 3300046660 Bacteria 2026
131 Ga0495661_0000015 3300046665 Bacteria 223740
132 Ga0495661_0057964 3300046665 Bacteria 2310
133 Ga0495670_0050185 3300046691 Bacteria 2088
134 Ga0495670_0183281 3300046691 Eukaryota 1106
135 Ga0495589_0000639 3300046794 Bacteria 22912
136 Ga0495660_0005859 3300046810 Bacteria 7332
137 Ga0495672_0062602 3300047320 Bacteria 2139
138 Ga0495672_0073693 3300047320 Bacteria 1925
139 Ga0495683_0000056 3300047323 Bacteria 118944
140 Ga0495679_000121 3300047446 Bacteria 68858
141 Ga0495673_0002363 3300047469 Bacteria 13392
142 Ga0495673_0044967 3300047469 Bacteria 1966
143 Ga0495681_0039157 3300047470 Bacteria 2317
144 Ga0495686_0000302 3300047472 Bacteria 84826
145 Ga0495686_0000944 3300047472 Bacteria 36054
146 Ga0495686_0002694 3300047472 Bacteria 16296
147 Ga0495686_0057678 3300047472 Bacteria 2423
148 Ga0495686_0108452 3300047472 Bacteria 1668
149 Ga0495626_0006701 3300048091 Bacteria 6524
150 Ga0496102_0016620 3300048905 Bacteria 6433
151 Ga0496103_0002355 3300048906 Bacteria 11921
152 Ga0496112_0059078 3300048915 Bacteria 3778
153 Ga0496113_0051421 3300048916 Bacteria 3075
154 Ga0496117_0001433 3300048920 Bacteria 34426
155 Ga0496117_0010989 3300048920 Bacteria 8152
156 Ga0496117_0056324 3300048920 Bacteria 2739
157 Ga0496117_0140563 3300048920 Bacteria 1447
158 Ga0496118_0001911 3300048921 Bacteria 29639
159 Ga0496118_0053606 3300048921 Bacteria 3063
160 Ga0496118_0148687 3300048921 Bacteria 1470
161 Ga0496119_0033045 3300048922 Bacteria 3438
162 Ga0496119_0120150 3300048922 Bacteria 1446
163 Ga0496120_0016939 3300048923 Bacteria 4743
164 Ga0496120_0020752 3300048923 Bacteria 4167
165 Ga0496120_0032249 3300048923 Bacteria 3161
166 Ga0496121_0000084 3300048924 Bacteria 225942
167 Ga0496121_0000515 3300048924 Bacteria 73665
168 Ga0496121_0001254 3300048924 Bacteria 43970
169 Ga0496121_0010021 3300048924 Bacteria 10766
170 Ga0496121_0010192 3300048924 Bacteria 10642
171 Ga0496121_0071576 3300048924 Bacteria 2788
172 Ga0496121_0079078 3300048924 Bacteria 2612
173 Ga0496122_0000218 3300048925 Bacteria 127770
174 Ga0496122_0004628 3300048925 Bacteria 16924
175 Ga0496122_0006817 3300048925 Bacteria 12956
176 Ga0496122_0008494 3300048925 Bacteria 11059
177 Ga0496122_0113982 3300048925 Bacteria 1764
178 Ga0496123_0000327 3300048926 Bacteria 90879
179 Ga0496123_0001734 3300048926 Bacteria 28884
180 Ga0496123_0005298 3300048926 Bacteria 13060
181 Ga0496123_0012251 3300048926 Bacteria 7331
182 Ga0496125_0000402 3300048928 Bacteria 80919
183 Ga0496125_0002054 3300048928 Bacteria 27194
184 Ga0496125_0013074 3300048928 Bacteria 8185
185 Ga0496125_0222351 3300048928 Bacteria 1215
186 Ga0496126_0011473 3300048929 Bacteria 9167
187 Ga0496126_0017407 3300048929 Bacteria 7159
188 Ga0496126_0020382 3300048929 Bacteria 6502
189 Ga0496126_0053087 3300048929 Bacteria 3679
190 Ga0496126_0149449 3300048929 Bacteria 2003
191 Ga0496126_0246467 3300048929 Bacteria 1490
192 Ga0495678_000063 3300049459 Bacteria 140183
193 Ga0501032_0023119 3300049569 Bacteria 4303
194 Ga0501033_0009147 3300049570 Bacteria 7637
195 Ga0501033_0062946 3300049570 Bacteria 2731
196 Ga0501033_0142105 3300049570 Bacteria 1735
197 Ga0501034_0006368 3300049571 Bacteria 12712
198 Ga0501034_0023832 3300049571 Bacteria 6232
199 Ga0501036_0166177 3300049572 Bacteria 1860
200 Ga0501038_0008807 3300049574 Bacteria 9257
201 Ga0501038_0132636 3300049574 Bacteria 2043
202 Ga0501038_0385798 3300049574 Bacteria 1086
203 Ga0501043_0000072 3300049579 Bacteria 89021
204 Ga0501043_0004057 3300049579 Bacteria 11972
205 Ga0501043_0074264 3300049579 Bacteria 2671
206 Ga0501043_0273108 3300049579 Bacteria 1297
207 Ga0501046_0000010 3300049580 Bacteria 331082
208 Ga0501046_0000112 3300049580 Bacteria 86313
209 Ga0501046_0140627 3300049580 Bacteria 1827
210 Ga0501047_0000138 3300049581 Bacteria 89028
211 Ga0501047_0019928 3300049581 Bacteria 6438
212 Ga0501047_0020864 3300049581 Bacteria 6293
213 Ga0501048_0001412 3300049582 Bacteria 18171
214 Ga0501067_0028270 3300049583 Bacteria 3106
215 Ga0501068_0075689 3300049584 Bacteria 2059
216 Ga0501069_0078576 3300049585 Bacteria 1856
217 Ga0501070_0188392 3300049586 Bacteria 1696
218 Ga0501073_0078617 3300049589 Bacteria 2295
219 Ga0501073_0173066 3300049589 Bacteria 1495
220 Ga0501080_0067705 3300049742 Bacteria 3321
221 Ga0501080_0153067 3300049742 Bacteria 2131
222 Ga0501083_0067215 3300049744 Bacteria 2387
223 Ga0501035_0015284 3300049822 Bacteria 7084
224 Ga0501035_0077924 3300049822 Bacteria 2929
225 Ga0501035_0081356 3300049822 Bacteria 2858
226 Ga0501044_0021616 3300049823 Bacteria 6860
227 Ga0501044_0043332 3300049823 Bacteria 4676
228 Ga0501044_0087208 3300049823 Bacteria 3153
229 Ga0501045_0008786 3300049824 Bacteria 7052
230 nmdc:mga0yw44_54413_c1 3300050492 Bacteria 2432
231 nmdc:mga0yw44_83795_c1 3300050492 Bacteria 2003
232 nmdc:mga0sz30_60091_c1 3300050516 Bacteria 1623
233 Ga0500643_024903 3300053087 Bacteria 1892
234 Ga0500566_0015515 3300053094 Bacteria 4471
235 Ga0500641_0019200 3300053096 Bacteria 2582
236 Ga0500650_0023801 3300053098 Bacteria 2724
237 Ga0500556_0000195 3300053104 Bacteria 49800
238 Ga0500556_0000348 3300053104 Bacteria 34521
239 Ga0500556_0047267 3300053104 Bacteria 1543
240 Ga0500562_016402 3300053108 Bacteria 1904
241 Ga0500562_017002 3300053108 Bacteria 1872
242 Ga0500593_111717 3300053117 Bacteria 1122
243 Ga0500595_004692 3300053119 Bacteria 6073
244 Ga0500618_000106 3300053125 Bacteria 67801
245 Ga0500618_000753 3300053125 Bacteria 18333
246 Ga0500618_002547 3300053125 Bacteria 6776
247 Ga0500618_004126 3300053125 Bacteria 4752
248 Ga0500618_007367 3300053125 Bacteria 3145
249 Ga0500642_0000012 3300053130 Bacteria 206424
250 Ga0500652_000146 3300053131 Bacteria 26947
251 Ga0500559_0000848 3300053136 Bacteria 19718
252 Ga0500559_0020453 3300053136 Bacteria 2799
253 Ga0500568_0002038 3300053139 Bacteria 12288
254 Ga0500568_0049289 3300053139 Bacteria 1663
255 Ga0500577_0084702 3300053142 Bacteria 1271
256 Ga0500604_0001026 3300053151 Bacteria 7803
257 Ga0500616_0001093 3300053153 Bacteria 28182
258 Ga0500616_0076727 3300053153 Bacteria 1689
259 Ga0500622_0001963 3300053156 Bacteria 15485
260 Ga0500622_0101482 3300053156 Bacteria 1416
261 Ga0500627_0066808 3300053158 Bacteria 1588
262 Ga0500645_014158 3300053730 Bacteria 2546
263 Ga0500645_034000 3300053730 Bacteria 1523
264 Ga0501082_0018974 3300060353 Bacteria 5926
265 2508690661 2508501042 Bacteria 8719808
266 2513652760 2513237095 Bacteria 8976980
267 2513657977 2513237096 Bacteria 8722461
268 2513671534 2513237098 Bacteria 9902361
269 2513855679 2513237137 Bacteria 9558895
270 2513919930 2513237145 Bacteria 8979722
271 2514017279 2513237161 Bacteria 8871253
272 2515627889 2515154112 Bacteria 8294334
273 2517887901 2517572143 Bacteria 9484767
274 2517892217 2517572143 Bacteria 9484767
275 2524464840 2524023210 Bacteria 9029266
276 2524534309 2524023228 Bacteria 10118060
277 2535517644 2534681796 Bacteria 7146037
278 2585278036 2582581308 Bacteria 7413247
279 2585328343 2582581315 Bacteria 7318924
280 2585536956 2585427527 Bacteria 7273426
281 2585554592 2585427530 Bacteria 7383882
282 2600377245 2600254933 Bacteria 4750527
283 2600446849 2600254954 Bacteria 5100516
284 2603857452 2602042107 Bacteria 6226103
285 2616309042 2615840626 Bacteria 7921970
286 2617382127 2617270742 Bacteria 6808054
287 2671120533 2667528175 Bacteria 7532676
288 2671123669 2667528175 Bacteria 7532676
289 2688594856 2687453392 Bacteria 6880454
290 2723879024 2721755763 Bacteria 4464185
291 2738804877 2738541293 Bacteria 7065685
292 2758639958 2758568016 Bacteria 5645291
293 2774871636 2773857925 Bacteria 6472445
294 2793068713 2791355197 Bacteria 8420563
295 2793370781 2791355267 Bacteria 7222458
296 2806058589 2802429635 Bacteria 7650140
297 2818243073 2816332527 Bacteria 8933356
298 2819643171 2818991453 Bacteria 7181617
299 2819643995 2818991453 Bacteria 7181617
300 2819714909 2818991466 Bacteria 4748179
301 2821446319 2821443989 Bacteria 7658172
302 2824606413 2824600985 Bacteria 8488197
303 2824616334 2824609381 Bacteria 8672835
304 2842484361 2842482326 Bacteria 7212537
305 2844533786 2844533157 Bacteria 7517899
306 2849078000 2849076700 Bacteria 7039503
307 2856333886 2856328259 Bacteria 6528202
308 2857526833 2857524615 Bacteria 6615449
309 2869275492 2869271264 Bacteria 6908218
310 2876400730 2876399893 Bacteria 6927900
311 2881670961 2881665667 Bacteria 8175609
312 2885381959 2885374607 Bacteria 8927485
313 2885385576 2885383462 Bacteria 9473874
314 2893069996 2893066018 Bacteria 6158120
315 2903751586 2903748898 Bacteria 9972761
316 2903773856 2903768456 Bacteria 9749579
317 2904509075 2904504865 Bacteria 5152820
318 2904694647 2904690495 Bacteria 9412302
319 2906643095 2906635258 Bacteria 8601019
320 2908742493 2908739725 Bacteria 8628932
321 2908760197 2908756301 Bacteria 8864324
322 2919077958 2919073203 Bacteria 6531949
323 2929205873 2929199973 Bacteria 7260745
324 2932837469 2932828146 Bacteria 9745859
325 2935631479 2935630451 Bacteria 8169952
326 2935653010 2935648319 Bacteria 8801166
327 2935661593 2935656913 Bacteria 8965014
328 2935674941 2935665750 Bacteria 9571747
329 2935770882 2935769743 Bacteria 7878163
330 2935782403 2935777560 Bacteria 8077691
331 2935786838 2935785616 Bacteria 7962367
332 2935794885 2935793552 Bacteria 8012592
333 2935837352 2935827899 Bacteria 10038562
334 2936016049 2936011229 Bacteria 8801034
335 2936024514 2936019824 Bacteria 8804134
336 2936036998 2936028420 Bacteria 8965941
337 2936051793 2936046547 Bacteria 8903709
338 2936063404 2936055302 Bacteria 8785755
339 2941510221 2941507105 Bacteria 8166816
340 2941518693 2941515067 Bacteria 8166720
341 2941525620 2941523033 Bacteria 8169134
342 2961140788 2961136820 Bacteria 6775228
343 2965028202 2965025482 Bacteria 6532201
344 2965106968 2965102966 Bacteria 6800987
345 2970551449 2970547951 Bacteria 6931819
346 3005480395 3005474847 Bacteria 9259049
347 3005720111 3005718088 Bacteria 8283608
348 8005549674 8005542996 Bacteria 7077758
349 8006940480 8006933436 Bacteria 10410654
350 8006980169 8006973647 Bacteria 10679141
351 8016512481 8016511872 Bacteria 9921665
352 8016604872 8016603502 Bacteria 8731218
353 8016620135 8016613128 Bacteria 8794220
354 8017067009 8017057580 Bacteria 10023680
355 8019539268 8019538911 Bacteria 7872763
356 8019559175 8019555841 Bacteria 9642137
357 8019566125 8019565922 Bacteria 9639779
358 8019620733 8019619141 Bacteria 9218857
359 8019637399 8019629233 Bacteria 8687553
360 8023681452 8023680758 Bacteria 7729763
361 8055912382 8055909800 Bacteria 7278581
362 8056688153 8056681323 Bacteria 8472857
363 8056691335 8056689827 Bacteria 6712655
364 8056974374 8056967851 Bacteria 9038162
365 8057576018 8057575449 Bacteria 7367519
366 Ga0495686_0101692
367 JGI25162J39368_1000109
368 JGI25165J46597_1000368
369 rootH2_10199025
370 rootL2_10103203
371 Ga0070658_10047406
372 Ga0070670_100005017
373 Ga0070667_100000214
374 Ga0070684_100183418
375 Ga0068853_100007092
376 Ga0068853_100029714
377 Ga0068853_100554616
378 Ga0070665_100112146
379 Ga0070665_100436765
380 Ga0068851_10016926
381 Ga0081540_1000809
382 Ga0075369_10009688
383 Ga0099825_1028570
384 Ga0099824_1017723
385 Ga0099822_1031267
386 Ga0099823_1030525
387 Ga0105251_10122871
388 Ga0105240_10000290
389 Ga0105240_10000336
390 Ga0105240_10007408
391 Ga0105240_10016389
392 Ga0105240_10035916
393 Ga0105240_10061314
394 Ga0105243_10552750
395 Ga0105237_10003793
396 Ga0105238_10142006
397 Ga0105239_10000024
398 Ga0105239_10000202
399 Ga0105239_10010502
400 Ga0157370_10003913
401 Ga0157369_10021636
402 Ga0157374_10016153
403 Ga0157372_10010786
404 Ga0157372_10644435
405 Ga0163163_10116520
406 Ga0157380_10241940
407 Ga0182007_10026536
408 Ga0182005_1001606
409 Ga0213872_10008747
410 Ga0209437_100064
411 Ga0209677_107107
412 Ga0209677_109223
413 Ga0209148_1000396
414 Ga0209233_1000081
415 Ga0209233_1000334
416 Ga0209564_1011130
417 Ga0209758_1010005
418 Ga0209758_1021299
419 Ga0209257_1000303
420 Ga0207647_10053728
421 Ga0207695_10000385
422 Ga0207695_10000458
423 Ga0207695_10010386
424 Ga0207695_10071150
425 Ga0207695_10127119
426 Ga0207695_10167842
427 Ga0207671_10000330
428 Ga0207671_10259063
429 Ga0207650_10003897
430 Ga0207658_10000750
431 Ga0207639_10531219
432 Ga0207698_10102233
433 Ga0209389_1000054
434 Ga0209389_1000242
435 Ga0209389_1000371
436 Ga0209389_1001311
437 Ga0209589_1000002
438 Ga0209589_1005194
439 Ga0209489_100002
440 Ga0209489_102751
441 Ga0209489_105336
442 Ga0209700_100002
443 Ga0209700_102860
444 Ga0268266_10001576
445 Ga0268266_10373160
446 Ga0268266_10392246
447 Ga0265338_10000385
448 Ga0307412_10018329
449 Ga0315911_1000006
450 Ga0395900_0189882
451 Ga0395900_0329671
452 Ga0395898_0031633
453 Ga0395898_0040300
454 Ga0395905_0024873
455 Ga0395901_0047484
456 Ga0395901_0467373
457 Ga0436361_0502315
458 Ga0436361_0670517
459 Ga0436361_0671798
460 Ga0466965_0032514
461 Ga0466960_0016699
462 Ga0466959_0114678
463 Ga0495591_022283
464 Ga0495638_0006823
465 Ga0495638_0007762
466 Ga0495650_0003322
467 Ga0495650_0014055
468 Ga0495605_0000014
469 Ga0495605_0000678
470 Ga0495594_0003400
471 Ga0495607_0005690
472 Ga0495607_0125042
473 Ga0495583_0000066
474 Ga0495583_0001467
475 Ga0495583_0001499
476 Ga0495606_0007281
477 Ga0495610_0002330
478 Ga0495610_0005737
479 Ga0495616_0015760
480 Ga0495620_0000048
481 Ga0495631_0003784
482 Ga0495631_0034551
483 Ga0495631_0048565
484 Ga0495632_0001675
485 Ga0495637_0006613
486 Ga0495648_0002990
487 Ga0495654_0002337
488 Ga0495609_0000006
489 Ga0495609_0000024
490 Ga0495597_0001399
491 Ga0495633_0000030
492 Ga0495668_0000024
493 Ga0495611_0004277
494 Ga0495625_0000769
495 Ga0495625_0097291
496 Ga0495661_0000015
497 Ga0495661_0057964
498 Ga0495670_0050185
499 Ga0495670_0183281
500 Ga0495589_0000639
501 Ga0495660_0005859
502 Ga0495672_0062602
503 Ga0495672_0073693
504 Ga0495683_0000056
505 Ga0495679_000121
506 Ga0495673_0002363
507 Ga0495673_0044967
508 Ga0495681_0039157
509 Ga0495686_0000302
510 Ga0495686_0000944
511 Ga0495686_0002694
512 Ga0495686_0057678
513 Ga0495686_0108452
514 Ga0495626_0006701
515 Ga0496102_0016620
516 Ga0496103_0002355
517 Ga0496112_0059078
518 Ga0496113_0051421
519 Ga0496117_0001433
520 Ga0496117_0010989
521 Ga0496117_0056324
522 Ga0496117_0140563
523 Ga0496118_0001911
524 Ga0496118_0053606
525 Ga0496118_0148687
526 Ga0496119_0033045
527 Ga0496119_0120150
528 Ga0496120_0016939
529 Ga0496120_0020752
530 Ga0496120_0032249
531 Ga0496121_0000084
532 Ga0496121_0000515
533 Ga0496121_0001254
534 Ga0496121_0010021
535 Ga0496121_0010192
536 Ga0496121_0071576
537 Ga0496121_0079078
538 Ga0496122_0000218
539 Ga0496122_0004628
540 Ga0496122_0006817
541 Ga0496122_0008494
542 Ga0496122_0113982
543 Ga0496123_0000327
544 Ga0496123_0001734
545 Ga0496123_0005298
546 Ga0496123_0012251
547 Ga0496125_0000402
548 Ga0496125_0002054
549 Ga0496125_0013074
550 Ga0496125_0222351
551 Ga0496126_0011473
552 Ga0496126_0017407
553 Ga0496126_0020382
554 Ga0496126_0053087
555 Ga0496126_0149449
556 Ga0496126_0246467
557 Ga0495678_000063
558 Ga0501032_0023119
559 Ga0501033_0009147
560 Ga0501033_0062946
561 Ga0501033_0142105
562 Ga0501034_0006368
563 Ga0501034_0023832
564 Ga0501036_0166177
565 Ga0501038_0008807
566 Ga0501038_0132636
567 Ga0501038_0385798
568 Ga0501043_0000072
569 Ga0501043_0004057
570 Ga0501043_0074264
571 Ga0501043_0273108
572 Ga0501046_0000010
573 Ga0501046_0000112
574 Ga0501046_0140627
575 Ga0501047_0000138
576 Ga0501047_0019928
577 Ga0501047_0020864
578 Ga0501048_0001412
579 Ga0501067_0028270
580 Ga0501068_0075689
581 Ga0501069_0078576
582 Ga0501070_0188392
583 Ga0501073_0078617
584 Ga0501073_0173066
585 Ga0501080_0067705
586 Ga0501080_0153067
587 Ga0501083_0067215
588 Ga0501035_0015284
589 Ga0501035_0077924
590 Ga0501035_0081356
591 Ga0501044_0021616
592 Ga0501044_0043332
593 Ga0501044_0087208
594 Ga0501045_0008786
595 nmdc:mga0yw44_54413_c1
596 nmdc:mga0yw44_83795_c1
597 nmdc:mga0sz30_60091_c1
598 Ga0500643_024903
599 Ga0500566_0015515
600 Ga0500641_0019200
601 Ga0500650_0023801
602 Ga0500556_0000195
603 Ga0500556_0000348
604 Ga0500556_0047267
605 Ga0500562_016402
606 Ga0500562_017002
607 Ga0500593_111717
608 Ga0500595_004692
609 Ga0500618_000106
610 Ga0500618_000753
611 Ga0500618_002547
612 Ga0500618_004126
613 Ga0500618_007367
614 Ga0500642_0000012
615 Ga0500652_000146
616 Ga0500559_0000848
617 Ga0500559_0020453
618 Ga0500568_0002038
619 Ga0500568_0049289
620 Ga0500577_0084702
621 Ga0500604_0001026
622 Ga0500616_0001093
623 Ga0500616_0076727
624 Ga0500622_0001963
625 Ga0500622_0101482
626 Ga0500627_0066808
627 Ga0500645_014158
628 Ga0500645_034000
629 Ga0501082_0018974
630 2508690661
631 2513652760
632 2513657977
633 2513671534
634 2513855679
635 2513919930
636 2514017279
637 2515627889
638 2517887901
639 2517892217
640 2524464840
641 2524534309
642 2535517644
643 2585278036
644 2585328343
645 2585536956
646 2585554592
647 2600377245
648 2600446849
649 2603857452
650 2616309042
651 2617382127
652 2671120533
653 2671123669
654 2688594856
655 2723879024
656 2738804877
657 2758639958
658 2774871636
659 2793068713
660 2793370781
661 2806058589
662 2818243073
663 2819643171
664 2819643995
665 2819714909
666 2821446319
667 2824606413
668 2824616334
669 2842484361
670 2844533786
671 2849078000
672 2856333886
673 2857526833
674 2869275492
675 2876400730
676 2881670961
677 2885381959
678 2885385576
679 2893069996
680 2903751586
681 2903773856
682 2904509075
683 2904694647
684 2906643095
685 2908742493
686 2908760197
687 2919077958
688 2929205873
689 2932837469
690 2935631479
691 2935653010
692 2935661593
693 2935674941
694 2935770882
695 2935782403
696 2935786838
697 2935794885
698 2935837352
699 2936016049
700 2936024514
701 2936036998
702 2936051793
703 2936063404
704 2941510221
705 2941518693
706 2941525620
707 2961140788
708 2965028202
709 2965106968
710 2970551449
711 3005480395
712 3005720111
713 8005549674
714 8006940480
715 8006980169
716 8016512481
717 8016604872
718 8016620135
719 8017067009
720 8019539268
721 8019559175
722 8019566125
723 8019620733
724 8019637399
725 8023681452
726 8055912382
727 8056688153
728 8056691335
729 8056974374
730 8057576018

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12833

HTH_18

Helix-turn-helix domain

294

373

0.98

PF01965

DJ-1_PfpI

DJ-1/PfpI family

60

233

0.93

PF00165

HTH_AraC

Bacterial regulatory helix-turn-helix proteins, AraC family

291

322

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3w6v-assembly1.cif.gz_A crystal structure of the dna-binding domain of adpa, the global transcriptional factor, in complex with a target dna 0.9401 212 316
3lsg-assembly1.cif.gz_A the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.9344 218 312
6swi-assembly1.cif.gz_A the c-terminal domain of arat, a response regulator from geobacillus stearothermophilus 0.9186 217 314
3lsg-assembly2.cif.gz_D the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.9173 218 304
3lsg-assembly3.cif.gz_E the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.9094 218 307
ID Description Score Start End Superfamily
af_P77379_178_282_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9579 215 318 1.10.10.60
af_P32677_219_275_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9563 266 315 1.10.10.60
3lsgA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9417 268 312 1.10.10.60
af_P77379_178_282_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9405 215 318 1.10.10.60
3w6vA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9401 212 316 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A6L8Z911-F1-model_v4 deleted 0.9654 214 313
AF-F1TEY5-F1-model_v4 Transcriptional regulator, AraC family 0.9606 214 314 GO:0003700
GO:0043565
AF-A0A2W4NK05-F1-model_v4 deleted 0.9585 214 318
AF-A0A5Q4T4C4-F1-model_v4 AraC family transcriptional regulator 0.9562 214 313 GO:0003700
GO:0043565
AF-A0A7Y2MPR1-F1-model_v4 Helix-turn-helix domain-containing protein 0.9562 214 315 GO:0003700
GO:0016020
GO:0043565

Map