F424155

General Info

Members Datasets Scaffolds Average Seq Length
366 198 366 338

Family's Representative Sequence

Representative Sequence 3300049585|Ga0501069_0045689|Ga0501069_0045689_64_1092
Length 342
Sequence MGTNDTLGRPLRNLRVSVTDRCNLRCAYCMPEPEYAWLPRADILRFEEIGRLVEVFTRLGVDRVRLTGGEPLVRQNLPELVRILAGNPEVRDLAMTTNGVLLAEAARSLRDAGLHRLTVSLDTLRPERFRLLTRTDAHARVLAGLDAAAAAGFARGSLKIDTVVLRDCNDDELADLLEAGKRWGAEVRFIEYMDVGGATLWTRQSVVSRREILDRLAERFGPATPVAEHTSAPAERFRLPDGTVFGVIASTTAPFCRSCDRSRLTADGLWYLCLYAARGMDLRGPLRAGESDEGLAERIASVWRARADRGAEERLELANRSALLPTAELKRDPHLEMHTRGG

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
111 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
118 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
119 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
120 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
121 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
122 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
123 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
124 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
127 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
128 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
129 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
132 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
135 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
136 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
145 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
161 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
162 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
163 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
164 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
165 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
166 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
167 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
168 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
169 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
170 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
171 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
177 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
178 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
179 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
180 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
181 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
188 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
189 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
190 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
191 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
192 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
193 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
194 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
195 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
196 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
197 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
198 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.37
Nodule 0
Rhizoplane 2.46
Rhizosphere 93.17
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10023196 3300005293 Bacteria 2245
2 Ga0065715_10113207 3300005293 Bacteria 2499
3 Ga0065715_10191091 3300005293 Bacteria 1414
4 Ga0070676_10122417 3300005328 Bacteria 1635
5 Ga0070690_100004159 3300005330 Bacteria 8003
6 Ga0070690_100317510 3300005330 Bacteria 1121
7 Ga0070670_100001541 3300005331 Bacteria 18578
8 Ga0068869_100005696 3300005334 Bacteria 7860
9 Ga0068869_100025746 3300005334 Bacteria 4088
10 Ga0070666_10010806 3300005335 Bacteria 5716
11 Ga0070689_100051246 3300005340 Bacteria 3190
12 Ga0070691_10139136 3300005341 Bacteria 1235
13 Ga0070687_100019202 3300005343 Bacteria 3175
14 Ga0070661_100047046 3300005344 Bacteria 3157
15 Ga0070668_100157060 3300005347 Bacteria 1843
16 Ga0070669_100002231 3300005353 Bacteria 14027
17 Ga0070669_100029722 3300005353 Bacteria 3941
18 Ga0070669_100094584 3300005353 Bacteria 2246
19 Ga0070675_100203404 3300005354 Bacteria 1719
20 Ga0070675_100373439 3300005354 Bacteria 1268
21 Ga0070671_100116704 3300005355 Bacteria 2244
22 Ga0070674_100306657 3300005356 Bacteria 1268
23 Ga0070673_100093324 3300005364 Bacteria 2464
24 Ga0070673_100115384 3300005364 Bacteria 2233
25 Ga0070659_100208807 3300005366 Bacteria 1609
26 Ga0070659_100253861 3300005366 Bacteria 1458
27 Ga0070667_100004446 3300005367 Bacteria 11819
28 Ga0070713_100003248 3300005436 Bacteria 10721
29 Ga0070705_100082352 3300005440 Bacteria 1980
30 Ga0070708_100442226 3300005445 Bacteria 1226
31 Ga0070681_10092612 3300005458 Bacteria 2971
32 Ga0068867_100011266 3300005459 Bacteria 6306
33 Ga0068867_100029623 3300005459 Bacteria 3944
34 Ga0070706_100024539 3300005467 Bacteria 5551
35 Ga0070698_100171561 3300005471 Bacteria 2110
36 Ga0070698_100273044 3300005471 Bacteria 1622
37 Ga0070697_100115606 3300005536 Bacteria 2240
38 Ga0070672_100001243 3300005543 Bacteria 15668
39 Ga0070686_100011087 3300005544 Bacteria 5105
40 Ga0070693_100005803 3300005547 Bacteria 5962
41 Ga0070693_100013176 3300005547 Bacteria 4205
42 Ga0070693_100130747 3300005547 Bacteria 1569
43 Ga0070665_100036157 3300005548 Bacteria 4969
44 Ga0070704_100081147 3300005549 Bacteria 2388
45 Ga0070664_100007934 3300005564 Bacteria 8576
46 Ga0068857_100009817 3300005577 Bacteria 8315
47 Ga0068854_100036100 3300005578 Bacteria 3463
48 Ga0068856_100027141 3300005614 Bacteria 5586
49 Ga0070702_100034202 3300005615 Bacteria 2800
50 Ga0070702_100060080 3300005615 Bacteria 2209
51 Ga0068852_100393866 3300005616 Bacteria 1361
52 Ga0068859_100004828 3300005617 Bacteria 13723
53 Ga0068859_100358839 3300005617 Bacteria 1552
54 Ga0068859_100511311 3300005617 Bacteria 1296
55 Ga0068866_10027461 3300005718 Bacteria 2700
56 Ga0068863_100061867 3300005841 Bacteria 3540
57 Ga0068863_100182933 3300005841 Bacteria 2012
58 Ga0068858_100001090 3300005842 Bacteria 28100
59 Ga0068858_100163057 3300005842 Bacteria 2099
60 Ga0068860_100005884 3300005843 Bacteria 12341
61 Ga0068860_100077786 3300005843 Bacteria 3155
62 Ga0068862_100097994 3300005844 Bacteria 2560
63 Ga0068862_100291004 3300005844 Bacteria 1500
64 Ga0075365_10139254 3300006038 Bacteria 1684
65 Ga0075368_10039586 3300006042 Bacteria 1848
66 Ga0075364_10115103 3300006051 Bacteria 1797
67 Ga0075362_10039086 3300006177 Bacteria 2085
68 Ga0075367_10003333 3300006178 Bacteria 7629
69 Ga0075367_10018496 3300006178 Bacteria 3846
70 Ga0075367_10076531 3300006178 Bacteria 2019
71 Ga0075366_10005182 3300006195 Bacteria 7055
72 Ga0075366_10009657 3300006195 Bacteria 5393
73 Ga0097621_100108956 3300006237 Bacteria 2339
74 Ga0068871_100082876 3300006358 Bacteria 2660
75 Ga0075428_100008656 3300006844 Bacteria 11287
76 Ga0075428_100014673 3300006844 Bacteria 8702
77 Ga0075428_100017905 3300006844 Bacteria 7830
78 Ga0075428_100027501 3300006844 Bacteria 6292
79 Ga0075428_100066629 3300006844 Unclassified 3942
80 Ga0075428_100106962 3300006844 Bacteria 3049
81 Ga0075428_100209581 3300006844 Bacteria 2106
82 Ga0075430_100000529 3300006846 Bacteria 28699
83 Ga0075430_100030948 3300006846 Bacteria 4544
84 Ga0075430_100120138 3300006846 Bacteria 2190
85 Ga0075431_100002968 3300006847 Bacteria 16412
86 Ga0075431_100032531 3300006847 Bacteria 5374
87 Ga0075431_100069468 3300006847 Bacteria 3634
88 Ga0075431_100109464 3300006847 Bacteria 2852
89 Ga0075431_100148107 3300006847 Bacteria 2418
90 Ga0075433_10027780 3300006852 Bacteria 4803
91 Ga0075433_10039655 3300006852 Bacteria 4073
92 Ga0075433_10086617 3300006852 Bacteria 2766
93 Ga0075433_10275357 3300006852 Bacteria 1492
94 Ga0075434_100006207 3300006871 Bacteria 10948
95 Ga0075434_100029333 3300006871 Bacteria 5411
96 Ga0075434_100075183 3300006871 Bacteria 3371
97 Ga0075429_100038507 3300006880 Bacteria 4162
98 Ga0075429_100291750 3300006880 Bacteria 1428
99 Ga0075429_100344864 3300006880 Unclassified 1304
100 Ga0075436_100003964 3300006914 Bacteria 10149
101 Ga0097620_100004828 3300006931 Bacteria 13723
102 Ga0097620_100358836 3300006931 Bacteria 1552
103 Ga0097620_100511274 3300006931 Bacteria 1296
104 Ga0075435_100013064 3300007076 Bacteria 6167
105 Ga0075435_100042825 3300007076 Bacteria 3623
106 Ga0105240_10165030 3300009093 Bacteria 2627
107 Ga0111539_10000544 3300009094 Bacteria 48062
108 Ga0111539_10004387 3300009094 Bacteria 18455
109 Ga0111539_10014410 3300009094 Bacteria 9868
110 Ga0111539_10026494 3300009094 Bacteria 7087
111 Ga0111539_10090160 3300009094 Bacteria 3603
112 Ga0111539_10253978 3300009094 Bacteria 2047
113 Ga0111539_10284668 3300009094 Bacteria 1924
114 Ga0105245_10229105 3300009098 Bacteria 1796
115 Ga0105245_10446747 3300009098 Bacteria 1300
116 Ga0114129_10000118 3300009147 Bacteria 79809
117 Ga0114129_10002709 3300009147 Bacteria 24665
118 Ga0114129_10002818 3300009147 Bacteria 24260
119 Ga0114129_10003807 3300009147 Bacteria 21263
120 Ga0114129_10015165 3300009147 Bacteria 10968
121 Ga0114129_10015684 3300009147 Bacteria 10774
122 Ga0114129_10058965 3300009147 Bacteria 5368
123 Ga0114129_10072381 3300009147 Bacteria 4805
124 Ga0114129_10554283 3300009147 Bacteria 1494
125 Ga0114129_10591054 3300009147 Bacteria 1439
126 Ga0105242_10175285 3300009176 Bacteria 1887
127 Ga0105242_10199006 3300009176 Bacteria 1778
128 Ga0105248_10001501 3300009177 Bacteria 25949
129 Ga0105248_10065390 3300009177 Bacteria 4084
130 Ga0105248_10247028 3300009177 Bacteria 2009
131 Ga0105249_10001034 3300009553 Bacteria 24616
132 Ga0157378_10151440 3300013297 Bacteria 2162
133 Ga0157375_10002194 3300013308 Bacteria 16873
134 Ga0163163_10000137 3300014325 Bacteria 75320
135 Ga0157380_10299807 3300014326 Bacteria 1480
136 Ga0157380_10672919 3300014326 Bacteria 1036
137 Ga0157379_10004960 3300014968 Bacteria 11416
138 Ga0207688_10010648 3300025901 Bacteria 5002
139 Ga0207680_10008000 3300025903 Bacteria 5176
140 Ga0207645_10011010 3300025907 Bacteria 6189
141 Ga0207657_10032834 3300025919 Bacteria 4684
142 Ga0207646_10083970 3300025922 Bacteria 2849
143 Ga0207681_10018924 3300025923 Bacteria 4343
144 Ga0207650_10003621 3300025925 Bacteria 10588
145 Ga0207659_10155081 3300025926 Bacteria 1792
146 Ga0207700_10004156 3300025928 Bacteria 8498
147 Ga0207690_10147454 3300025932 Unclassified 1741
148 Ga0207690_10208860 3300025932 Bacteria 1487
149 Ga0207706_10054149 3300025933 Bacteria 3541
150 Ga0207686_10098079 3300025934 Bacteria 1950
151 Ga0207670_10040650 3300025936 Bacteria 3053
152 Ga0207670_10113537 3300025936 Bacteria 1957
153 Ga0207670_10131057 3300025936 Bacteria 1837
154 Ga0207669_10083483 3300025937 Bacteria 2055
155 Ga0207691_10001363 3300025940 Bacteria 24367
156 Ga0207711_10011741 3300025941 Bacteria 7277
157 Ga0207711_10114435 3300025941 Bacteria 2402
158 Ga0207689_10011554 3300025942 Bacteria 7563
159 Ga0207689_10012720 3300025942 Bacteria 7190
160 Ga0207661_10019536 3300025944 Bacteria 5054
161 Ga0207661_10269229 3300025944 Bacteria 1520
162 Ga0207679_10022998 3300025945 Bacteria 4254
163 Ga0207679_10090952 3300025945 Bacteria 2360
164 Ga0207679_10342367 3300025945 Bacteria 1301
165 Ga0207667_10182576 3300025949 Bacteria 2154
166 Ga0207651_10006308 3300025960 Bacteria 6189
167 Ga0207651_10090614 3300025960 Bacteria 2236
168 Ga0207712_10091976 3300025961 Bacteria 2235
169 Ga0207658_10032259 3300025986 Bacteria 3726
170 Ga0207703_10054232 3300026035 Bacteria 3259
171 Ga0207678_10218522 3300026067 Bacteria 1631
172 Ga0207678_10292341 3300026067 Bacteria 1399
173 Ga0207708_10007093 3300026075 Bacteria 8279
174 Ga0207708_10300486 3300026075 Bacteria 1305
175 Ga0207702_10022841 3300026078 Bacteria 5189
176 Ga0207641_10044682 3300026088 Bacteria 3726
177 Ga0207641_10152040 3300026088 Bacteria 2097
178 Ga0207648_10017239 3300026089 Bacteria 6580
179 Ga0207648_10020608 3300026089 Bacteria 5935
180 Ga0207674_10015360 3300026116 Bacteria 8414
181 Ga0207675_100057208 3300026118 Bacteria 3638
182 Ga0207698_10519479 3300026142 Bacteria 1162
183 Ga0207428_10001847 3300027907 Bacteria 21649
184 Ga0207428_10005495 3300027907 Bacteria 11813
185 Ga0207428_10023807 3300027907 Bacteria 5144
186 Ga0207428_10037868 3300027907 Bacteria 3923
187 Ga0207428_10093927 3300027907 Bacteria 2326
188 Ga0268266_10022012 3300028379 Bacteria 5434
189 Ga0268265_10050346 3300028380 Bacteria 3138
190 Ga0268264_10019966 3300028381 Bacteria 5475
191 Ga0307408_100029833 3300031548 Bacteria 3782
192 Ga0307408_100070463 3300031548 Bacteria 2581
193 Ga0307413_10223287 3300031824 Bacteria 1378
194 Ga0307410_10228382 3300031852 Bacteria 1436
195 Ga0307406_10019093 3300031901 Bacteria 4019
196 Ga0307409_100079539 3300031995 Bacteria 2642
197 Ga0307409_100398256 3300031995 Bacteria 1314
198 Ga0307416_100005088 3300032002 Bacteria 8023
199 Ga0307416_100045454 3300032002 Bacteria 3458
200 Ga0307416_100074278 3300032002 Bacteria 2839
201 Ga0307416_100178280 3300032002 Bacteria 1988
202 Ga0307416_100444985 3300032002 Bacteria 1347
203 Ga0307411_10090923 3300032005 Bacteria 2130
204 Ga0307411_10161706 3300032005 Bacteria 1678
205 Ga0307411_10234182 3300032005 Bacteria 1433
206 Ga0307415_100067803 3300032126 Bacteria 2495
207 Ga0373934_0002818 3300035086 Bacteria 6369
208 Ga0373953_0075887 3300035117 Bacteria 1392
209 Ga0373954_0044501 3300035118 Bacteria 2072
210 Ga0373956_0043871 3300035119 Bacteria 1991
211 Ga0373955_0003836 3300035172 Bacteria 6627
212 Ga0373931_0077344 3300035691 Bacteria 1829
213 Ga0373933_0079496 3300035724 Bacteria 2008
214 Ga0373947_0105744 3300035725 Bacteria 1773
215 Ga0373947_0316889 3300035725 Bacteria 1042
216 Ga0373937_0000436 3300036401 Bacteria 38637
217 Ga0373937_0008092 3300036401 Bacteria 9127
218 Ga0373937_0356795 3300036401 Bacteria 1385
219 Ga0373925_0015503 3300037068 Bacteria 5511
220 Ga0439446_0085990 3300042156 Bacteria 979
221 Ga0453683_0046439 3300044673 Bacteria 2723
222 Ga0453684_0053588 3300044712 Bacteria 5264
223 Ga0451576_0026932 3300045051 Bacteria 6177
224 Ga0495653_0019805 3300046463 Bacteria 5455
225 Ga0495662_0020210 3300046476 Bacteria 3221
226 Ga0495630_0176220 3300046517 Bacteria 1630
227 Ga0495598_0085812 3300046537 Bacteria 1018
228 Ga0495613_0108270 3300046689 Bacteria 2004
229 Ga0495680_0084111 3300047322 Bacteria 2398
230 Ga0496102_0004395 3300048905 Bacteria 11909
231 Ga0496106_0008786 3300048909 Bacteria 7466
232 Ga0496106_0009554 3300048909 Bacteria 7163
233 Ga0496107_0000755 3300048910 Bacteria 18603
234 Ga0496108_0153754 3300048911 Bacteria 1986
235 Ga0496110_0014619 3300048913 Bacteria 6522
236 Ga0496111_0051702 3300048914 Bacteria 2966
237 Ga0496112_0097992 3300048915 Bacteria 2902
238 Ga0496115_0333992 3300048918 Bacteria 1238
239 Ga0501031_0245633 3300049568 Bacteria 1163
240 Ga0501032_0020238 3300049569 Bacteria 4638
241 Ga0501032_0185568 3300049569 Bacteria 1360
242 Ga0501033_0008877 3300049570 Bacteria 7765
243 Ga0501033_0019803 3300049570 Bacteria 5085
244 Ga0501033_0160810 3300049570 Bacteria 1617
245 Ga0501033_0243429 3300049570 Bacteria 1276
246 Ga0501034_0204088 3300049571 Bacteria 1933
247 Ga0501036_0004095 3300049572 Bacteria 11734
248 Ga0501036_0076560 3300049572 Bacteria 2830
249 Ga0501037_0132160 3300049573 Bacteria 1789
250 Ga0501037_0158023 3300049573 Bacteria 1617
251 Ga0501038_0043653 3300049574 Bacteria 3897
252 Ga0501038_0054036 3300049574 Bacteria 3454
253 Ga0501039_0013579 3300049575 Bacteria 6229
254 Ga0501040_0003736 3300049576 Bacteria 9870
255 Ga0501040_0033723 3300049576 Bacteria 3470
256 Ga0501041_0005673 3300049577 Bacteria 7296
257 Ga0501042_0052637 3300049578 Bacteria 2904
258 Ga0501043_0067447 3300049579 Bacteria 2809
259 Ga0501046_0014029 3300049580 Bacteria 6767
260 Ga0501046_0046256 3300049580 Bacteria 3455
261 Ga0501046_0048679 3300049580 Bacteria 3355
262 Ga0501047_0313249 3300049581 Bacteria 1409
263 Ga0501048_0013554 3300049582 Bacteria 6048
264 Ga0501048_0021493 3300049582 Bacteria 4725
265 Ga0501048_0032641 3300049582 Bacteria 3762
266 Ga0501048_0057869 3300049582 Bacteria 2748
267 Ga0501067_0041611 3300049583 Bacteria 2551
268 Ga0501068_0015964 3300049584 Bacteria 4325
269 Ga0501068_0048498 3300049584 Bacteria 2564
270 Ga0501069_0015928 3300049585 Bacteria 4031
271 Ga0501069_0045689 3300049585 Bacteria 2427
272 Ga0501070_0006376 3300049586 Bacteria 10042
273 Ga0501070_0071943 3300049586 Bacteria 2862
274 Ga0501070_0274274 3300049586 Bacteria 1377
275 Ga0501071_0008097 3300049587 Bacteria 6930
276 Ga0501071_0091475 3300049587 Bacteria 2235
277 Ga0501071_0272067 3300049587 Bacteria 1281
278 Ga0501072_0007286 3300049588 Bacteria 8387
279 Ga0501072_0026391 3300049588 Bacteria 4530
280 Ga0501073_0033154 3300049589 Bacteria 3679
281 Ga0501074_0000463 3300049590 Bacteria 24468
282 Ga0501074_0024133 3300049590 Bacteria 4419
283 Ga0501074_0065194 3300049590 Bacteria 2622
284 Ga0501075_0073384 3300049591 Bacteria 2588
285 Ga0501075_0114008 3300049591 Bacteria 2055
286 Ga0501075_0290034 3300049591 Bacteria 1247
287 Ga0501076_0035099 3300049592 Bacteria 3923
288 Ga0501076_0044834 3300049592 Bacteria 3489
289 Ga0501077_0098132 3300049593 Bacteria 1857
290 Ga0501079_0007650 3300049741 Bacteria 8184
291 Ga0501079_0047289 3300049741 Bacteria 3319
292 Ga0501079_0226227 3300049741 Bacteria 1461
293 Ga0501079_0481337 3300049741 Unclassified 975
294 Ga0501080_0013631 3300049742 Bacteria 7484
295 Ga0501080_0304028 3300049742 Bacteria 1446
296 Ga0501083_0005317 3300049744 Bacteria 9104
297 Ga0501083_0030156 3300049744 Bacteria 3727
298 Ga0501035_0129748 3300049822 Bacteria 2198
299 Ga0501044_0005392 3300049823 Bacteria 14202
300 Ga0501045_0027381 3300049824 Bacteria 4107
301 Ga0501045_0139814 3300049824 Bacteria 1800
302 nmdc:mga03683_2084_c1 3300050489 Bacteria 6142
303 nmdc:mga00v17_166440_c1 3300050491 Bacteria 1420
304 nmdc:mga00v17_18045_c1 3300050491 Bacteria 4005
305 nmdc:mga00v17_20075_c1 3300050491 Bacteria 3824
306 nmdc:mga0yw44_4106_c1 3300050492 Bacteria 6603
307 nmdc:mga0k408_13670_c1 3300050493 Bacteria 4456
308 nmdc:mga06z11_9489_c1 3300050494 Bacteria 4102
309 nmdc:mga05p37_1065_c1 3300050507 Bacteria 31391
310 nmdc:mga05p37_111176_c1 3300050507 Bacteria 3370
311 nmdc:mga05p37_12192_c1 3300050507 Bacteria 10263
312 nmdc:mga05p37_1280_c1 3300050507 Bacteria 29233
313 nmdc:mga05p37_182481_c1 3300050507 Bacteria 2552
314 nmdc:mga05p37_30587_c1 3300050507 Bacteria 6570
315 nmdc:mga05p37_30_c1 3300050507 Bacteria 114300
316 nmdc:mga05p37_33870_c1 3300050507 Bacteria 6257
317 nmdc:mga05p37_8617_c1 3300050507 Bacteria 12055
318 nmdc:mga09592_190643_c1 3300050508 Bacteria 1774
319 nmdc:mga09592_32889_c1 3300050508 Bacteria 4325
320 nmdc:mga0qj67_183904_c1 3300050509 Bacteria 1698
321 nmdc:mga0qj67_243326_c1 3300050509 Bacteria 1459
322 nmdc:mga0qj67_32212_c1 3300050509 Bacteria 4087
323 nmdc:mga0qj67_41988_c1 3300050509 Bacteria 3599
324 nmdc:mga0qj67_5853_c1 3300050509 Bacteria 9001
325 nmdc:mga06r32_114922_c1 3300050510 Bacteria 2650
326 nmdc:mga06r32_188851_c1 3300050510 Bacteria 2048
327 nmdc:mga06r32_230796_c1 3300050510 Bacteria 1839
328 nmdc:mga06r32_439234_c1 3300050510 Bacteria 1285
329 nmdc:mga06r32_70642_c1 3300050510 Unclassified 3377
330 nmdc:mga06r32_89029_c1 3300050510 Bacteria 3013
331 nmdc:mga06r32_93491_c1 3300050510 Bacteria 2941
332 nmdc:mga06r32_99128_c1 3300050510 Bacteria 2857
333 nmdc:mga08y16_2181_c1 3300050511 Bacteria 20079
334 nmdc:mga08y16_332918_c1 3300050511 Bacteria 1562
335 nmdc:mga08y16_364539_c1 3300050511 Bacteria 1483
336 nmdc:mga08y16_4232_c1 3300050511 Bacteria 14976
337 nmdc:mga08y16_5039_c1 3300050511 Bacteria 13809
338 nmdc:mga08y16_61412_c1 3300050511 Bacteria 3924
339 nmdc:mga08y16_962_c1 3300050511 Bacteria 28000
340 nmdc:mga0n895_31751_c1 3300050512 Bacteria 5060
341 nmdc:mga0n895_377358_c1 3300050512 Bacteria 1435
342 nmdc:mga0n895_393_c1 3300050512 Bacteria 29329
343 nmdc:mga0n895_7501_c1 3300050512 Bacteria 9367
344 nmdc:mga0rr50_18036_c1 3300050513 Bacteria 4732
345 nmdc:mga0rr50_90361_c1 3300050513 Bacteria 2383
346 nmdc:mga0a205_109907_c1 3300050515 Bacteria 2655
347 nmdc:mga0a205_27409_c1 3300050515 Bacteria 5441
348 nmdc:mga0a205_4326_c1 3300050515 Bacteria 12733
349 nmdc:mga0a205_49291_c1 3300050515 Bacteria 4065
350 nmdc:mga0a205_53463_c1 3300050515 Bacteria 3898
351 Ga0495601_0051115 3300053077 Bacteria 2609
352 Ga0495619_0142870 3300053085 Bacteria 1649
353 Ga0501084_0018855 3300054114 Bacteria 5744
354 Ga0501084_0034573 3300054114 Bacteria 4226
355 Ga0501084_0064507 3300054114 Bacteria 3065
356 Ga0501084_0161925 3300054114 Bacteria 1888
357 Ga0501084_0278934 3300054114 Bacteria 1411
358 Ga0501084_0542030 3300054114 Bacteria 983
359 Ga0590071_001017 3300059421 Bacteria 7633
360 Ga0590074_004314 3300059423 Bacteria 2351
361 Ga0590075_000043 3300059424 Bacteria 33018
362 Ga0590077_000073 3300059426 Bacteria 25304
363 Ga0501082_0009279 3300060353 Bacteria 8478
364 Ga0501082_0140183 3300060353 Bacteria 2099
365 Ga0501082_0151342 3300060353 Bacteria 2015
366 Ga0530510_0009096 3300061734 Bacteria 6962

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025923 Ga0207681_10018924 Ga0207681_100189242 305
2 3300005330 Ga0070690_100004159 Ga0070690_1000041593 310
3 3300005335 Ga0070666_10010806 Ga0070666_100108065 310
4 3300005364 Ga0070673_100115384 Ga0070673_1001153843 310
5 3300005367 Ga0070667_100004446 Ga0070667_1000044466 310
6 3300005440 Ga0070705_100082352 Ga0070705_1000823522 310
7 3300005459 Ga0068867_100029623 Ga0068867_1000296234 310
8 3300005543 Ga0070672_100001243 Ga0070672_1000012434 310
9 3300005547 Ga0070693_100013176 Ga0070693_1000131763 310
10 3300005548 Ga0070665_100036157 Ga0070665_1000361574 310
11 3300005549 Ga0070704_100081147 Ga0070704_1000811473 310
12 3300005614 Ga0068856_100027141 Ga0068856_1000271414 310
13 3300005615 Ga0070702_100060080 Ga0070702_1000600803 310
14 3300005617 Ga0068859_100004828 Ga0068859_1000048287 310
15 3300005841 Ga0068863_100061867 Ga0068863_1000618673 310
16 3300005842 Ga0068858_100001090 Ga0068858_10000109024 310
17 3300005843 Ga0068860_100005884 Ga0068860_1000058849 310
18 3300006237 Ga0097621_100108956 Ga0097621_1001089562 310
19 3300006358 Ga0068871_100082876 Ga0068871_1000828763 310
20 3300006931 Ga0097620_100004828 Ga0097620_1000048287 310
21 3300009177 Ga0105248_10001501 Ga0105248_100015016 310
22 3300013308 Ga0157375_10002194 Ga0157375_100021944 310
23 3300014968 Ga0157379_10004960 Ga0157379_100049606 310
24 3300025903 Ga0207680_10008000 Ga0207680_100080002 310
25 3300025940 Ga0207691_10001363 Ga0207691_1000136321 310
26 3300025941 Ga0207711_10011741 Ga0207711_100117418 310
27 3300025945 Ga0207679_10022998 Ga0207679_100229985 310
28 3300025960 Ga0207651_10090614 Ga0207651_100906142 310
29 3300025986 Ga0207658_10032259 Ga0207658_100322592 310
30 3300026035 Ga0207703_10054232 Ga0207703_100542324 310
31 3300026078 Ga0207702_10022841 Ga0207702_100228414 310
32 3300026088 Ga0207641_10044682 Ga0207641_100446823 310
33 3300026089 Ga0207648_10017239 Ga0207648_100172394 310
34 3300028379 Ga0268266_10022012 Ga0268266_100220124 310
35 3300028381 Ga0268264_10019966 Ga0268264_100199662 310
36 3300032126 Ga0307415_100067803 Ga0307415_1000678032 310
37 3300048905 Ga0496102_0004395 Ga0496102_0004395_8212_9243 310
38 3300048909 Ga0496106_0008786 Ga0496106_0008786_3288_4319 310
39 3300048910 Ga0496107_0000755 Ga0496107_0000755_6899_7930 310
40 3300048913 Ga0496110_0014619 Ga0496110_0014619_2928_3959 310
41 3300048914 Ga0496111_0051702 Ga0496111_0051702_1212_2243 310
42 3300048918 Ga0496115_0333992 Ga0496115_0333992_266_1210 310
43 3300049568 Ga0501031_0245633 Ga0501031_0245633_35_970 310
44 3300049569 Ga0501032_0020238 Ga0501032_0020238_1578_2615 310
45 3300049569 Ga0501032_0185568 Ga0501032_0185568_263_1291 310
46 3300049570 Ga0501033_0008877 Ga0501033_0008877_6416_7444 310
47 3300049570 Ga0501033_0019803 Ga0501033_0019803_1150_2187 310
48 3300049571 Ga0501034_0204088 Ga0501034_0204088_419_1447 310
49 3300049572 Ga0501036_0004095 Ga0501036_0004095_5154_6182 310
50 3300049573 Ga0501037_0132160 Ga0501037_0132160_473_1501 310
51 3300049574 Ga0501038_0043653 Ga0501038_0043653_26_1054 310
52 3300049574 Ga0501038_0054036 Ga0501038_0054036_1053_2090 310
53 3300049575 Ga0501039_0013579 Ga0501039_0013579_2848_3885 310
54 3300049579 Ga0501043_0067447 Ga0501043_0067447_1144_2172 310
55 3300049580 Ga0501046_0014029 Ga0501046_0014029_3810_4847 310
56 3300049580 Ga0501046_0048679 Ga0501046_0048679_485_1513 310
57 3300049581 Ga0501047_0313249 Ga0501047_0313249_355_1383 310
58 3300049582 Ga0501048_0032641 Ga0501048_0032641_535_1572 310
59 3300049582 Ga0501048_0057869 Ga0501048_0057869_268_1296 310
60 3300049583 Ga0501067_0041611 Ga0501067_0041611_1321_2349 310
61 3300049584 Ga0501068_0015964 Ga0501068_0015964_3269_4306 310
62 3300049584 Ga0501068_0048498 Ga0501068_0048498_68_1096 310
63 3300049585 Ga0501069_0015928 Ga0501069_0015928_2976_4004 310
64 3300049586 Ga0501070_0006376 Ga0501070_0006376_5973_7001 310
65 3300049586 Ga0501070_0071943 Ga0501070_0071943_748_1785 310
66 3300049587 Ga0501071_0091475 Ga0501071_0091475_783_1820 310
67 3300049590 Ga0501074_0000463 Ga0501074_0000463_236_1264 310
68 3300049592 Ga0501076_0035099 Ga0501076_0035099_142_1179 310
69 3300049741 Ga0501079_0007650 Ga0501079_0007650_275_1303 310
70 3300049741 Ga0501079_0226227 Ga0501079_0226227_57_992 310
71 3300049742 Ga0501080_0013631 Ga0501080_0013631_4033_5070 310
72 3300049744 Ga0501083_0005317 Ga0501083_0005317_190_1218 310
73 3300049744 Ga0501083_0030156 Ga0501083_0030156_833_1870 310
74 3300049822 Ga0501035_0129748 Ga0501035_0129748_340_1368 310
75 3300049823 Ga0501044_0005392 Ga0501044_0005392_5023_6051 310
76 3300049824 Ga0501045_0139814 Ga0501045_0139814_40_1077 310
77 3300054114 Ga0501084_0018855 Ga0501084_0018855_4659_5687 310
78 3300054114 Ga0501084_0542030 Ga0501084_0542030_31_966 310
79 3300060353 Ga0501082_0009279 Ga0501082_0009279_5015_6043 310
80 3300060353 Ga0501082_0151342 Ga0501082_0151342_67_1104 310
81 3300005293 Ga0065715_10023196 Ga0065715_100231964 311
82 3300005293 Ga0065715_10113207 Ga0065715_101132073 311
83 3300005293 Ga0065715_10191091 Ga0065715_101910912 311
84 3300005328 Ga0070676_10122417 Ga0070676_101224172 311
85 3300005330 Ga0070690_100317510 Ga0070690_1003175101 311
86 3300005331 Ga0070670_100001541 Ga0070670_1000015416 311
87 3300005334 Ga0068869_100005696 Ga0068869_1000056965 311
88 3300005334 Ga0068869_100025746 Ga0068869_1000257462 311
89 3300005340 Ga0070689_100051246 Ga0070689_1000512461 311
90 3300005341 Ga0070691_10139136 Ga0070691_101391361 311
91 3300005343 Ga0070687_100019202 Ga0070687_1000192022 311
92 3300005344 Ga0070661_100047046 Ga0070661_1000470461 311
93 3300005347 Ga0070668_100157060 Ga0070668_1001570602 311
94 3300005353 Ga0070669_100002231 Ga0070669_1000022315 311
95 3300005353 Ga0070669_100029722 Ga0070669_1000297221 311
96 3300005353 Ga0070669_100094584 Ga0070669_1000945842 311
97 3300005354 Ga0070675_100203404 Ga0070675_1002034042 311
98 3300005354 Ga0070675_100373439 Ga0070675_1003734391 311
99 3300005355 Ga0070671_100116704 Ga0070671_1001167042 311
100 3300005356 Ga0070674_100306657 Ga0070674_1003066571 311
101 3300005364 Ga0070673_100093324 Ga0070673_1000933242 311
102 3300005366 Ga0070659_100208807 Ga0070659_1002088072 311
103 3300005366 Ga0070659_100253861 Ga0070659_1002538611 311
104 3300005436 Ga0070713_100003248 Ga0070713_1000032486 311
105 3300005445 Ga0070708_100442226 Ga0070708_1004422262 311
106 3300005458 Ga0070681_10092612 Ga0070681_100926121 311
107 3300005459 Ga0068867_100011266 Ga0068867_1000112662 311
108 3300005467 Ga0070706_100024539 Ga0070706_1000245395 311
109 3300005471 Ga0070698_100171561 Ga0070698_1001715613 311
110 3300005471 Ga0070698_100273044 Ga0070698_1002730442 311
111 3300005536 Ga0070697_100115606 Ga0070697_1001156063 311
112 3300005544 Ga0070686_100011087 Ga0070686_1000110872 311
113 3300005547 Ga0070693_100005803 Ga0070693_1000058032 311
114 3300005547 Ga0070693_100130747 Ga0070693_1001307471 311
115 3300005564 Ga0070664_100007934 Ga0070664_1000079346 311
116 3300005577 Ga0068857_100009817 Ga0068857_1000098175 311
117 3300005578 Ga0068854_100036100 Ga0068854_1000361001 311
118 3300005615 Ga0070702_100034202 Ga0070702_1000342022 311
119 3300005616 Ga0068852_100393866 Ga0068852_1003938661 311
120 3300005617 Ga0068859_100358839 Ga0068859_1003588392 311
121 3300005617 Ga0068859_100511311 Ga0068859_1005113112 311
122 3300005718 Ga0068866_10027461 Ga0068866_100274611 311
123 3300005841 Ga0068863_100182933 Ga0068863_1001829332 311
124 3300005842 Ga0068858_100163057 Ga0068858_1001630572 311
125 3300005843 Ga0068860_100077786 Ga0068860_1000777862 311
126 3300005844 Ga0068862_100097994 Ga0068862_1000979942 311
127 3300005844 Ga0068862_100291004 Ga0068862_1002910042 311
128 3300006038 Ga0075365_10139254 Ga0075365_101392542 311
129 3300006042 Ga0075368_10039586 Ga0075368_100395862 311
130 3300006051 Ga0075364_10115103 Ga0075364_101151032 311
131 3300006177 Ga0075362_10039086 Ga0075362_100390862 311
132 3300006178 Ga0075367_10003333 Ga0075367_100033336 311
133 3300006178 Ga0075367_10018496 Ga0075367_100184962 311
134 3300006178 Ga0075367_10076531 Ga0075367_100765312 311
135 3300006195 Ga0075366_10005182 Ga0075366_100051824 311
136 3300006195 Ga0075366_10009657 Ga0075366_100096574 311
137 3300006844 Ga0075428_100008656 Ga0075428_1000086564 311
138 3300006844 Ga0075428_100014673 Ga0075428_1000146732 311
139 3300006844 Ga0075428_100017905 Ga0075428_1000179054 311
140 3300006844 Ga0075428_100027501 Ga0075428_1000275012 311
141 3300006844 Ga0075428_100066629 Ga0075428_1000666291 311
142 3300006844 Ga0075428_100106962 Ga0075428_1001069621 311
143 3300006844 Ga0075428_100209581 Ga0075428_1002095812 311
144 3300006846 Ga0075430_100000529 Ga0075430_10000052922 311
145 3300006846 Ga0075430_100030948 Ga0075430_1000309484 311
146 3300006846 Ga0075430_100120138 Ga0075430_1001201383 311
147 3300006847 Ga0075431_100002968 Ga0075431_10000296811 311
148 3300006847 Ga0075431_100032531 Ga0075431_1000325313 311
149 3300006847 Ga0075431_100069468 Ga0075431_1000694683 311
150 3300006847 Ga0075431_100109464 Ga0075431_1001094642 311
151 3300006847 Ga0075431_100148107 Ga0075431_1001481072 311
152 3300006852 Ga0075433_10027780 Ga0075433_100277802 311
153 3300006852 Ga0075433_10039655 Ga0075433_100396552 311
154 3300006852 Ga0075433_10086617 Ga0075433_100866172 311
155 3300006852 Ga0075433_10275357 Ga0075433_102753571 311
156 3300006871 Ga0075434_100006207 Ga0075434_1000062076 311
157 3300006871 Ga0075434_100029333 Ga0075434_1000293332 311
158 3300006871 Ga0075434_100075183 Ga0075434_1000751832 311
159 3300006880 Ga0075429_100038507 Ga0075429_1000385072 311
160 3300006880 Ga0075429_100291750 Ga0075429_1002917502 311
161 3300006880 Ga0075429_100344864 Ga0075429_1003448641 311
162 3300006914 Ga0075436_100003964 Ga0075436_1000039645 311
163 3300006931 Ga0097620_100358836 Ga0097620_1003588361 311
164 3300006931 Ga0097620_100511274 Ga0097620_1005112742 311
165 3300007076 Ga0075435_100013064 Ga0075435_1000130643 311
166 3300007076 Ga0075435_100042825 Ga0075435_1000428252 311
167 3300009093 Ga0105240_10165030 Ga0105240_101650302 311
168 3300009094 Ga0111539_10000544 Ga0111539_1000054410 311
169 3300009094 Ga0111539_10004387 Ga0111539_100043875 311
170 3300009094 Ga0111539_10014410 Ga0111539_100144108 311
171 3300009094 Ga0111539_10026494 Ga0111539_100264942 311
172 3300009094 Ga0111539_10090160 Ga0111539_100901602 311
173 3300009094 Ga0111539_10253978 Ga0111539_102539782 311
174 3300009094 Ga0111539_10284668 Ga0111539_102846681 311
175 3300009098 Ga0105245_10229105 Ga0105245_102291052 311
176 3300009098 Ga0105245_10446747 Ga0105245_104467472 311
177 3300009147 Ga0114129_10000118 Ga0114129_1000011820 311
178 3300009147 Ga0114129_10002709 Ga0114129_1000270922 311
179 3300009147 Ga0114129_10002818 Ga0114129_1000281819 311
180 3300009147 Ga0114129_10003807 Ga0114129_1000380717 311
181 3300009147 Ga0114129_10015165 Ga0114129_100151654 311
182 3300009147 Ga0114129_10015684 Ga0114129_100156841 311
183 3300009147 Ga0114129_10058965 Ga0114129_100589653 311
184 3300009147 Ga0114129_10072381 Ga0114129_100723812 311
185 3300009147 Ga0114129_10554283 Ga0114129_105542831 311
186 3300009147 Ga0114129_10591054 Ga0114129_105910542 311
187 3300009176 Ga0105242_10175285 Ga0105242_101752852 311
188 3300009176 Ga0105242_10199006 Ga0105242_101990062 311
189 3300009177 Ga0105248_10065390 Ga0105248_100653904 311
190 3300009177 Ga0105248_10247028 Ga0105248_102470282 311
191 3300009553 Ga0105249_10001034 Ga0105249_100010341 311
192 3300013297 Ga0157378_10151440 Ga0157378_101514403 311
193 3300014325 Ga0163163_10000137 Ga0163163_1000013754 311
194 3300014326 Ga0157380_10299807 Ga0157380_102998071 311
195 3300014326 Ga0157380_10672919 Ga0157380_106729192 311
196 3300025901 Ga0207688_10010648 Ga0207688_100106483 311
197 3300025907 Ga0207645_10011010 Ga0207645_100110102 311
198 3300025919 Ga0207657_10032834 Ga0207657_100328341 311
199 3300025922 Ga0207646_10083970 Ga0207646_100839703 311
200 3300025925 Ga0207650_10003621 Ga0207650_100036215 311
201 3300025926 Ga0207659_10155081 Ga0207659_101550812 311
202 3300025928 Ga0207700_10004156 Ga0207700_100041564 311
203 3300025932 Ga0207690_10147454 Ga0207690_101474542 311
204 3300025932 Ga0207690_10208860 Ga0207690_102088602 311
205 3300025933 Ga0207706_10054149 Ga0207706_100541491 311
206 3300025934 Ga0207686_10098079 Ga0207686_100980792 311
207 3300025936 Ga0207670_10040650 Ga0207670_100406501 311
208 3300025936 Ga0207670_10113537 Ga0207670_101135372 311
209 3300025936 Ga0207670_10131057 Ga0207670_101310572 311
210 3300025937 Ga0207669_10083483 Ga0207669_100834832 311
211 3300025941 Ga0207711_10114435 Ga0207711_101144353 311
212 3300025942 Ga0207689_10011554 Ga0207689_100115542 311
213 3300025942 Ga0207689_10012720 Ga0207689_100127203 311
214 3300025944 Ga0207661_10019536 Ga0207661_100195365 311
215 3300025944 Ga0207661_10269229 Ga0207661_102692292 311
216 3300025945 Ga0207679_10090952 Ga0207679_100909522 311
217 3300025945 Ga0207679_10342367 Ga0207679_103423671 311
218 3300025949 Ga0207667_10182576 Ga0207667_101825764 311
219 3300025960 Ga0207651_10006308 Ga0207651_100063083 311
220 3300025961 Ga0207712_10091976 Ga0207712_100919762 311
221 3300026067 Ga0207678_10218522 Ga0207678_102185222 311
222 3300026067 Ga0207678_10292341 Ga0207678_102923411 311
223 3300026075 Ga0207708_10007093 Ga0207708_100070935 311
224 3300026075 Ga0207708_10300486 Ga0207708_103004861 311
225 3300026088 Ga0207641_10152040 Ga0207641_101520402 311
226 3300026089 Ga0207648_10020608 Ga0207648_100206083 311
227 3300026116 Ga0207674_10015360 Ga0207674_100153604 311
228 3300026118 Ga0207675_100057208 Ga0207675_1000572082 311
229 3300026142 Ga0207698_10519479 Ga0207698_105194791 311
230 3300027907 Ga0207428_10001847 Ga0207428_100018474 311
231 3300027907 Ga0207428_10005495 Ga0207428_1000549510 311
232 3300027907 Ga0207428_10023807 Ga0207428_100238074 311
233 3300027907 Ga0207428_10037868 Ga0207428_100378684 311
234 3300027907 Ga0207428_10093927 Ga0207428_100939273 311
235 3300028380 Ga0268265_10050346 Ga0268265_100503462 311
236 3300031548 Ga0307408_100029833 Ga0307408_1000298332 311
237 3300031548 Ga0307408_100070463 Ga0307408_1000704632 311
238 3300031824 Ga0307413_10223287 Ga0307413_102232872 311
239 3300031852 Ga0307410_10228382 Ga0307410_102283822 311
240 3300031901 Ga0307406_10019093 Ga0307406_100190933 311
241 3300031995 Ga0307409_100079539 Ga0307409_1000795391 311
242 3300031995 Ga0307409_100398256 Ga0307409_1003982561 311
243 3300032002 Ga0307416_100005088 Ga0307416_1000050887 311
244 3300032002 Ga0307416_100045454 Ga0307416_1000454542 311
245 3300032002 Ga0307416_100074278 Ga0307416_1000742782 311
246 3300032002 Ga0307416_100178280 Ga0307416_1001782802 311
247 3300032002 Ga0307416_100444985 Ga0307416_1004449852 311
248 3300032005 Ga0307411_10090923 Ga0307411_100909232 311
249 3300032005 Ga0307411_10161706 Ga0307411_101617061 311
250 3300032005 Ga0307411_10234182 Ga0307411_102341821 311
251 3300035086 Ga0373934_0002818 Ga0373934_0002818_5163_6194 311
252 3300035117 Ga0373953_0075887 Ga0373953_0075887_319_1350 311
253 3300035118 Ga0373954_0044501 Ga0373954_0044501_28_963 311
254 3300035119 Ga0373956_0043871 Ga0373956_0043871_95_1126 311
255 3300035172 Ga0373955_0003836 Ga0373955_0003836_3949_4980 311
256 3300035691 Ga0373931_0077344 Ga0373931_0077344_423_1442 311
257 3300035724 Ga0373933_0079496 Ga0373933_0079496_279_1214 311
258 3300035725 Ga0373947_0105744 Ga0373947_0105744_294_1313 311
259 3300035725 Ga0373947_0316889 Ga0373947_0316889_74_1009 311
260 3300036401 Ga0373937_0000436 Ga0373937_0000436_15907_16842 311
261 3300036401 Ga0373937_0008092 Ga0373937_0008092_2369_3400 311
262 3300036401 Ga0373937_0356795 Ga0373937_0356795_310_1245 311
263 3300037068 Ga0373925_0015503 Ga0373925_0015503_3427_4446 311
264 3300042156 Ga0439446_0085990 Ga0439446_0085990_12_947 311
265 3300044673 Ga0453683_0046439 Ga0453683_0046439_1188_2210 311
266 3300044712 Ga0453684_0053588 Ga0453684_0053588_3204_4223 311
267 3300045051 Ga0451576_0026932 Ga0451576_0026932_3092_4027 311
268 3300046463 Ga0495653_0019805 Ga0495653_0019805_3160_4095 311
269 3300046476 Ga0495662_0020210 Ga0495662_0020210_2215_3192 311
270 3300046517 Ga0495630_0176220 Ga0495630_0176220_551_1573 311
271 3300046537 Ga0495598_0085812 Ga0495598_0085812_31_966 311
272 3300046689 Ga0495613_0108270 Ga0495613_0108270_81_1103 311
273 3300047322 Ga0495680_0084111 Ga0495680_0084111_1101_2132 311
274 3300048909 Ga0496106_0009554 Ga0496106_0009554_269_1291 311
275 3300048911 Ga0496108_0153754 Ga0496108_0153754_379_1401 311
276 3300048915 Ga0496112_0097992 Ga0496112_0097992_906_1928 311
277 3300049570 Ga0501033_0160810 Ga0501033_0160810_304_1323 311
278 3300049570 Ga0501033_0243429 Ga0501033_0243429_218_1153 311
279 3300049572 Ga0501036_0076560 Ga0501036_0076560_1513_2535 311
280 3300049573 Ga0501037_0158023 Ga0501037_0158023_249_1268 311
281 3300049576 Ga0501040_0003736 Ga0501040_0003736_5893_6912 311
282 3300049576 Ga0501040_0033723 Ga0501040_0033723_2209_3231 311
283 3300049577 Ga0501041_0005673 Ga0501041_0005673_3609_4628 311
284 3300049578 Ga0501042_0052637 Ga0501042_0052637_787_1806 311
285 3300049580 Ga0501046_0046256 Ga0501046_0046256_137_1159 311
286 3300049582 Ga0501048_0013554 Ga0501048_0013554_2844_3863 311
287 3300049582 Ga0501048_0021493 Ga0501048_0021493_3067_4002 311
288 3300049585 Ga0501069_0045689 Ga0501069_0045689_64_1092 311
289 3300049586 Ga0501070_0274274 Ga0501070_0274274_83_1018 311
290 3300049587 Ga0501071_0008097 Ga0501071_0008097_562_1581 311
291 3300049587 Ga0501071_0272067 Ga0501071_0272067_238_1260 311
292 3300049588 Ga0501072_0007286 Ga0501072_0007286_3984_4919 311
293 3300049588 Ga0501072_0026391 Ga0501072_0026391_1554_2573 311
294 3300049589 Ga0501073_0033154 Ga0501073_0033154_2645_3667 311
295 3300049590 Ga0501074_0024133 Ga0501074_0024133_711_1646 311
296 3300049590 Ga0501074_0065194 Ga0501074_0065194_1052_2071 311
297 3300049591 Ga0501075_0073384 Ga0501075_0073384_1274_2296 311
298 3300049591 Ga0501075_0114008 Ga0501075_0114008_780_1802 311
299 3300049591 Ga0501075_0290034 Ga0501075_0290034_42_977 311
300 3300049592 Ga0501076_0044834 Ga0501076_0044834_1160_2095 311
301 3300049593 Ga0501077_0098132 Ga0501077_0098132_259_1278 311
302 3300049741 Ga0501079_0047289 Ga0501079_0047289_893_1912 311
303 3300049741 Ga0501079_0481337 Ga0501079_0481337_16_951 311
304 3300049742 Ga0501080_0304028 Ga0501080_0304028_255_1190 311
305 3300049824 Ga0501045_0027381 Ga0501045_0027381_145_1164 311
306 3300050489 nmdc:mga03683_2084_c1 nmdc:mga03683_2084_c1_59_1087 311
307 3300050491 nmdc:mga00v17_166440_c1 nmdc:mga00v17_166440_c1_188_1207 311
308 3300050491 nmdc:mga00v17_18045_c1 nmdc:mga00v17_18045_c1_2873_3901 311
309 3300050491 nmdc:mga00v17_20075_c1 nmdc:mga00v17_20075_c1_2573_3601 311
310 3300050492 nmdc:mga0yw44_4106_c1 nmdc:mga0yw44_4106_c1_719_1738 311
311 3300050493 nmdc:mga0k408_13670_c1 nmdc:mga0k408_13670_c1_3375_4403 311
312 3300050494 nmdc:mga06z11_9489_c1 nmdc:mga06z11_9489_c1_86_1120 311
313 3300050507 nmdc:mga05p37_1065_c1 nmdc:mga05p37_1065_c1_14285_15322 311
314 3300050507 nmdc:mga05p37_111176_c1 nmdc:mga05p37_111176_c1_535_1563 311
315 3300050507 nmdc:mga05p37_12192_c1 nmdc:mga05p37_12192_c1_6718_7746 311
316 3300050507 nmdc:mga05p37_1280_c1 nmdc:mga05p37_1280_c1_5529_6551 311
317 3300050507 nmdc:mga05p37_182481_c1 nmdc:mga05p37_182481_c1_1318_2340 311
318 3300050507 nmdc:mga05p37_30587_c1 nmdc:mga05p37_30587_c1_3580_4602 311
319 3300050507 nmdc:mga05p37_30_c1 nmdc:mga05p37_30_c1_32125_33147 311
320 3300050507 nmdc:mga05p37_33870_c1 nmdc:mga05p37_33870_c1_1762_2784 311
321 3300050507 nmdc:mga05p37_8617_c1 nmdc:mga05p37_8617_c1_1326_2348 311
322 3300050508 nmdc:mga09592_190643_c1 nmdc:mga09592_190643_c1_131_1159 311
323 3300050508 nmdc:mga09592_32889_c1 nmdc:mga09592_32889_c1_2634_3662 311
324 3300050509 nmdc:mga0qj67_183904_c1 nmdc:mga0qj67_183904_c1_267_1289 311
325 3300050509 nmdc:mga0qj67_243326_c1 nmdc:mga0qj67_243326_c1_415_1437 311
326 3300050509 nmdc:mga0qj67_32212_c1 nmdc:mga0qj67_32212_c1_1811_2839 311
327 3300050509 nmdc:mga0qj67_41988_c1 nmdc:mga0qj67_41988_c1_932_1954 311
328 3300050509 nmdc:mga0qj67_5853_c1 nmdc:mga0qj67_5853_c1_6463_7491 311
329 3300050510 nmdc:mga06r32_114922_c1 nmdc:mga06r32_114922_c1_842_1870 311
330 3300050510 nmdc:mga06r32_188851_c1 nmdc:mga06r32_188851_c1_321_1343 311
331 3300050510 nmdc:mga06r32_230796_c1 nmdc:mga06r32_230796_c1_427_1449 311
332 3300050510 nmdc:mga06r32_439234_c1 nmdc:mga06r32_439234_c1_22_1059 311
333 3300050510 nmdc:mga06r32_70642_c1 nmdc:mga06r32_70642_c1_1660_2787 311
334 3300050510 nmdc:mga06r32_89029_c1 nmdc:mga06r32_89029_c1_206_1228 311
335 3300050510 nmdc:mga06r32_93491_c1 nmdc:mga06r32_93491_c1_684_1706 311
336 3300050510 nmdc:mga06r32_99128_c1 nmdc:mga06r32_99128_c1_1173_2195 311
337 3300050511 nmdc:mga08y16_2181_c1 nmdc:mga08y16_2181_c1_7706_8728 311
338 3300050511 nmdc:mga08y16_332918_c1 nmdc:mga08y16_332918_c1_424_1431 311
339 3300050511 nmdc:mga08y16_364539_c1 nmdc:mga08y16_364539_c1_37_1065 311
340 3300050511 nmdc:mga08y16_4232_c1 nmdc:mga08y16_4232_c1_1121_2143 311
341 3300050511 nmdc:mga08y16_5039_c1 nmdc:mga08y16_5039_c1_10618_11640 311
342 3300050511 nmdc:mga08y16_61412_c1 nmdc:mga08y16_61412_c1_1201_2220 311
343 3300050511 nmdc:mga08y16_962_c1 nmdc:mga08y16_962_c1_15555_16583 311
344 3300050512 nmdc:mga0n895_31751_c1 nmdc:mga0n895_31751_c1_3492_4619 311
345 3300050512 nmdc:mga0n895_377358_c1 nmdc:mga0n895_377358_c1_335_1357 311
346 3300050512 nmdc:mga0n895_393_c1 nmdc:mga0n895_393_c1_24659_25696 311
347 3300050512 nmdc:mga0n895_7501_c1 nmdc:mga0n895_7501_c1_5342_6364 311
348 3300050513 nmdc:mga0rr50_18036_c1 nmdc:mga0rr50_18036_c1_916_1953 311
349 3300050513 nmdc:mga0rr50_90361_c1 nmdc:mga0rr50_90361_c1_312_1439 311
350 3300050515 nmdc:mga0a205_109907_c1 nmdc:mga0a205_109907_c1_1232_2254 311
351 3300050515 nmdc:mga0a205_27409_c1 nmdc:mga0a205_27409_c1_1932_3059 311
352 3300050515 nmdc:mga0a205_4326_c1 nmdc:mga0a205_4326_c1_1872_2909 311
353 3300050515 nmdc:mga0a205_49291_c1 nmdc:mga0a205_49291_c1_1569_2597 311
354 3300050515 nmdc:mga0a205_53463_c1 nmdc:mga0a205_53463_c1_336_1358 311
355 3300053077 Ga0495601_0051115 Ga0495601_0051115_758_1693 311
356 3300053085 Ga0495619_0142870 Ga0495619_0142870_114_1049 311
357 3300054114 Ga0501084_0034573 Ga0501084_0034573_2626_3645 311
358 3300054114 Ga0501084_0064507 Ga0501084_0064507_266_1201 311
359 3300054114 Ga0501084_0161925 Ga0501084_0161925_846_1868 311
360 3300054114 Ga0501084_0278934 Ga0501084_0278934_124_1146 311
361 3300059421 Ga0590071_001017 Ga0590071_001017_6257_7285 311
362 3300059423 Ga0590074_004314 Ga0590074_004314_775_1803 311
363 3300059424 Ga0590075_000043 Ga0590075_000043_31752_32780 311
364 3300059426 Ga0590077_000073 Ga0590077_000073_16032_17060 311
365 3300060353 Ga0501082_0140183 Ga0501082_0140183_23_1045 311
366 3300061734 Ga0530510_0009096 Ga0530510_0009096_2380_3399 311

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

16

179

0.98

PF06463

Mob_synth_C

Molybdenum Cofactor Synthesis C

185

312

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tv8-assembly1.cif.gz_A structure of moaa in complex with s-adenosylmethionine 0.9156 5 284
2fb2-assembly1.cif.gz_B structure of the moaa arg17/266/268/ala triple mutant 0.9092 5 284
7tom-assembly1.cif.gz_A x-ray crystal structure of glycerol dibiphytanyl glycerol tetraether - macrocyclic archaeol synthase (gdgt-mas) from methanocaldococcus jannaschii with bacterial lipid substrate analog, 5'deoxyadenosine, and methionine bound 0.8581 15 195
3ciw-assembly1.cif.gz_A x-ray structure of the [fefe]-hydrogenase maturase hyde from thermotoga maritima 0.8376 15 162
7o26-assembly1.cif.gz_A complex-b bound [fefe]-hydrogenase maturase hyde fromt. maritima (5'da + methionine) 0.8302 15 162
ID Description Score Start End Superfamily
af_P9WJS3_16_359_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9524 1 311 3.20.20.70
af_P9WJS3_16_359_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9495 1 311 3.20.20.70
1tv8A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9156 5 284 3.20.20.70
af_P9WJS1_27_360_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8917 1 311 3.20.20.70
af_I1KTQ5_72_400_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8784 3 311 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A833E0F9-F1-model_v4 GTP 3',8-cyclase MoaA 0.9653 15 158 GO:0006777
GO:0046872
GO:0051539
GO:0061798
GO:0061799
AF-A0A7V3XHQ7-F1-model_v4 GTP 3',8-cyclase (EC 4.1.99.22) (Molybdenum cofactor biosynthesis protein A) 0.9635 1 311 GO:0005525
GO:0006777
GO:0046872
GO:0051539
GO:0061798
GO:0061799
GO:1904047
AF-A0A2A5DHD3-F1-model_v4 GTP 3',8-cyclase (EC 4.1.99.22) (Molybdenum cofactor biosynthesis protein A) 0.9618 1 311 GO:0005525
GO:0006777
GO:0046872
GO:0051539
GO:0061798
GO:0061799
GO:1904047
AF-A0A7V3XHQ7-F1-model_v4 GTP 3',8-cyclase (EC 4.1.99.22) (Molybdenum cofactor biosynthesis protein A) 0.9605 1 311 GO:0005525
GO:0006777
GO:0046872
GO:0051539
GO:0061798
GO:0061799
GO:1904047
AF-A0A2A5DHD3-F1-model_v4 GTP 3',8-cyclase (EC 4.1.99.22) (Molybdenum cofactor biosynthesis protein A) 0.9588 1 311 GO:0005525
GO:0006777
GO:0046872
GO:0051539
GO:0061798
GO:0061799
GO:1904047

Feature Viewer

pLDDT pTM Quality
85.17 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map