F424168

General Info

Members Datasets Scaffolds Average Seq Length
366 292 732 213

Family's Representative Sequence

Representative Sequence 3300053094|Ga0500566_0071336|Ga0500566_0071336_809_1543
Length 244
Sequence VLANFAVYSASCEVIKLTASFTLSSRQGNFMNIALIGATGFIGTPVLSELLSRGHKVTVLARNPGKLTPQPGLTVVAADALDATQVAKAAAGHDAVISAYNPGWGEPKIHDLHLQASKAIVDGVKQSGVKRLLVVGGAGSLFVAPGLQLVDTPQFPAEYKQAALAAREALNQIKLETSLDWSFVSPPIGLAPGERTGKYRVGADELLPGQGDKPAGISVADLAVAIVDEIENARHVRRRFTVAN

Samples

Sample ID Description Type Environment
1 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
42 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
45 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
46 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
47 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
48 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
49 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
50 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
53 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
56 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
58 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
61 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
73 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
74 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
75 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
76 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
77 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
78 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
79 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
80 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
83 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
84 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
85 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
86 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
90 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
91 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
92 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
93 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
94 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
95 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
96 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
97 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
98 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
99 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
100 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
101 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
102 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
103 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
104 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
105 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
106 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
107 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
108 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
109 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
110 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
111 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
112 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
113 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
114 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
115 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
116 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
117 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
120 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
121 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
122 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
123 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
124 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
125 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
126 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
127 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
128 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
129 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
130 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
131 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
132 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
133 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
134 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
135 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
136 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
137 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
138 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
139 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
140 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
141 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
142 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
143 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
144 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
145 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
146 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
147 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
148 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
149 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
150 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
151 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
152 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
153 2643221557 Ensifer sp. Root558 Isolate Unclassified
154 2643221591 Devosia sp. Root685 Isolate Unclassified
155 2643221610 Ensifer sp. Root74 Isolate Unclassified
156 2643221618 Ensifer sp. Root231 Isolate Unclassified
157 2643221626 Ensifer sp. Root31 Isolate Unclassified
158 2643221655 Ensifer sp. Root1252 Isolate Unclassified
159 2643221659 Ensifer sp. Root127 Isolate Unclassified
160 2643221668 Ensifer sp. Root423 Isolate Unclassified
161 2643221675 Ensifer sp. Root1298 Isolate Unclassified
162 2643221680 Ensifer sp. Root1312 Isolate Unclassified
163 2643221698 Ensifer sp. Root142 Isolate Unclassified
164 2643221712 Ensifer sp. Root258 Isolate Unclassified
165 2643221723 Ensifer sp. Root278 Isolate Unclassified
166 2643221726 Ensifer sp. Root954 Isolate Unclassified
167 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
168 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
169 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
170 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
171 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
172 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
173 2844163670 Ensifer sp. 1H6 Isolate Unclassified
174 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
175 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
176 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
177 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
178 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
179 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
180 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
181 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
182 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
183 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
184 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
185 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
186 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
187 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
188 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
189 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
190 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
191 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
192 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
193 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
194 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
195 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
196 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
197 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
198 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
199 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
200 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
201 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
202 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
203 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
204 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
205 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
206 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
207 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
208 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
209 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
210 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
211 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
212 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
213 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
214 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
215 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
216 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
217 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
218 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
219 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
220 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
221 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
222 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
223 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
224 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
225 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
226 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
227 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
228 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
229 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
230 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
231 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
232 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
233 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
234 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
235 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
236 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
237 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
238 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
239 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
240 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
241 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
242 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
243 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
244 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
245 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
246 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
247 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
248 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
249 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
250 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
251 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
252 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
253 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
254 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
255 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
256 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
257 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
258 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
259 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
260 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
261 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
262 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
263 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
264 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
265 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
266 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
267 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
268 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
269 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
270 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
271 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
272 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
273 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
274 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
275 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
276 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
277 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
278 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
279 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
280 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
281 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
282 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
283 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
284 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
285 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
286 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
287 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
288 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
289 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
290 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
291 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
292 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 56.83
Metatranscriptomes 0.27
Isolates 42.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.5
Nodule 37.16
Rhizoplane 0.27
Rhizosphere 21.86
Stem 0
Stem Tuber 0
Unclassified 0.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500566_0071336 3300053094 Bacteria 1949
2 JGI24739J22299_10115417 3300001989 Bacteria 804
3 JGI24735J21928_10069428 3300002067 Bacteria 1010
4 JGI25155J39150_1000323 3300002704 Bacteria 16055
5 JGI25154J39366_1000657 3300002738 Bacteria 16151
6 JGI25157J39369_1000791 3300002741 Bacteria 16148
7 JGI25150J39212_1016184 3300002774 Bacteria 1227
8 JGI25159J45721_1000407 3300002987 Bacteria 19965
9 JGI25159J45721_1016390 3300002987 Bacteria 1581
10 JGI25151J46595_10010088 3300003187 Bacteria 4420
11 JGI25151J46595_10014781 3300003187 Bacteria 3465
12 JGI25151J46595_10015740 3300003187 Bacteria 3322
13 JGI25151J46595_10045880 3300003187 Bacteria 1537
14 JGI25153J46596_10053264 3300003215 Bacteria 1146
15 rootH2_10004521 3300003320 Bacteria 39563
16 rootH2_10028784 3300003320 Bacteria 31504
17 rootH2_10139151 3300003320 Bacteria 4608
18 rootH2_10194633 3300003320 Bacteria 1946
19 rootL2_10193618 3300003322 Unclassified 1112
20 rootH1_10114170 3300003323 Bacteria 1938
21 JGI25160J50197_1000172 3300003354 Bacteria 55781
22 JGI25161J50226_1000007 3300003374 Bacteria 256181
23 Ga0055526_1009546 3300003771 Bacteria 4649
24 Ga0055526_1018589 3300003771 Bacteria 2585
25 Ga0055537_1000356 3300003773 Bacteria 31055
26 Ga0055537_1022752 3300003773 Bacteria 909
27 Ga0055524_1000213 3300003775 Bacteria 61225
28 Ga0055524_1000859 3300003775 Bacteria 19898
29 Ga0055536_1001320 3300003781 Bacteria 15197
30 Ga0055536_1003918 3300003781 Bacteria 7806
31 Ga0055536_1005157 3300003781 Bacteria 6459
32 Ga0055536_1035843 3300003781 Bacteria 1235
33 Ga0055534_1015169 3300003784 Bacteria 1419
34 Ga0055528_1002730 3300003790 Bacteria 9255
35 Ga0055530_10001299 3300003791 Bacteria 18844
36 Ga0055540_1000504 3300003792 Bacteria 29761
37 Ga0055540_1000731 3300003792 Bacteria 22379
38 Ga0055531_10003518 3300003794 Bacteria 9960
39 Ga0055531_10004306 3300003794 Bacteria 8724
40 Ga0055531_10015747 3300003794 Bacteria 3308
41 Ga0055531_10025776 3300003794 Bacteria 2122
42 Ga0055543_1005400 3300004625 Bacteria 3269
43 Ga0065165_1001170 3300005262 Bacteria 30482
44 Ga0065165_1053854 3300005262 Bacteria 1130
45 Ga0070681_10013633 3300005458 Bacteria 8088
46 Ga0070698_101227962 3300005471 Bacteria 699
47 Ga0070679_100007570 3300005530 Bacteria 10158
48 Ga0068853_100005264 3300005539 Bacteria 10126
49 Ga0068853_100019944 3300005539 Bacteria 5568
50 Ga0068853_100598577 3300005539 Bacteria 1047
51 Ga0068855_100057666 3300005563 Bacteria 4551
52 Ga0068855_100544373 3300005563 Bacteria 1257
53 Ga0068856_100079821 3300005614 Bacteria 3245
54 Ga0068866_10373673 3300005718 Bacteria 912
55 Ga0075432_10002756 3300006058 Bacteria 5883
56 Ga0075362_10131882 3300006177 Bacteria 1189
57 Ga0105240_10161808 3300009093 Bacteria 2658
58 Ga0105241_10212673 3300009174 Bacteria 1621
59 Ga0105241_10215155 3300009174 Bacteria 1612
60 Ga0105237_10000221 3300009545 Bacteria 80262
61 Ga0105238_10002426 3300009551 Bacteria 18699
62 Ga0105239_10024169 3300010375 Bacteria 6693
63 Ga0105239_10233704 3300010375 Bacteria 2063
64 Ga0157326_1009622 3300012513 Bacteria 1067
65 Ga0171463_1002 3300013249 Bacteria 1274851
66 Ga0163162_10023053 3300013306 Bacteria 6140
67 Ga0209435_100019 3300025206 Bacteria 260989
68 Ga0209436_111330 3300025208 Bacteria 1572
69 Ga0207425_1001535 3300025245 Bacteria 9474
70 Ga0207425_1001851 3300025245 Bacteria 8164
71 Ga0209646_1000038 3300025246 Bacteria 353982
72 Ga0209026_1000048 3300025250 Bacteria 257264
73 Ga0209759_1000038 3300025256 Bacteria 257264
74 Ga0209565_1000041 3300025263 Bacteria 251081
75 Ga0209565_1000333 3300025263 Bacteria 42094
76 Ga0209565_1024124 3300025263 Bacteria 1241
77 Ga0209673_1000364 3300025273 Bacteria 81319
78 Ga0209130_1000245 3300025284 Bacteria 68668
79 Ga0209130_1000708 3300025284 Bacteria 29740
80 Ga0209675_1004149 3300025291 Bacteria 6578
81 Ga0209675_1020023 3300025291 Bacteria 1825
82 Ga0209675_1045777 3300025291 Bacteria 929
83 Ga0209676_1000013 3300025292 Bacteria 816080
84 Ga0209676_1001225 3300025292 Bacteria 27158
85 Ga0209676_1002248 3300025292 Bacteria 14263
86 Ga0209676_1003354 3300025292 Bacteria 9980
87 Ga0209025_1000470 3300025294 Bacteria 78526
88 Ga0209025_1008649 3300025294 Bacteria 7279
89 Ga0209025_1010276 3300025294 Bacteria 6363
90 Ga0209025_1011906 3300025294 Bacteria 5660
91 Ga0209025_1023660 3300025294 Bacteria 3200
92 Ga0209025_1107076 3300025294 Bacteria 868
93 Ga0209564_1000875 3300025295 Bacteria 40039
94 Ga0209564_1004983 3300025295 Bacteria 7819
95 Ga0209564_1017198 3300025295 Bacteria 2832
96 Ga0209758_1001101 3300025297 Bacteria 34939
97 Ga0209758_1019219 3300025297 Bacteria 3306
98 Ga0209758_1046862 3300025297 Bacteria 1553
99 Ga0209050_1000008 3300025298 Bacteria 1144179
100 Ga0209050_1001244 3300025298 Bacteria 29472
101 Ga0209050_1006590 3300025298 Bacteria 6818
102 Ga0209050_1023484 3300025298 Bacteria 2168
103 Ga0209256_1000003 3300025299 Bacteria 1661127
104 Ga0209256_1000131 3300025299 Bacteria 162368
105 Ga0207426_1000091 3300025302 Bacteria 280561
106 Ga0207426_1005778 3300025302 Bacteria 5555
107 Ga0209051_1000005 3300025303 Bacteria 1142353
108 Ga0209051_1003864 3300025303 Bacteria 9573
109 Ga0209051_1007713 3300025303 Bacteria 5835
110 Ga0209257_1000048 3300025304 Bacteria 455536
111 Ga0209257_1000091 3300025304 Bacteria 270637
112 Ga0209257_1001570 3300025304 Bacteria 26406
113 Ga0209257_1001625 3300025304 Bacteria 25742
114 Ga0209257_1005559 3300025304 Bacteria 8776
115 Ga0209257_1012006 3300025304 Bacteria 4073
116 Ga0207707_10421628 3300025912 Bacteria 1144
117 Ga0207695_10173819 3300025913 Bacteria 2077
118 Ga0207671_10000253 3300025914 Bacteria 80240
119 Ga0207660_10024148 3300025917 Bacteria 4112
120 Ga0207652_10019292 3300025921 Bacteria 5607
121 Ga0207667_10214439 3300025949 Bacteria 1973
122 Ga0207639_10640851 3300026041 Bacteria 982
123 Ga0207674_10016123 3300026116 Bacteria 8186
124 Ga0209970_1000297 3300027614 Bacteria 8189
125 Ga0307517_10005537 3300028786 Bacteria 18980
126 Ga0307515_10223916 3300028794 Bacteria 1691
127 Ga0265338_10014893 3300028800 Bacteria 8601
128 Ga0265338_10031719 3300028800 Bacteria 5173
129 Ga0265328_10101184 3300031239 Bacteria 1067
130 Ga0265325_10021407 3300031241 Bacteria 3552
131 Ga0265325_10115300 3300031241 Bacteria 1301
132 Ga0265339_10001174 3300031249 Bacteria 19772
133 Ga0265331_10133926 3300031250 Bacteria 1129
134 Ga0265327_10000010 3300031251 Bacteria 566817
135 Ga0307513_10000206 3300031456 Bacteria 85338
136 Ga0307513_10000543 3300031456 Bacteria 53868
137 Ga0307513_10115722 3300031456 Bacteria 2663
138 Ga0307408_100019595 3300031548 Bacteria 4556
139 Ga0307408_100027315 3300031548 Bacteria 3931
140 Ga0265313_10000523 3300031595 Bacteria 40161
141 Ga0265314_10063924 3300031711 Bacteria 2494
142 Ga0265342_10010417 3300031712 Bacteria 6449
143 Ga0307516_10005941 3300031730 Bacteria 14438
144 Ga0307516_10092893 3300031730 Bacteria 2844
145 Ga0307406_10017312 3300031901 Bacteria 4197
146 Ga0307406_10481724 3300031901 Bacteria 1002
147 Ga0307412_10761090 3300031911 Bacteria 837
148 Ga0307416_100184742 3300032002 Bacteria 1958
149 Ga0307416_100422533 3300032002 Bacteria 1378
150 Ga0307507_10000769 3300033179 Bacteria 70490
151 Ga0307510_10003047 3300033180 Bacteria 19348
152 Ga0395899_0000001 3300037312 Bacteria 1750322
153 Ga0436365_0833750 3300039437 Bacteria 1611
154 Ga0436363_0174408 3300039450 Bacteria 2155
155 Ga0451791_0325970 3300041451 Bacteria 1861
156 Ga0451853_3001305 3300041512 Bacteria 1519
157 Ga0466969_0004773 3300044656 Bacteria 7216
158 Ga0466966_0113482 3300044684 Bacteria 1669
159 Ga0466963_0216809 3300044694 Bacteria 1340
160 Ga0466970_0067680 3300044765 Bacteria 1918
161 Ga0495605_0142239 3300046474 Bacteria 1075
162 Ga0495596_0132272 3300046500 Bacteria 968
163 Ga0495606_0003125 3300046507 Bacteria 17981
164 Ga0495606_0316608 3300046507 Bacteria 840
165 Ga0495610_0036807 3300046512 Bacteria 2498
166 Ga0495616_0027265 3300046513 Bacteria 3033
167 Ga0495631_0008204 3300046518 Bacteria 5268
168 Ga0495631_0050118 3300046518 Bacteria 1827
169 Ga0495668_0005804 3300046616 Bacteria 8251
170 Ga0495661_0000305 3300046665 Bacteria 55940
171 Ga0495683_0120230 3300047323 Unclassified 1247
172 Ga0495687_000785 3300047443 Bacteria 34129
173 Ga0495681_0015890 3300047470 Bacteria 4248
174 Ga0496121_0121537 3300048924 Bacteria 1972
175 Ga0496121_0151614 3300048924 Bacteria 1705
176 Ga0496122_0017857 3300048925 Bacteria 6594
177 Ga0496123_0016549 3300048926 Bacteria 5979
178 Ga0496124_0000022 3300048927 Bacteria 421020
179 Ga0496125_0354907 3300048928 Bacteria 874
180 Ga0496126_0014723 3300048929 Bacteria 7892
181 Ga0496126_0034413 3300048929 Bacteria 4758
182 Ga0496126_0288480 3300048929 Bacteria 1358
183 Ga0501305_024838 3300049161 Bacteria 905
184 Ga0501034_0110874 3300049571 Bacteria 2734
185 Ga0501034_0183889 3300049571 Bacteria 2054
186 Ga0501206_004876 3300049653 Bacteria 1720
187 Ga0501257_006876 3300049686 Bacteria 2532
188 Ga0501225_0082966 3300049705 Bacteria 922
189 Ga0501262_008676 3300049759 Bacteria 1246
190 Ga0501265_001232 3300049762 Bacteria 2894
191 Ga0501044_0029143 3300049823 Bacteria 5822
192 nmdc:mga0k408_2159_c1 3300050493 Bacteria 10550
193 Ga0500644_0068851 3300053088 Bacteria 1269
194 Ga0500651_0026383 3300053093 Bacteria 3651
195 Ga0500566_0201066 3300053094 Bacteria 1006
196 Ga0500650_0128395 3300053098 Bacteria 1179
197 Ga0500660_126571 3300053100 Bacteria 1050
198 Ga0500593_000456 3300053117 Bacteria 16197
199 Ga0500608_000867 3300053122 Bacteria 10918
200 Ga0500604_0001562 3300053151 Bacteria 6412
201 Ga0500604_0064080 3300053151 Unclassified 1160
202 Ga0500616_0000007 3300053153 Bacteria 836875
203 Ga0500616_0000324 3300053153 Bacteria 68394
204 Ga0500622_0082408 3300053156 Bacteria 1609
205 Ga0500634_0000006 3300053161 Bacteria 171639
206 Ga0500645_001755 3300053730 Bacteria 10517
207 Ga0500645_003241 3300053730 Bacteria 6727
208 Ga0500645_004768 3300053730 Bacteria 5132
209 Ga0500645_035977 3300053730 Bacteria 1474
210 2510308043 2510065057 Bacteria 6649661
211 2511245299 2511231002 Bacteria 5042903
212 2511503656 2511231052 Bacteria 6974333
213 2513586533 2513237086 Bacteria 7265287
214 2513620256 2513237091 Bacteria 6900273
215 2516897836 2516653046 Bacteria 6989037
216 2551680757 2551306084 Bacteria 8942552
217 2551689941 2551306085 Bacteria 7347181
218 2551696632 2551306086 Bacteria 6843938
219 2551698361 2551306087 Bacteria 7351905
220 2551701577 2551306087 Bacteria 7351905
221 2551722143 2551306090 Bacteria 7953713
222 2551729855 2551306091 Bacteria 7086830
223 2551738544 2551306092 Bacteria 6992595
224 2551742402 2551306093 Bacteria 7064773
225 2585993816 2585427633 Bacteria 6413184
226 2586004740 2585427634 Bacteria 6455027
227 2643805629 2643221557 Bacteria 7184309
228 2643964177 2643221591 Bacteria 4397626
229 2644064561 2643221610 Bacteria 7480339
230 2644106458 2643221618 Bacteria 7717186
231 2644149215 2643221626 Bacteria 8069654
232 2644308341 2643221655 Bacteria 7722067
233 2644332053 2643221659 Bacteria 7890716
234 2644377068 2643221668 Bacteria 7306521
235 2644419558 2643221675 Bacteria 7473456
236 2644452915 2643221680 Bacteria 7473610
237 2644544427 2643221698 Bacteria 7756764
238 2644615729 2643221712 Bacteria 7729434
239 2644672315 2643221723 Bacteria 7095460
240 2644691906 2643221726 Bacteria 7455827
241 2720617921 2718218233 Bacteria 6662049
242 2802720108 2802428858 Bacteria 6636079
243 2802739565 2802428861 Bacteria 6534206
244 2802746032 2802428862 Bacteria 6633353
245 2842316509 2842311132 Bacteria 6616990
246 2842342264 2842341865 Bacteria 7003929
247 2844165271 2844163670 Bacteria 7266046
248 2855831230 2855825444 Bacteria 6785811
249 2855845140 2855839649 Bacteria 7135830
250 2858804553 2858800743 Bacteria 6603254
251 2898716008 2898713307 Bacteria 4110805
252 2915995825 2915993759 Bacteria 7016183
253 2916013791 2916007675 Bacteria 6898660
254 2916019780 2916014648 Bacteria 6946486
255 2916027981 2916021584 Bacteria 6854472
256 2916035107 2916028427 Bacteria 6748433
257 2916035687 2916035215 Bacteria 6755766
258 2916047872 2916041962 Bacteria 6820487
259 2916053993 2916048683 Bacteria 6543552
260 2916058522 2916055098 Bacteria 6758838
261 2916070658 2916068649 Bacteria 6943657
262 2916078810 2916076590 Bacteria 6596108
263 2919176175 2919171160 Bacteria 6499771
264 2921205979 2921201388 Bacteria 6926299
265 2921242000 2921237296 Bacteria 6876710
266 2921249722 2921244191 Bacteria 6568419
267 2921269952 2921263974 Bacteria 6864552
268 2921287881 2921282425 Bacteria 6826397
269 2921295962 2921289301 Bacteria 7316391
270 2921300757 2921296804 Bacteria 7176999
271 2924150066 2924144063 Bacteria 6883928
272 2924161335 2924158325 Bacteria 7188855
273 2924172101 2924165586 Bacteria 7260590
274 2924176538 2924172951 Bacteria 6749356
275 2924192491 2924186466 Bacteria 6876637
276 2924199990 2924193448 Bacteria 6955718
277 2924205962 2924200457 Bacteria 6757188
278 2924211843 2924207177 Bacteria 6917007
279 2924214689 2924214083 Bacteria 7080103
280 2924221659 2924221636 Bacteria 7113495
281 2924230243 2924228884 Bacteria 6633132
282 2937007912 2937002841 Bacteria 6934057
283 2937014595 2937009748 Bacteria 6746052
284 2937019699 2937016420 Bacteria 6782579
285 2937037206 2937036028 Bacteria 6846469
286 2937046399 2937042894 Bacteria 6741576
287 2937055469 2937049772 Bacteria 6757901
288 2937062286 2937056579 Bacteria 7107896
289 2937067179 2937063883 Bacteria 7199456
290 2937072548 2937071275 Bacteria 6984483
291 2937094203 2937091812 Bacteria 6979387
292 2937105943 2937098957 Bacteria 7249374
293 2937106729 2937106411 Bacteria 6947143
294 2937132778 2937126314 Bacteria 6771275
295 2941505375 2941499720 Bacteria 7599444
296 2957394198 2957388812 Bacteria 6778072
297 2957429351 2957422303 Bacteria 7172205
298 2957435359 2957430029 Bacteria 7022557
299 2957459625 2957457609 Bacteria 6967680
300 2957469908 2957464669 Bacteria 6568877
301 2957471534 2957471148 Bacteria 6797643
302 2957481807 2957478035 Bacteria 6756658
303 2957489628 2957484790 Bacteria 6703082
304 2957498430 2957498199 Bacteria 7126688
305 2957511088 2957505466 Bacteria 7253085
306 2960589814 2960584000 Bacteria 6864594
307 2960609895 2960603979 Bacteria 6898737
308 2960621964 2960617483 Bacteria 6727748
309 2960628636 2960624210 Bacteria 6875384
310 2960637744 2960631154 Bacteria 6732508
311 2960651463 2960645483 Bacteria 7211087
312 2960653387 2960652885 Bacteria 7083688
313 2960688466 2960687367 Bacteria 6535474
314 2964612771 2964607997 Bacteria 7101408
315 2964626291 2964621998 Bacteria 6834995
316 2964635515 2964628898 Bacteria 7083044
317 2964648990 2964643177 Bacteria 6820887
318 2964650549 2964649959 Bacteria 6675118
319 2964658675 2964656573 Bacteria 7100150
320 2964670022 2964663802 Bacteria 7019362
321 2964684044 2964678106 Bacteria 6792020
322 2964690847 2964685014 Bacteria 6839111
323 2964697357 2964691889 Bacteria 6802758
324 2964700409 2964698721 Bacteria 6765331
325 2964708486 2964705432 Bacteria 7114648
326 2967671256 2967664464 Bacteria 6948836
327 2967676085 2967671571 Bacteria 7021409
328 2967684263 2967678726 Bacteria 7264382
329 2967698028 2967693043 Bacteria 6804451
330 2967702770 2967699805 Bacteria 6854538
331 2967710667 2967706974 Bacteria 7186053
332 2967716032 2967714385 Bacteria 7000047
333 2967722819 2967721400 Bacteria 7073753
334 2967728618 2967728569 Bacteria 6641507
335 2967752729 2967748971 Bacteria 6733771
336 2967768956 2967762386 Bacteria 6923502
337 2967774787 2967769361 Bacteria 6587838
338 2967776211 2967775926 Bacteria 6738189
339 2970025291 2970019648 Bacteria 7072033
340 2970034962 2970033650 Bacteria 7118744
341 2970044893 2970040964 Bacteria 6731123
342 2970050799 2970047711 Bacteria 7088379
343 2970057579 2970054988 Bacteria 6611507
344 2970061787 2970061556 Bacteria 7099761
345 2970070633 2970068827 Bacteria 7123112
346 2970089044 2970088815 Bacteria 6933825
347 2970113136 2970109326 Bacteria 6863976
348 2970121628 2970116247 Bacteria 6501857
349 2970134080 2970129317 Bacteria 6806560
350 2970143076 2970136068 Bacteria 7207982
351 2970155934 2970149975 Bacteria 6779706
352 2970163231 2970156795 Bacteria 7168044
353 2970168902 2970164137 Bacteria 6861252
354 2970175476 2970170962 Bacteria 6876229
355 2970183187 2970177841 Bacteria 6768001
356 2970188128 2970184632 Bacteria 7054431
357 2970198071 2970191845 Bacteria 7032787
358 2977524211 2977523885 Bacteria 6960446
359 2977543656 2977537788 Bacteria 6929320
360 2977546623 2977544691 Bacteria 6875412
361 2977557106 2977551784 Bacteria 7125765
362 2977564851 2977558990 Bacteria 6863948
363 2977577835 2977572785 Bacteria 6763888
364 2977580110 2977579622 Bacteria 6772100
365 648739978 648276728 Bacteria 6968865
366 8003997562 8003992118 Bacteria 7266902
367 Ga0500566_0071336
368 JGI24739J22299_10115417
369 JGI24735J21928_10069428
370 JGI25155J39150_1000323
371 JGI25154J39366_1000657
372 JGI25157J39369_1000791
373 JGI25150J39212_1016184
374 JGI25159J45721_1000407
375 JGI25159J45721_1016390
376 JGI25151J46595_10010088
377 JGI25151J46595_10014781
378 JGI25151J46595_10015740
379 JGI25151J46595_10045880
380 JGI25153J46596_10053264
381 rootH2_10004521
382 rootH2_10028784
383 rootH2_10139151
384 rootH2_10194633
385 rootL2_10193618
386 rootH1_10114170
387 JGI25160J50197_1000172
388 JGI25161J50226_1000007
389 Ga0055526_1009546
390 Ga0055526_1018589
391 Ga0055537_1000356
392 Ga0055537_1022752
393 Ga0055524_1000213
394 Ga0055524_1000859
395 Ga0055536_1001320
396 Ga0055536_1003918
397 Ga0055536_1005157
398 Ga0055536_1035843
399 Ga0055534_1015169
400 Ga0055528_1002730
401 Ga0055530_10001299
402 Ga0055540_1000504
403 Ga0055540_1000731
404 Ga0055531_10003518
405 Ga0055531_10004306
406 Ga0055531_10015747
407 Ga0055531_10025776
408 Ga0055543_1005400
409 Ga0065165_1001170
410 Ga0065165_1053854
411 Ga0070681_10013633
412 Ga0070698_101227962
413 Ga0070679_100007570
414 Ga0068853_100005264
415 Ga0068853_100019944
416 Ga0068853_100598577
417 Ga0068855_100057666
418 Ga0068855_100544373
419 Ga0068856_100079821
420 Ga0068866_10373673
421 Ga0075432_10002756
422 Ga0075362_10131882
423 Ga0105240_10161808
424 Ga0105241_10212673
425 Ga0105241_10215155
426 Ga0105237_10000221
427 Ga0105238_10002426
428 Ga0105239_10024169
429 Ga0105239_10233704
430 Ga0157326_1009622
431 Ga0171463_1002
432 Ga0163162_10023053
433 Ga0209435_100019
434 Ga0209436_111330
435 Ga0207425_1001535
436 Ga0207425_1001851
437 Ga0209646_1000038
438 Ga0209026_1000048
439 Ga0209759_1000038
440 Ga0209565_1000041
441 Ga0209565_1000333
442 Ga0209565_1024124
443 Ga0209673_1000364
444 Ga0209130_1000245
445 Ga0209130_1000708
446 Ga0209675_1004149
447 Ga0209675_1020023
448 Ga0209675_1045777
449 Ga0209676_1000013
450 Ga0209676_1001225
451 Ga0209676_1002248
452 Ga0209676_1003354
453 Ga0209025_1000470
454 Ga0209025_1008649
455 Ga0209025_1010276
456 Ga0209025_1011906
457 Ga0209025_1023660
458 Ga0209025_1107076
459 Ga0209564_1000875
460 Ga0209564_1004983
461 Ga0209564_1017198
462 Ga0209758_1001101
463 Ga0209758_1019219
464 Ga0209758_1046862
465 Ga0209050_1000008
466 Ga0209050_1001244
467 Ga0209050_1006590
468 Ga0209050_1023484
469 Ga0209256_1000003
470 Ga0209256_1000131
471 Ga0207426_1000091
472 Ga0207426_1005778
473 Ga0209051_1000005
474 Ga0209051_1003864
475 Ga0209051_1007713
476 Ga0209257_1000048
477 Ga0209257_1000091
478 Ga0209257_1001570
479 Ga0209257_1001625
480 Ga0209257_1005559
481 Ga0209257_1012006
482 Ga0207707_10421628
483 Ga0207695_10173819
484 Ga0207671_10000253
485 Ga0207660_10024148
486 Ga0207652_10019292
487 Ga0207667_10214439
488 Ga0207639_10640851
489 Ga0207674_10016123
490 Ga0209970_1000297
491 Ga0307517_10005537
492 Ga0307515_10223916
493 Ga0265338_10014893
494 Ga0265338_10031719
495 Ga0265328_10101184
496 Ga0265325_10021407
497 Ga0265325_10115300
498 Ga0265339_10001174
499 Ga0265331_10133926
500 Ga0265327_10000010
501 Ga0307513_10000206
502 Ga0307513_10000543
503 Ga0307513_10115722
504 Ga0307408_100019595
505 Ga0307408_100027315
506 Ga0265313_10000523
507 Ga0265314_10063924
508 Ga0265342_10010417
509 Ga0307516_10005941
510 Ga0307516_10092893
511 Ga0307406_10017312
512 Ga0307406_10481724
513 Ga0307412_10761090
514 Ga0307416_100184742
515 Ga0307416_100422533
516 Ga0307507_10000769
517 Ga0307510_10003047
518 Ga0395899_0000001
519 Ga0436365_0833750
520 Ga0436363_0174408
521 Ga0451791_0325970
522 Ga0451853_3001305
523 Ga0466969_0004773
524 Ga0466966_0113482
525 Ga0466963_0216809
526 Ga0466970_0067680
527 Ga0495605_0142239
528 Ga0495596_0132272
529 Ga0495606_0003125
530 Ga0495606_0316608
531 Ga0495610_0036807
532 Ga0495616_0027265
533 Ga0495631_0008204
534 Ga0495631_0050118
535 Ga0495668_0005804
536 Ga0495661_0000305
537 Ga0495683_0120230
538 Ga0495687_000785
539 Ga0495681_0015890
540 Ga0496121_0121537
541 Ga0496121_0151614
542 Ga0496122_0017857
543 Ga0496123_0016549
544 Ga0496124_0000022
545 Ga0496125_0354907
546 Ga0496126_0014723
547 Ga0496126_0034413
548 Ga0496126_0288480
549 Ga0501305_024838
550 Ga0501034_0110874
551 Ga0501034_0183889
552 Ga0501206_004876
553 Ga0501257_006876
554 Ga0501225_0082966
555 Ga0501262_008676
556 Ga0501265_001232
557 Ga0501044_0029143
558 nmdc:mga0k408_2159_c1
559 Ga0500644_0068851
560 Ga0500651_0026383
561 Ga0500566_0201066
562 Ga0500650_0128395
563 Ga0500660_126571
564 Ga0500593_000456
565 Ga0500608_000867
566 Ga0500604_0001562
567 Ga0500604_0064080
568 Ga0500616_0000007
569 Ga0500616_0000324
570 Ga0500622_0082408
571 Ga0500634_0000006
572 Ga0500645_001755
573 Ga0500645_003241
574 Ga0500645_004768
575 Ga0500645_035977
576 2510308043
577 2511245299
578 2511503656
579 2513586533
580 2513620256
581 2516897836
582 2551680757
583 2551689941
584 2551696632
585 2551698361
586 2551701577
587 2551722143
588 2551729855
589 2551738544
590 2551742402
591 2585993816
592 2586004740
593 2643805629
594 2643964177
595 2644064561
596 2644106458
597 2644149215
598 2644308341
599 2644332053
600 2644377068
601 2644419558
602 2644452915
603 2644544427
604 2644615729
605 2644672315
606 2644691906
607 2720617921
608 2802720108
609 2802739565
610 2802746032
611 2842316509
612 2842342264
613 2844165271
614 2855831230
615 2855845140
616 2858804553
617 2898716008
618 2915995825
619 2916013791
620 2916019780
621 2916027981
622 2916035107
623 2916035687
624 2916047872
625 2916053993
626 2916058522
627 2916070658
628 2916078810
629 2919176175
630 2921205979
631 2921242000
632 2921249722
633 2921269952
634 2921287881
635 2921295962
636 2921300757
637 2924150066
638 2924161335
639 2924172101
640 2924176538
641 2924192491
642 2924199990
643 2924205962
644 2924211843
645 2924214689
646 2924221659
647 2924230243
648 2937007912
649 2937014595
650 2937019699
651 2937037206
652 2937046399
653 2937055469
654 2937062286
655 2937067179
656 2937072548
657 2937094203
658 2937105943
659 2937106729
660 2937132778
661 2941505375
662 2957394198
663 2957429351
664 2957435359
665 2957459625
666 2957469908
667 2957471534
668 2957481807
669 2957489628
670 2957498430
671 2957511088
672 2960589814
673 2960609895
674 2960621964
675 2960628636
676 2960637744
677 2960651463
678 2960653387
679 2960688466
680 2964612771
681 2964626291
682 2964635515
683 2964648990
684 2964650549
685 2964658675
686 2964670022
687 2964684044
688 2964690847
689 2964697357
690 2964700409
691 2964708486
692 2967671256
693 2967676085
694 2967684263
695 2967698028
696 2967702770
697 2967710667
698 2967716032
699 2967722819
700 2967728618
701 2967752729
702 2967768956
703 2967774787
704 2967776211
705 2970025291
706 2970034962
707 2970044893
708 2970050799
709 2970057579
710 2970061787
711 2970070633
712 2970089044
713 2970113136
714 2970121628
715 2970134080
716 2970143076
717 2970155934
718 2970163231
719 2970168902
720 2970175476
721 2970183187
722 2970188128
723 2970198071
724 2977524211
725 2977543656
726 2977546623
727 2977557106
728 2977564851
729 2977577835
730 2977580110
731 648739978
732 8003997562

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05368

NmrA

NmrA-like family

33

138

0.92

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

33

156

0.85

PF13460

NAD_binding_10

NAD(P)H-binding

37

233

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dhn-assembly1.cif.gz_A crystal structure of the putative epimerase q89z24_bactn from bacteroides thetaiotaomicron. northeast structural genomics consortium target btr310. 0.9543 2 213
4jgb-assembly2.cif.gz_B crystal structure of putative exported protein from burkholderia pseudomallei 0.9304 1 213
4jgb-assembly1.cif.gz_A crystal structure of putative exported protein from burkholderia pseudomallei 0.93 1 213
3dhn-assembly1.cif.gz_A crystal structure of the putative epimerase q89z24_bactn from bacteroides thetaiotaomicron. northeast structural genomics consortium target btr310. 0.9281 2 213
4jgb-assembly2.cif.gz_B crystal structure of putative exported protein from burkholderia pseudomallei 0.9217 1 213
ID Description Score Start End Superfamily
3dhnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.956 2 213 3.40.50.720
4jgbB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9304 1 213 3.40.50.720
4jgbB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9217 1 213 3.40.50.720
3dhnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9162 2 213 3.40.50.720
4r01B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9112 1 212 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3B7N047-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.992 1 213 GO:0016646
AF-A0A522T0B2-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9893 61 213 GO:0016646
AF-A0A643F4N6-F1-model_v4 NAD(P)-dependent oxidoreductase 0.989 2 213 GO:0016646
AF-A0A256FHA7-F1-model_v4 3-beta hydroxysteroid dehydrogenase/isomerase family protein 0.9887 2 213 GO:0016646
GO:0016853
AF-A0A368K7G6-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9884 2 213 GO:0016646

Map