F424173

General Info

Members Datasets Scaffolds Average Seq Length
366 256 356 123

Family's Representative Sequence

Representative Sequence 3300053733|Ga0500552_003017|Ga0500552_003017_169_546
Length 113
Sequence MADVKYSEEHEWIRIEGDTGTIGITQYAQEQLGDVVFVDVPASGRKVAKASDIYAPVSGEVIESNAALADSPGDVNTEPMGKGWFFKIKMSDKGELAGLMDEAAYEAFVKSLG

Samples

Sample ID Description Type Environment
1 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
2 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
3 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
4 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
5 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
6 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
7 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
8 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
9 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
10 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
11 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
12 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
13 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
14 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
15 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
16 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
18 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
19 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
24 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
70 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
87 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
88 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
91 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
92 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
97 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
139 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
140 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
141 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
142 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
143 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
146 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
147 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
148 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
151 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
152 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
153 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
154 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
155 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
156 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
157 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
158 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
159 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
160 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
161 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
162 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
163 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
164 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
165 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
166 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
167 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
168 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
169 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
170 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
171 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
172 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
173 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
174 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
175 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
176 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
177 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
178 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
179 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
180 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
181 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
182 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
183 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
184 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
185 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
186 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
187 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
188 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
189 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
190 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
191 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
192 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
193 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
194 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
195 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
196 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
197 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
198 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
199 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
211 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
212 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
213 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
214 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
215 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
216 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
217 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
218 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
219 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
220 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
221 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
226 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
227 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
228 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
230 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
231 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
232 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
233 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
234 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
235 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
236 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
237 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
238 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
239 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
240 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
241 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
242 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
243 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
244 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
245 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
246 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
247 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
248 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
249 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
250 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
251 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
252 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
253 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
254 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
255 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
256 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.72
Metatranscriptomes 0.55
Isolates 2.73

Biome Distribution

Category Percentage (%)
Aerial Root 0.82
Bulb 0
Endosphere 20.77
Nodule 0.82
Rhizoplane 4.1
Rhizosphere 64.75
Stem 0
Stem Tuber 0
Unclassified 8.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1082574 3300001904 Bacteria 505
2 JGI24740J21852_10017918 3300001979 Bacteria 2523
3 JGI24739J22299_10040369 3300001989 Bacteria 1558
4 JGI24737J22298_10019610 3300001990 Bacteria 2162
5 JGI24737J22298_10022475 3300001990 Bacteria 2005
6 JGI25151J46595_10013218 3300003187 Bacteria 3724
7 JGI25406J46586_10002442 3300003203 Bacteria 8787
8 JGI25165J46597_1000021 3300003214 Bacteria 359288
9 JGI25153J46596_10000021 3300003215 Bacteria 252651
10 JGI25153J46596_10000028 3300003215 Bacteria 209842
11 Ga0055525_1000070 3300003759 Bacteria 183047
12 Ga0055542_1000102 3300003762 Bacteria 115614
13 Ga0055529_1000136 3300003763 Bacteria 104102
14 Ga0055526_1013144 3300003771 Bacteria 3532
15 Ga0055537_1001325 3300003773 Bacteria 10122
16 Ga0055536_1006520 3300003781 Bacteria 5425
17 Ga0055540_1001854 3300003792 Bacteria 11908
18 Ga0070658_10000611 3300005327 Bacteria 30913
19 Ga0070676_10079851 3300005328 Bacteria 1981
20 Ga0070670_100639436 3300005331 Bacteria 954
21 Ga0070670_101569846 3300005331 Bacteria 605
22 Ga0068868_102301925 3300005338 Bacteria 514
23 Ga0070660_100135177 3300005339 Bacteria 1975
24 Ga0070660_100393851 3300005339 Bacteria 1145
25 Ga0070661_100010527 3300005344 Bacteria 6431
26 Ga0070669_101385530 3300005353 Bacteria 610
27 Ga0070674_100009563 3300005356 Bacteria 5807
28 Ga0070674_100037733 3300005356 Bacteria 3252
29 Ga0070673_100074342 3300005364 Bacteria 2739
30 Ga0070673_100242537 3300005364 Bacteria 1568
31 Ga0070673_101827288 3300005364 Bacteria 576
32 Ga0070659_100221561 3300005366 Bacteria 1561
33 Ga0070659_100224211 3300005366 Bacteria 1552
34 Ga0070678_100001327 3300005456 Bacteria 13134
35 Ga0070678_100149735 3300005456 Bacteria 1878
36 Ga0070662_100204787 3300005457 Bacteria 1567
37 Ga0070662_101519761 3300005457 Bacteria 577
38 Ga0068867_100069567 3300005459 Bacteria 2629
39 Ga0068867_101598571 3300005459 Bacteria 609
40 Ga0070699_101220136 3300005518 Bacteria 690
41 Ga0070679_100352271 3300005530 Bacteria 1420
42 Ga0070679_101765916 3300005530 Bacteria 567
43 Ga0070665_100000021 3300005548 Bacteria 389668
44 Ga0070665_100745111 3300005548 Bacteria 993
45 Ga0070665_102189061 3300005548 Bacteria 557
46 Ga0068855_100042838 3300005563 Bacteria 5363
47 Ga0068855_100449249 3300005563 Bacteria 1407
48 Ga0070664_100029163 3300005564 Bacteria 4599
49 Ga0068854_100030087 3300005578 Bacteria 3764
50 Ga0068854_100703020 3300005578 Bacteria 873
51 Ga0068852_100854893 3300005616 Bacteria 925
52 Ga0068852_102056229 3300005616 Bacteria 593
53 Ga0068864_100001277 3300005618 Bacteria 20922
54 Ga0068866_10690681 3300005718 Bacteria 699
55 Ga0068851_10006971 3300005834 Bacteria 5182
56 Ga0068863_101624703 3300005841 Bacteria 656
57 Ga0068858_100000414 3300005842 Bacteria 44330
58 Ga0068858_100022463 3300005842 Bacteria 5888
59 Ga0081539_10008557 3300005985 Bacteria 8854
60 Ga0081539_10011926 3300005985 Bacteria 6781
61 Ga0075365_10361494 3300006038 Bacteria 1023
62 Ga0075368_10206535 3300006042 Bacteria 832
63 Ga0075367_10104299 3300006178 Bacteria 1736
64 Ga0075369_10001315 3300006186 Bacteria 8457
65 Ga0075366_10274983 3300006195 Bacteria 1029
66 Ga0097621_100081089 3300006237 Bacteria 2700
67 Ga0097621_101170274 3300006237 Bacteria 724
68 Ga0075370_10388054 3300006353 Bacteria 837
69 Ga0075370_10616605 3300006353 Bacteria 658
70 Ga0068871_100293259 3300006358 Bacteria 1426
71 Ga0097620_101757961 3300006931 Bacteria 685
72 Ga0079104_1050766 3300006946 Bacteria 925
73 Ga0079104_1082942 3300006946 Bacteria 658
74 Ga0105245_10000244 3300009098 Bacteria 52007
75 Ga0105243_10000222 3300009148 Bacteria 65448
76 Ga0105243_10136744 3300009148 Bacteria 2086
77 Ga0105241_10089982 3300009174 Bacteria 2419
78 Ga0105248_10016890 3300009177 Bacteria 8035
79 Ga0105248_12176892 3300009177 Bacteria 631
80 Ga0105238_10199322 3300009551 Bacteria 1977
81 Ga0105238_11522760 3300009551 Bacteria 698
82 Ga0105249_10522567 3300009553 Bacteria 1234
83 Ga0105246_11279300 3300011119 Bacteria 679
84 Ga0157317_1001872 3300012475 Bacteria 1188
85 Ga0157313_1006022 3300012503 Bacteria 897
86 Ga0157373_10254339 3300013100 Bacteria 1243
87 Ga0157373_10929306 3300013100 Bacteria 646
88 Ga0157371_10000066 3300013102 Bacteria 168406
89 Ga0157371_10062008 3300013102 Bacteria 2651
90 Ga0157371_10100329 3300013102 Bacteria 2053
91 Ga0157371_11378562 3300013102 Bacteria 547
92 Ga0157370_11649467 3300013104 Bacteria 576
93 Ga0157378_10006170 3300013297 Bacteria 10492
94 Ga0157378_10130816 3300013297 Bacteria 2323
95 Ga0157378_11542118 3300013297 Bacteria 709
96 Ga0157378_12295539 3300013297 Bacteria 591
97 Ga0163162_10001705 3300013306 Bacteria 20605
98 Ga0163162_10114018 3300013306 Bacteria 2802
99 Ga0163162_10560843 3300013306 Bacteria 1270
100 Ga0163162_10884452 3300013306 Bacteria 1007
101 Ga0157372_10034904 3300013307 Bacteria 5534
102 Ga0157372_10043919 3300013307 Bacteria 4950
103 Ga0157372_10242215 3300013307 Bacteria 2093
104 Ga0157375_10841575 3300013308 Bacteria 1064
105 Ga0182008_10238772 3300014497 Bacteria 934
106 Ga0182008_10736926 3300014497 Bacteria 566
107 Ga0157377_10530607 3300014745 Bacteria 828
108 Ga0157379_11688685 3300014968 Bacteria 620
109 Ga0157376_13087523 3300014969 Bacteria 504
110 Ga0183363_1007 3300015690 Bacteria 315687
111 Ga0163161_10023014 3300017792 Bacteria 4390
112 Ga0206352_11110008 3300020078 Bacteria 544
113 Ga0209563_100053 3300025230 Bacteria 332370
114 Ga0209437_102200 3300025233 Bacteria 3890
115 Ga0207425_1000005 3300025245 Bacteria 900502
116 Ga0209677_104480 3300025253 Bacteria 4005
117 Ga0209148_1000159 3300025254 Bacteria 139560
118 Ga0209129_1002321 3300025258 Bacteria 9431
119 Ga0209233_1000065 3300025261 Bacteria 387195
120 Ga0209233_1011101 3300025261 Bacteria 2665
121 Ga0209565_1000056 3300025263 Bacteria 200189
122 Ga0209565_1015778 3300025263 Bacteria 1695
123 Ga0209455_1000045 3300025272 Bacteria 383329
124 Ga0209673_1057283 3300025273 Bacteria 993
125 Ga0209673_1063505 3300025273 Bacteria 910
126 Ga0209676_1007393 3300025292 Bacteria 5166
127 Ga0209025_1000464 3300025294 Bacteria 79341
128 Ga0209564_1000899 3300025295 Bacteria 39101
129 Ga0209758_1000002 3300025297 Bacteria 1400310
130 Ga0209758_1000023 3300025297 Bacteria 612453
131 Ga0209050_1000005 3300025298 Bacteria 1557793
132 Ga0209051_1000967 3300025303 Bacteria 28107
133 Ga0207697_10194690 3300025315 Bacteria 890
134 Ga0207656_10036656 3300025321 Bacteria 2059
135 Ga0207688_10038358 3300025901 Bacteria 2659
136 Ga0207688_10232825 3300025901 Bacteria 1112
137 Ga0207647_10427153 3300025904 Bacteria 744
138 Ga0207645_10163509 3300025907 Bacteria 1457
139 Ga0207705_10000523 3300025909 Bacteria 32624
140 Ga0207705_10004430 3300025909 Bacteria 10614
141 Ga0207671_10013543 3300025914 Bacteria 6494
142 Ga0207657_10005576 3300025919 Bacteria 13143
143 Ga0207657_10159747 3300025919 Bacteria 1831
144 Ga0207657_11463602 3300025919 Bacteria 511
145 Ga0207649_10000069 3300025920 Bacteria 91425
146 Ga0207652_10302481 3300025921 Bacteria 1444
147 Ga0207694_10005213 3300025924 Bacteria 10037
148 Ga0207694_10148963 3300025924 Bacteria 1885
149 Ga0207650_10564962 3300025925 Bacteria 954
150 Ga0207659_10949832 3300025926 Bacteria 739
151 Ga0207687_10006845 3300025927 Bacteria 7509
152 Ga0207690_10000846 3300025932 Bacteria 19607
153 Ga0207706_10034636 3300025933 Bacteria 4492
154 Ga0207709_10000047 3300025935 Bacteria 238649
155 Ga0207709_10110421 3300025935 Bacteria 1837
156 Ga0207669_10000339 3300025937 Bacteria 21278
157 Ga0207669_10009784 3300025937 Bacteria 4583
158 Ga0207704_10336362 3300025938 Bacteria 1170
159 Ga0207704_10721449 3300025938 Bacteria 827
160 Ga0207691_10591428 3300025940 Bacteria 940
161 Ga0207711_10009724 3300025941 Bacteria 8002
162 Ga0207679_10021396 3300025945 Bacteria 4385
163 Ga0207667_10000001 3300025949 Bacteria 1178522
164 Ga0207667_10498220 3300025949 Bacteria 1236
165 Ga0207651_10425597 3300025960 Bacteria 1134
166 Ga0207651_11514227 3300025960 Bacteria 604
167 Ga0207640_10001746 3300025981 Bacteria 11663
168 Ga0207640_10166312 3300025981 Bacteria 1638
169 Ga0207658_10023885 3300025986 Bacteria 4272
170 Ga0207703_10000634 3300026035 Bacteria 35367
171 Ga0207703_10011591 3300026035 Bacteria 6855
172 Ga0207639_10000379 3300026041 Bacteria 30706
173 Ga0207641_11374751 3300026088 Bacteria 707
174 Ga0207648_10308368 3300026089 Bacteria 1420
175 Ga0207648_10317315 3300026089 Bacteria 1400
176 Ga0207676_10056703 3300026095 Bacteria 3081
177 Ga0207674_10003949 3300026116 Bacteria 18040
178 Ga0207675_100338138 3300026118 Bacteria 1473
179 Ga0207683_10048111 3300026121 Bacteria 3734
180 Ga0207698_10000220 3300026142 Bacteria 35458
181 Ga0207698_10000605 3300026142 Bacteria 21064
182 Ga0207698_10807956 3300026142 Bacteria 940
183 Ga0207698_11828975 3300026142 Bacteria 622
184 Ga0209281_1030505 3300027111 Bacteria 967
185 Ga0268266_10000015 3300028379 Bacteria 630629
186 Ga0268266_12016354 3300028379 Bacteria 550
187 Ga0307517_10024002 3300028786 Bacteria 7542
188 Ga0307517_10060934 3300028786 Bacteria 3580
189 Ga0307515_10219553 3300028794 Bacteria 1723
190 Ga0265340_10078348 3300031247 Bacteria 1558
191 Ga0307513_10016183 3300031456 Bacteria 9009
192 Ga0307509_10363898 3300031507 Bacteria 1165
193 Ga0307508_10000810 3300031616 Bacteria 36605
194 Ga0307413_11874683 3300031824 Bacteria 538
195 Ga0307510_10048004 3300033180 Bacteria 4562
196 Ga0307510_10051823 3300033180 Bacteria 4336
197 Ga0373946_0300955 3300035171 Bacteria 793
198 Ga0237819_00276 3300038705 Bacteria 18875
199 Ga0237816_07754 3300039145 Bacteria 669
200 Ga0436365_0642857 3300039437 Bacteria 630
201 Ga0436363_0921155 3300039450 Bacteria 1186
202 Ga0436363_1272908 3300039450 Bacteria 765
203 Ga0439461_0005110 3300041410 Bacteria 2223
204 Ga0451789_0625851 3300041443 Bacteria 802
205 Ga0451793_1007654 3300041452 Bacteria 770
206 Ga0451797_0332862 3300041453 Bacteria 533
207 Ga0451804_0897421 3300041463 Bacteria 636
208 Ga0451849_0946690 3300041505 Bacteria 664
209 Ga0451855_0610982 3300041511 Bacteria 632
210 Ga0439431_0011622 3300041997 Bacteria 2013
211 Ga0439452_047438 3300042010 Bacteria 993
212 Ga0439457_005326 3300042014 Bacteria 3252
213 Ga0439462_0154318 3300042015 Bacteria 646
214 Ga0450894_004126 3300042131 Bacteria 1893
215 Ga0450906_063717 3300042145 Bacteria 657
216 Ga0439446_0007575 3300042156 Bacteria 2858
217 Ga0439434_0008271 3300042435 Bacteria 3051
218 Ga0495638_0000481 3300046460 Bacteria 47890
219 Ga0495638_0577842 3300046460 Bacteria 555
220 Ga0495650_0000491 3300046471 Bacteria 60068
221 Ga0495584_0190565 3300046491 Bacteria 1042
222 Ga0495585_0015386 3300046492 Bacteria 4446
223 Ga0495585_0144418 3300046492 Bacteria 1244
224 Ga0495596_0027174 3300046500 Bacteria 2303
225 Ga0495583_0003992 3300046506 Bacteria 10888
226 Ga0495583_0044206 3300046506 Bacteria 2068
227 Ga0495583_0062892 3300046506 Bacteria 1651
228 Ga0495583_0129419 3300046506 Bacteria 1057
229 Ga0495606_0000379 3300046507 Bacteria 75426
230 Ga0495606_0117246 3300046507 Bacteria 1598
231 Ga0495616_0336604 3300046513 Bacteria 631
232 Ga0495631_0018789 3300046518 Bacteria 3250
233 Ga0495631_0402014 3300046518 Bacteria 583
234 Ga0495637_0077865 3300046520 Bacteria 1326
235 Ga0495643_0038387 3300046522 Bacteria 2623
236 Ga0495643_0081417 3300046522 Bacteria 1683
237 Ga0495643_0113703 3300046522 Bacteria 1374
238 Ga0495648_0012527 3300046524 Bacteria 6319
239 Ga0495648_0019397 3300046524 Bacteria 4783
240 Ga0495648_0063298 3300046524 Bacteria 2185
241 Ga0495648_0430828 3300046524 Bacteria 582
242 Ga0495663_0005640 3300046525 Bacteria 3465
243 Ga0495666_0341404 3300046526 Bacteria 675
244 Ga0495642_0063488 3300046528 Bacteria 1535
245 Ga0495587_0149162 3300046536 Bacteria 1333
246 Ga0495597_0071135 3300046542 Bacteria 1499
247 Ga0495597_0350082 3300046542 Bacteria 567
248 Ga0495622_0080776 3300046557 Bacteria 1496
249 Ga0495633_0000758 3300046558 Bacteria 29025
250 Ga0495633_0152431 3300046558 Bacteria 1067
251 Ga0495668_0000548 3300046616 Bacteria 46481
252 Ga0495668_0179476 3300046616 Bacteria 1160
253 Ga0495625_0000112 3300046660 Bacteria 124365
254 Ga0495625_0000757 3300046660 Bacteria 45128
255 Ga0495625_0009826 3300046660 Bacteria 7962
256 Ga0495625_0098392 3300046660 Bacteria 2012
257 Ga0495625_0117561 3300046660 Bacteria 1812
258 Ga0495625_0151277 3300046660 Bacteria 1560
259 Ga0495625_0350012 3300046660 Bacteria 934
260 Ga0495669_0000378 3300046684 Bacteria 22467
261 Ga0495670_0183182 3300046691 Bacteria 1106
262 Ga0495670_0392439 3300046691 Bacteria 749
263 Ga0495671_0613580 3300046692 Bacteria 517
264 Ga0495649_0188259 3300046694 Bacteria 1075
265 Ga0495649_0311317 3300046694 Bacteria 800
266 Ga0495600_0001428 3300046809 Bacteria 13211
267 Ga0495660_0104340 3300046810 Bacteria 1455
268 Ga0495636_0414743 3300047318 Bacteria 643
269 Ga0495683_0018676 3300047323 Bacteria 3582
270 Ga0495683_0084157 3300047323 Bacteria 1548
271 Ga0495687_000192 3300047443 Bacteria 87877
272 Ga0495687_000611 3300047443 Bacteria 41726
273 Ga0495677_0016311 3300047445 Bacteria 2695
274 Ga0495677_0027315 3300047445 Bacteria 2071
275 Ga0495673_0103332 3300047469 Bacteria 1149
276 Ga0495681_0019613 3300047470 Bacteria 3686
277 Ga0495681_0115729 3300047470 Bacteria 1156
278 Ga0495686_0001111 3300047472 Bacteria 31908
279 Ga0495686_0011788 3300047472 Bacteria 6152
280 Ga0496101_0585848 3300048904 Bacteria 882
281 Ga0496102_0000435 3300048905 Bacteria 47703
282 Ga0496102_0103865 3300048905 Bacteria 2643
283 Ga0496103_0000177 3300048906 Bacteria 65489
284 Ga0496104_0039847 3300048907 Bacteria 4400
285 Ga0496105_0000159 3300048908 Bacteria 44784
286 Ga0496109_0728243 3300048912 Bacteria 930
287 Ga0496110_0325432 3300048913 Bacteria 1400
288 Ga0496111_0015596 3300048914 Bacteria 5221
289 Ga0496114_0006747 3300048917 Bacteria 9043
290 Ga0496115_0000410 3300048918 Bacteria 35215
291 Ga0496116_0020947 3300048919 Bacteria 4946
292 Ga0496117_0004031 3300048920 Bacteria 16542
293 Ga0496118_0000850 3300048921 Bacteria 48481
294 Ga0496118_0422007 3300048921 Bacteria 686
295 Ga0496119_0019836 3300048922 Bacteria 4929
296 Ga0496120_0022294 3300048923 Bacteria 3986
297 Ga0496121_0000580 3300048924 Bacteria 68713
298 Ga0496121_0002231 3300048924 Bacteria 30224
299 Ga0496121_0170581 3300048924 Bacteria 1581
300 Ga0496122_0102476 3300048925 Bacteria 1908
301 Ga0496122_0365417 3300048925 Bacteria 747
302 Ga0496123_0085682 3300048926 Bacteria 1894
303 Ga0496124_0004357 3300048927 Bacteria 16557
304 Ga0496125_0118781 3300048928 Bacteria 1892
305 Ga0496126_0004511 3300048929 Bacteria 16586
306 Ga0501032_0648407 3300049569 Bacteria 671
307 Ga0501043_0270158 3300049579 Bacteria 1306
308 Ga0501046_1176798 3300049580 Bacteria 527
309 Ga0501047_1142425 3300049581 Bacteria 592
310 Ga0501070_1272736 3300049586 Bacteria 562
311 Ga0501071_0129371 3300049587 Bacteria 1875
312 Ga0501074_0746602 3300049590 Bacteria 690
313 Ga0501035_0450297 3300049822 Bacteria 1065
314 Ga0501035_0828447 3300049822 Bacteria 737
315 Ga0501044_0112869 3300049823 Bacteria 2725
316 Ga0501044_0230571 3300049823 Bacteria 1799
317 Ga0501044_0931260 3300049823 Bacteria 743
318 nmdc:mga03683_222411_c1 3300050489 Bacteria 871
319 nmdc:mga0yw44_17375_c1 3300050492 Bacteria 3913
320 nmdc:mga0yw44_381547_c1 3300050492 Bacteria 952
321 nmdc:mga0k408_388994_c1 3300050493 Bacteria 830
322 nmdc:mga06z11_97344_c1 3300050494 Bacteria 1608
323 nmdc:mga04h51_75144_c1 3300050495 Bacteria 1188
324 nmdc:mga07m45_316914_c1 3300050496 Bacteria 906
325 nmdc:mga07m45_413910_c1 3300050496 Bacteria 782
326 nmdc:mga0sz30_14056_c2 3300050516 Bacteria 2375
327 Ga0500610_0000059 3300053079 Bacteria 34324
328 Ga0500643_009135 3300053087 Bacteria 3815
329 Ga0500643_012835 3300053087 Bacteria 2987
330 Ga0500643_017703 3300053087 Bacteria 2379
331 Ga0500643_023291 3300053087 Bacteria 1979
332 Ga0500643_025282 3300053087 Bacteria 1875
333 Ga0500583_0103825 3300053092 Bacteria 1395
334 Ga0500651_0471109 3300053093 Bacteria 696
335 Ga0500650_0271564 3300053098 Bacteria 756
336 Ga0500562_029654 3300053108 Bacteria 1440
337 Ga0500595_000440 3300053119 Bacteria 25956
338 Ga0500642_0010462 3300053130 Bacteria 3272
339 Ga0500642_0243372 3300053130 Bacteria 828
340 Ga0500658_0001174 3300053134 Bacteria 10671
341 Ga0500658_0004018 3300053134 Bacteria 5525
342 Ga0500559_0273086 3300053136 Bacteria 795
343 Ga0500568_0153647 3300053139 Bacteria 851
344 Ga0500588_0076740 3300053146 Bacteria 1109
345 Ga0500616_0000385 3300053153 Bacteria 61815
346 Ga0500616_0028461 3300053153 Bacteria 3079
347 Ga0500620_038574 3300053155 Bacteria 1556
348 Ga0500636_0157454 3300053177 Bacteria 1242
349 Ga0500645_000116 3300053730 Bacteria 63698
350 Ga0500645_011629 3300053730 Bacteria 2867
351 Ga0500645_024482 3300053730 Bacteria 1846
352 Ga0500645_078250 3300053730 Bacteria 945
353 Ga0500552_003017 3300053733 Bacteria 1681
354 Ga0500596_001717 3300053735 Bacteria 4440
355 Ga0500661_045548 3300055283 Bacteria 780
356 Ga0587111_0023583 3300060346 Bacteria 1205

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053093 Ga0500651_0471109 Ga0500651_0471109_97_474 110
2 3300053733 Ga0500552_003017 Ga0500552_003017_169_546 110
3 iso_pu_bacteria 2751185897 2753765298 119
4 iso_pu_bacteria 2830075706 2830078642 119
5 iso_pu_bacteria 2885429604 2885431661 119
6 iso_pu_bacteria 2919138771 2919140170 119
7 iso_pu_bacteria 2928027323 2928028616 119
8 iso_pu_bacteria 2946787523 2946789321 119
9 iso_pu_bacteria 2984555340 2984555807 119
10 iso_pu_bacteria 2984564862 2984566083 119
11 iso_pu_bacteria 2993356040 2993357095 119
12 3300005530 Ga0070679_101765916 Ga0070679_1017659161 120
13 iso_pu_bacteria 2894772417 2894776453 120
14 3300001904 JGI24736J21556_1082574 JGI24736J21556_10825742 122
15 3300001979 JGI24740J21852_10017918 JGI24740J21852_100179182 122
16 3300001989 JGI24739J22299_10040369 JGI24739J22299_100403692 122
17 3300001990 JGI24737J22298_10019610 JGI24737J22298_100196102 122
18 3300001990 JGI24737J22298_10022475 JGI24737J22298_100224751 122
19 3300003187 JGI25151J46595_10013218 JGI25151J46595_100132182 122
20 3300003203 JGI25406J46586_10002442 JGI25406J46586_100024422 122
21 3300003214 JGI25165J46597_1000021 JGI25165J46597_100002127 122
22 3300003215 JGI25153J46596_10000021 JGI25153J46596_1000002137 122
23 3300003215 JGI25153J46596_10000028 JGI25153J46596_1000002863 122
24 3300003759 Ga0055525_1000070 Ga0055525_1000070109 122
25 3300003762 Ga0055542_1000102 Ga0055542_100010283 122
26 3300003763 Ga0055529_1000136 Ga0055529_100013671 122
27 3300003771 Ga0055526_1013144 Ga0055526_10131443 122
28 3300003773 Ga0055537_1001325 Ga0055537_10013254 122
29 3300003781 Ga0055536_1006520 Ga0055536_10065204 122
30 3300003792 Ga0055540_1001854 Ga0055540_10018543 122
31 3300005327 Ga0070658_10000611 Ga0070658_1000061125 122
32 3300005328 Ga0070676_10079851 Ga0070676_100798512 122
33 3300005331 Ga0070670_100639436 Ga0070670_1006394361 122
34 3300005331 Ga0070670_101569846 Ga0070670_1015698461 122
35 3300005338 Ga0068868_102301925 Ga0068868_1023019251 122
36 3300005339 Ga0070660_100135177 Ga0070660_1001351772 122
37 3300005339 Ga0070660_100393851 Ga0070660_1003938511 122
38 3300005344 Ga0070661_100010527 Ga0070661_1000105272 122
39 3300005353 Ga0070669_101385530 Ga0070669_1013855301 122
40 3300005356 Ga0070674_100009563 Ga0070674_1000095633 122
41 3300005356 Ga0070674_100037733 Ga0070674_1000377334 122
42 3300005364 Ga0070673_100074342 Ga0070673_1000743422 122
43 3300005364 Ga0070673_100242537 Ga0070673_1002425372 122
44 3300005364 Ga0070673_101827288 Ga0070673_1018272881 122
45 3300005366 Ga0070659_100221561 Ga0070659_1002215612 122
46 3300005366 Ga0070659_100224211 Ga0070659_1002242112 122
47 3300005456 Ga0070678_100001327 Ga0070678_1000013275 122
48 3300005456 Ga0070678_100149735 Ga0070678_1001497352 122
49 3300005457 Ga0070662_100204787 Ga0070662_1002047872 122
50 3300005457 Ga0070662_101519761 Ga0070662_1015197611 122
51 3300005459 Ga0068867_100069567 Ga0068867_1000695672 122
52 3300005459 Ga0068867_101598571 Ga0068867_1015985712 122
53 3300005518 Ga0070699_101220136 Ga0070699_1012201362 122
54 3300005530 Ga0070679_100352271 Ga0070679_1003522712 122
55 3300005548 Ga0070665_100000021 Ga0070665_100000021314 122
56 3300005548 Ga0070665_100745111 Ga0070665_1007451112 122
57 3300005548 Ga0070665_102189061 Ga0070665_1021890611 122
58 3300005563 Ga0068855_100042838 Ga0068855_1000428382 122
59 3300005563 Ga0068855_100449249 Ga0068855_1004492491 122
60 3300005564 Ga0070664_100029163 Ga0070664_1000291636 122
61 3300005578 Ga0068854_100030087 Ga0068854_1000300873 122
62 3300005578 Ga0068854_100703020 Ga0068854_1007030202 122
63 3300005616 Ga0068852_100854893 Ga0068852_1008548932 122
64 3300005616 Ga0068852_102056229 Ga0068852_1020562292 122
65 3300005618 Ga0068864_100001277 Ga0068864_10000127723 122
66 3300005718 Ga0068866_10690681 Ga0068866_106906811 122
67 3300005834 Ga0068851_10006971 Ga0068851_100069713 122
68 3300005841 Ga0068863_101624703 Ga0068863_1016247032 122
69 3300005842 Ga0068858_100000414 Ga0068858_10000041415 122
70 3300005842 Ga0068858_100022463 Ga0068858_1000224633 122
71 3300005985 Ga0081539_10008557 Ga0081539_100085576 122
72 3300005985 Ga0081539_10011926 Ga0081539_100119265 122
73 3300006038 Ga0075365_10361494 Ga0075365_103614942 122
74 3300006042 Ga0075368_10206535 Ga0075368_102065352 122
75 3300006178 Ga0075367_10104299 Ga0075367_101042992 122
76 3300006186 Ga0075369_10001315 Ga0075369_1000131510 122
77 3300006195 Ga0075366_10274983 Ga0075366_102749832 122
78 3300006237 Ga0097621_100081089 Ga0097621_1000810893 122
79 3300006237 Ga0097621_101170274 Ga0097621_1011702742 122
80 3300006353 Ga0075370_10388054 Ga0075370_103880542 122
81 3300006353 Ga0075370_10616605 Ga0075370_106166052 122
82 3300006358 Ga0068871_100293259 Ga0068871_1002932592 122
83 3300006931 Ga0097620_101757961 Ga0097620_1017579612 122
84 3300006946 Ga0079104_1050766 Ga0079104_10507662 122
85 3300006946 Ga0079104_1082942 Ga0079104_10829421 122
86 3300009098 Ga0105245_10000244 Ga0105245_1000024450 122
87 3300009148 Ga0105243_10000222 Ga0105243_100002222 122
88 3300009148 Ga0105243_10136744 Ga0105243_101367441 122
89 3300009174 Ga0105241_10089982 Ga0105241_100899822 122
90 3300009177 Ga0105248_10016890 Ga0105248_100168902 122
91 3300009177 Ga0105248_12176892 Ga0105248_121768921 122
92 3300009551 Ga0105238_10199322 Ga0105238_101993222 122
93 3300009551 Ga0105238_11522760 Ga0105238_115227601 122
94 3300009553 Ga0105249_10522567 Ga0105249_105225672 122
95 3300011119 Ga0105246_11279300 Ga0105246_112793002 122
96 3300012475 Ga0157317_1001872 Ga0157317_10018722 122
97 3300012503 Ga0157313_1006022 Ga0157313_10060222 122
98 3300013100 Ga0157373_10254339 Ga0157373_102543392 122
99 3300013100 Ga0157373_10929306 Ga0157373_109293061 122
100 3300013102 Ga0157371_10000066 Ga0157371_1000006671 122
101 3300013102 Ga0157371_10062008 Ga0157371_100620082 122
102 3300013102 Ga0157371_10100329 Ga0157371_101003292 122
103 3300013102 Ga0157371_11378562 Ga0157371_113785622 122
104 3300013104 Ga0157370_11649467 Ga0157370_116494672 122
105 3300013297 Ga0157378_10006170 Ga0157378_100061702 122
106 3300013297 Ga0157378_10130816 Ga0157378_101308162 122
107 3300013297 Ga0157378_11542118 Ga0157378_115421183 122
108 3300013297 Ga0157378_12295539 Ga0157378_122955391 122
109 3300013306 Ga0163162_10001705 Ga0163162_100017053 122
110 3300013306 Ga0163162_10114018 Ga0163162_101140182 122
111 3300013306 Ga0163162_10560843 Ga0163162_105608432 122
112 3300013306 Ga0163162_10884452 Ga0163162_108844522 122
113 3300013307 Ga0157372_10034904 Ga0157372_100349047 122
114 3300013307 Ga0157372_10043919 Ga0157372_100439192 122
115 3300013307 Ga0157372_10242215 Ga0157372_102422152 122
116 3300013308 Ga0157375_10841575 Ga0157375_108415751 122
117 3300014497 Ga0182008_10238772 Ga0182008_102387722 122
118 3300014497 Ga0182008_10736926 Ga0182008_107369261 122
119 3300014745 Ga0157377_10530607 Ga0157377_105306071 122
120 3300014968 Ga0157379_11688685 Ga0157379_116886852 122
121 3300014969 Ga0157376_13087523 Ga0157376_130875231 122
122 3300015690 Ga0183363_1007 Ga0183363_1007179 122
123 3300017792 Ga0163161_10023014 Ga0163161_100230147 122
124 3300020078 Ga0206352_11110008 Ga0206352_111100081 122
125 3300025230 Ga0209563_100053 Ga0209563_10005387 122
126 3300025233 Ga0209437_102200 Ga0209437_1022003 122
127 3300025245 Ga0207425_1000005 Ga0207425_100000563 122
128 3300025253 Ga0209677_104480 Ga0209677_1044805 122
129 3300025254 Ga0209148_1000159 Ga0209148_1000159105 122
130 3300025258 Ga0209129_1002321 Ga0209129_10023212 122
131 3300025261 Ga0209233_1000065 Ga0209233_100006526 122
132 3300025261 Ga0209233_1011101 Ga0209233_10111013 122
133 3300025263 Ga0209565_1000056 Ga0209565_100005624 122
134 3300025263 Ga0209565_1015778 Ga0209565_10157782 122
135 3300025272 Ga0209455_1000045 Ga0209455_100004538 122
136 3300025273 Ga0209673_1057283 Ga0209673_10572831 122
137 3300025273 Ga0209673_1063505 Ga0209673_10635052 122
138 3300025292 Ga0209676_1007393 Ga0209676_10073932 122
139 3300025294 Ga0209025_1000464 Ga0209025_100046436 122
140 3300025295 Ga0209564_1000899 Ga0209564_10008993 122
141 3300025297 Ga0209758_1000002 Ga0209758_10000021281 122
142 3300025297 Ga0209758_1000023 Ga0209758_1000023246 122
143 3300025298 Ga0209050_1000005 Ga0209050_1000005196 122
144 3300025303 Ga0209051_1000967 Ga0209051_100096710 122
145 3300025315 Ga0207697_10194690 Ga0207697_101946901 122
146 3300025321 Ga0207656_10036656 Ga0207656_100366562 122
147 3300025901 Ga0207688_10038358 Ga0207688_100383583 122
148 3300025901 Ga0207688_10232825 Ga0207688_102328252 122
149 3300025904 Ga0207647_10427153 Ga0207647_104271532 122
150 3300025907 Ga0207645_10163509 Ga0207645_101635092 122
151 3300025909 Ga0207705_10000523 Ga0207705_1000052319 122
152 3300025909 Ga0207705_10004430 Ga0207705_1000443011 122
153 3300025914 Ga0207671_10013543 Ga0207671_100135433 122
154 3300025919 Ga0207657_10005576 Ga0207657_100055763 122
155 3300025919 Ga0207657_10159747 Ga0207657_101597472 122
156 3300025919 Ga0207657_11463602 Ga0207657_114636021 122
157 3300025920 Ga0207649_10000069 Ga0207649_1000006952 122
158 3300025921 Ga0207652_10302481 Ga0207652_103024812 122
159 3300025924 Ga0207694_10005213 Ga0207694_100052138 122
160 3300025924 Ga0207694_10148963 Ga0207694_101489631 122
161 3300025925 Ga0207650_10564962 Ga0207650_105649621 122
162 3300025926 Ga0207659_10949832 Ga0207659_109498321 122
163 3300025927 Ga0207687_10006845 Ga0207687_100068452 122
164 3300025932 Ga0207690_10000846 Ga0207690_100008463 122
165 3300025933 Ga0207706_10034636 Ga0207706_100346363 122
166 3300025935 Ga0207709_10000047 Ga0207709_10000047154 122
167 3300025935 Ga0207709_10110421 Ga0207709_101104212 122
168 3300025937 Ga0207669_10000339 Ga0207669_100003393 122
169 3300025937 Ga0207669_10009784 Ga0207669_100097844 122
170 3300025938 Ga0207704_10336362 Ga0207704_103363622 122
171 3300025938 Ga0207704_10721449 Ga0207704_107214492 122
172 3300025940 Ga0207691_10591428 Ga0207691_105914282 122
173 3300025941 Ga0207711_10009724 Ga0207711_100097242 122
174 3300025945 Ga0207679_10021396 Ga0207679_100213964 122
175 3300025949 Ga0207667_10000001 Ga0207667_10000001104 122
176 3300025949 Ga0207667_10498220 Ga0207667_104982202 122
177 3300025960 Ga0207651_10425597 Ga0207651_104255972 122
178 3300025960 Ga0207651_11514227 Ga0207651_115142272 122
179 3300025981 Ga0207640_10001746 Ga0207640_100017462 122
180 3300025981 Ga0207640_10166312 Ga0207640_101663122 122
181 3300025986 Ga0207658_10023885 Ga0207658_100238853 122
182 3300026035 Ga0207703_10000634 Ga0207703_100006346 122
183 3300026035 Ga0207703_10011591 Ga0207703_100115913 122
184 3300026041 Ga0207639_10000379 Ga0207639_1000037919 122
185 3300026088 Ga0207641_11374751 Ga0207641_113747512 122
186 3300026089 Ga0207648_10308368 Ga0207648_103083682 122
187 3300026089 Ga0207648_10317315 Ga0207648_103173152 122
188 3300026095 Ga0207676_10056703 Ga0207676_100567033 122
189 3300026116 Ga0207674_10003949 Ga0207674_100039493 122
190 3300026118 Ga0207675_100338138 Ga0207675_1003381382 122
191 3300026121 Ga0207683_10048111 Ga0207683_100481111 122
192 3300026142 Ga0207698_10000220 Ga0207698_1000022019 122
193 3300026142 Ga0207698_10000605 Ga0207698_1000060517 122
194 3300026142 Ga0207698_10807956 Ga0207698_108079561 122
195 3300026142 Ga0207698_11828975 Ga0207698_118289751 122
196 3300027111 Ga0209281_1030505 Ga0209281_10305052 122
197 3300028379 Ga0268266_10000015 Ga0268266_10000015139 122
198 3300028379 Ga0268266_12016354 Ga0268266_120163542 122
199 3300028786 Ga0307517_10024002 Ga0307517_100240026 122
200 3300028786 Ga0307517_10060934 Ga0307517_100609343 122
201 3300028794 Ga0307515_10219553 Ga0307515_102195532 122
202 3300031247 Ga0265340_10078348 Ga0265340_100783482 122
203 3300031456 Ga0307513_10016183 Ga0307513_100161834 122
204 3300031507 Ga0307509_10363898 Ga0307509_103638982 122
205 3300031616 Ga0307508_10000810 Ga0307508_1000081022 122
206 3300031824 Ga0307413_11874683 Ga0307413_118746831 122
207 3300033180 Ga0307510_10048004 Ga0307510_100480043 122
208 3300033180 Ga0307510_10051823 Ga0307510_100518234 122
209 3300035171 Ga0373946_0300955 Ga0373946_0300955_145_522 122
210 3300038705 Ga0237819_00276 Ga0237819_00276_14239_14610 122
211 3300039145 Ga0237816_07754 Ga0237816_07754_122_493 122
212 3300039437 Ga0436365_0642857 Ga0436365_0642857_92_469 122
213 3300039450 Ga0436363_0921155 Ga0436363_0921155_445_822 122
214 3300039450 Ga0436363_1272908 Ga0436363_1272908_29_400 122
215 3300041410 Ga0439461_0005110 Ga0439461_0005110_807_1175 122
216 3300041443 Ga0451789_0625851 Ga0451789_0625851_21_389 122
217 3300041452 Ga0451793_1007654 Ga0451793_1007654_74_442 122
218 3300041453 Ga0451797_0332862 Ga0451797_0332862_116_484 122
219 3300041463 Ga0451804_0897421 Ga0451804_0897421_182_550 122
220 3300041505 Ga0451849_0946690 Ga0451849_0946690_184_555 122
221 3300041511 Ga0451855_0610982 Ga0451855_0610982_215_586 122
222 3300041997 Ga0439431_0011622 Ga0439431_0011622_671_1039 122
223 3300042010 Ga0439452_047438 Ga0439452_047438_142_510 122
224 3300042014 Ga0439457_005326 Ga0439457_005326_1253_1621 122
225 3300042015 Ga0439462_0154318 Ga0439462_0154318_92_460 122
226 3300042131 Ga0450894_004126 Ga0450894_004126_1080_1448 122
227 3300042145 Ga0450906_063717 Ga0450906_063717_179_547 122
228 3300042156 Ga0439446_0007575 Ga0439446_0007575_21_389 122
229 3300042435 Ga0439434_0008271 Ga0439434_0008271_975_1343 122
230 3300046460 Ga0495638_0000481 Ga0495638_0000481_21104_21475 122
231 3300046460 Ga0495638_0577842 Ga0495638_0577842_50_418 122
232 3300046471 Ga0495650_0000491 Ga0495650_0000491_31779_32147 122
233 3300046491 Ga0495584_0190565 Ga0495584_0190565_408_776 122
234 3300046492 Ga0495585_0015386 Ga0495585_0015386_2818_3186 122
235 3300046492 Ga0495585_0144418 Ga0495585_0144418_492_863 122
236 3300046500 Ga0495596_0027174 Ga0495596_0027174_875_1243 122
237 3300046506 Ga0495583_0003992 Ga0495583_0003992_2566_2934 122
238 3300046506 Ga0495583_0044206 Ga0495583_0044206_1667_2035 122
239 3300046506 Ga0495583_0062892 Ga0495583_0062892_70_438 122
240 3300046506 Ga0495583_0129419 Ga0495583_0129419_542_913 122
241 3300046507 Ga0495606_0000379 Ga0495606_0000379_27497_27865 122
242 3300046507 Ga0495606_0117246 Ga0495606_0117246_865_1233 122
243 3300046513 Ga0495616_0336604 Ga0495616_0336604_16_384 122
244 3300046518 Ga0495631_0018789 Ga0495631_0018789_2835_3203 122
245 3300046518 Ga0495631_0402014 Ga0495631_0402014_15_383 122
246 3300046520 Ga0495637_0077865 Ga0495637_0077865_465_860 122
247 3300046522 Ga0495643_0038387 Ga0495643_0038387_993_1361 122
248 3300046522 Ga0495643_0081417 Ga0495643_0081417_70_438 122
249 3300046522 Ga0495643_0113703 Ga0495643_0113703_825_1196 122
250 3300046524 Ga0495648_0012527 Ga0495648_0012527_5894_6262 122
251 3300046524 Ga0495648_0019397 Ga0495648_0019397_1694_2065 122
252 3300046524 Ga0495648_0063298 Ga0495648_0063298_1430_1801 122
253 3300046524 Ga0495648_0430828 Ga0495648_0430828_159_527 122
254 3300046525 Ga0495663_0005640 Ga0495663_0005640_2133_2501 122
255 3300046526 Ga0495666_0341404 Ga0495666_0341404_99_470 122
256 3300046528 Ga0495642_0063488 Ga0495642_0063488_71_439 122
257 3300046536 Ga0495587_0149162 Ga0495587_0149162_868_1236 122
258 3300046542 Ga0495597_0071135 Ga0495597_0071135_703_1071 122
259 3300046542 Ga0495597_0350082 Ga0495597_0350082_44_439 122
260 3300046557 Ga0495622_0080776 Ga0495622_0080776_853_1221 122
261 3300046558 Ga0495633_0000758 Ga0495633_0000758_19038_19406 122
262 3300046558 Ga0495633_0152431 Ga0495633_0152431_514_882 122
263 3300046616 Ga0495668_0000548 Ga0495668_0000548_15513_15881 122
264 3300046616 Ga0495668_0179476 Ga0495668_0179476_225_593 122
265 3300046660 Ga0495625_0000112 Ga0495625_0000112_25303_25698 122
266 3300046660 Ga0495625_0000757 Ga0495625_0000757_1997_2365 122
267 3300046660 Ga0495625_0009826 Ga0495625_0009826_5768_6136 122
268 3300046660 Ga0495625_0098392 Ga0495625_0098392_1528_1899 122
269 3300046660 Ga0495625_0117561 Ga0495625_0117561_593_961 122
270 3300046660 Ga0495625_0151277 Ga0495625_0151277_1066_1434 122
271 3300046660 Ga0495625_0350012 Ga0495625_0350012_140_508 122
272 3300046684 Ga0495669_0000378 Ga0495669_0000378_76_444 122
273 3300046691 Ga0495670_0183182 Ga0495670_0183182_509_877 122
274 3300046691 Ga0495670_0392439 Ga0495670_0392439_52_423 122
275 3300046692 Ga0495671_0613580 Ga0495671_0613580_62_430 122
276 3300046694 Ga0495649_0188259 Ga0495649_0188259_650_1018 122
277 3300046694 Ga0495649_0311317 Ga0495649_0311317_375_743 122
278 3300046809 Ga0495600_0001428 Ga0495600_0001428_3953_4321 122
279 3300046810 Ga0495660_0104340 Ga0495660_0104340_630_998 122
280 3300047318 Ga0495636_0414743 Ga0495636_0414743_40_408 122
281 3300047323 Ga0495683_0018676 Ga0495683_0018676_2567_2935 122
282 3300047323 Ga0495683_0084157 Ga0495683_0084157_79_447 122
283 3300047443 Ga0495687_000192 Ga0495687_000192_42223_42591 122
284 3300047443 Ga0495687_000611 Ga0495687_000611_11475_11843 122
285 3300047445 Ga0495677_0016311 Ga0495677_0016311_1348_1719 122
286 3300047445 Ga0495677_0027315 Ga0495677_0027315_899_1267 122
287 3300047469 Ga0495673_0103332 Ga0495673_0103332_157_525 122
288 3300047470 Ga0495681_0019613 Ga0495681_0019613_1786_2154 122
289 3300047470 Ga0495681_0115729 Ga0495681_0115729_41_409 122
290 3300047472 Ga0495686_0001111 Ga0495686_0001111_12526_12894 122
291 3300047472 Ga0495686_0011788 Ga0495686_0011788_80_451 122
292 3300048904 Ga0496101_0585848 Ga0496101_0585848_416_787 122
293 3300048905 Ga0496102_0000435 Ga0496102_0000435_45826_46194 122
294 3300048905 Ga0496102_0103865 Ga0496102_0103865_723_1094 122
295 3300048906 Ga0496103_0000177 Ga0496103_0000177_18395_18763 122
296 3300048907 Ga0496104_0039847 Ga0496104_0039847_2804_3172 122
297 3300048908 Ga0496105_0000159 Ga0496105_0000159_9759_10127 122
298 3300048912 Ga0496109_0728243 Ga0496109_0728243_523_891 122
299 3300048913 Ga0496110_0325432 Ga0496110_0325432_838_1206 122
300 3300048914 Ga0496111_0015596 Ga0496111_0015596_434_802 122
301 3300048917 Ga0496114_0006747 Ga0496114_0006747_7161_7529 122
302 3300048918 Ga0496115_0000410 Ga0496115_0000410_14681_15049 122
303 3300048919 Ga0496116_0020947 Ga0496116_0020947_1521_1889 122
304 3300048920 Ga0496117_0004031 Ga0496117_0004031_1531_1899 122
305 3300048921 Ga0496118_0000850 Ga0496118_0000850_46580_46948 122
306 3300048921 Ga0496118_0422007 Ga0496118_0422007_176_547 122
307 3300048922 Ga0496119_0019836 Ga0496119_0019836_4338_4706 122
308 3300048923 Ga0496120_0022294 Ga0496120_0022294_1215_1583 122
309 3300048924 Ga0496121_0000580 Ga0496121_0000580_10557_10928 122
310 3300048924 Ga0496121_0002231 Ga0496121_0002231_28334_28702 122
311 3300048924 Ga0496121_0170581 Ga0496121_0170581_1077_1448 122
312 3300048925 Ga0496122_0102476 Ga0496122_0102476_30_398 122
313 3300048925 Ga0496122_0365417 Ga0496122_0365417_55_426 122
314 3300048926 Ga0496123_0085682 Ga0496123_0085682_1483_1851 122
315 3300048927 Ga0496124_0004357 Ga0496124_0004357_14683_15051 122
316 3300048928 Ga0496125_0118781 Ga0496125_0118781_1508_1876 122
317 3300048929 Ga0496126_0004511 Ga0496126_0004511_1527_1895 122
318 3300049569 Ga0501032_0648407 Ga0501032_0648407_280_654 122
319 3300049579 Ga0501043_0270158 Ga0501043_0270158_359_733 122
320 3300049580 Ga0501046_1176798 Ga0501046_1176798_101_472 122
321 3300049581 Ga0501047_1142425 Ga0501047_1142425_169_543 122
322 3300049586 Ga0501070_1272736 Ga0501070_1272736_147_518 122
323 3300049587 Ga0501071_0129371 Ga0501071_0129371_893_1288 122
324 3300049590 Ga0501074_0746602 Ga0501074_0746602_64_438 122
325 3300049822 Ga0501035_0450297 Ga0501035_0450297_660_1034 122
326 3300049822 Ga0501035_0828447 Ga0501035_0828447_298_669 122
327 3300049823 Ga0501044_0112869 Ga0501044_0112869_1032_1403 122
328 3300049823 Ga0501044_0230571 Ga0501044_0230571_895_1269 122
329 3300049823 Ga0501044_0931260 Ga0501044_0931260_273_644 122
330 3300050489 nmdc:mga03683_222411_c1 nmdc:mga03683_222411_c1_301_678 122
331 3300050492 nmdc:mga0yw44_17375_c1 nmdc:mga0yw44_17375_c1_125_502 122
332 3300050492 nmdc:mga0yw44_381547_c1 nmdc:mga0yw44_381547_c1_220_597 122
333 3300050493 nmdc:mga0k408_388994_c1 nmdc:mga0k408_388994_c1_222_599 122
334 3300050494 nmdc:mga06z11_97344_c1 nmdc:mga06z11_97344_c1_1157_1534 122
335 3300050495 nmdc:mga04h51_75144_c1 nmdc:mga04h51_75144_c1_80_457 122
336 3300050496 nmdc:mga07m45_316914_c1 nmdc:mga07m45_316914_c1_169_546 122
337 3300050496 nmdc:mga07m45_413910_c1 nmdc:mga07m45_413910_c1_220_597 122
338 3300050516 nmdc:mga0sz30_14056_c2 nmdc:mga0sz30_14056_c2_1052_1429 122
339 3300053079 Ga0500610_0000059 Ga0500610_0000059_2299_2667 122
340 3300053087 Ga0500643_009135 Ga0500643_009135_1366_1737 122
341 3300053087 Ga0500643_012835 Ga0500643_012835_2599_2967 122
342 3300053087 Ga0500643_017703 Ga0500643_017703_1366_1737 122
343 3300053087 Ga0500643_023291 Ga0500643_023291_1509_1880 122
344 3300053087 Ga0500643_025282 Ga0500643_025282_102_470 122
345 3300053092 Ga0500583_0103825 Ga0500583_0103825_983_1351 122
346 3300053098 Ga0500650_0271564 Ga0500650_0271564_57_434 122
347 3300053108 Ga0500562_029654 Ga0500562_029654_219_614 122
348 3300053119 Ga0500595_000440 Ga0500595_000440_11626_11994 122
349 3300053130 Ga0500642_0010462 Ga0500642_0010462_1524_1892 122
350 3300053130 Ga0500642_0243372 Ga0500642_0243372_133_510 122
351 3300053134 Ga0500658_0001174 Ga0500658_0001174_2594_2965 122
352 3300053134 Ga0500658_0004018 Ga0500658_0004018_2183_2551 122
353 3300053136 Ga0500559_0273086 Ga0500559_0273086_85_456 122
354 3300053139 Ga0500568_0153647 Ga0500568_0153647_79_447 122
355 3300053146 Ga0500588_0076740 Ga0500588_0076740_521_916 122
356 3300053153 Ga0500616_0000385 Ga0500616_0000385_16203_16580 122
357 3300053153 Ga0500616_0028461 Ga0500616_0028461_772_1167 122
358 3300053155 Ga0500620_038574 Ga0500620_038574_944_1321 122
359 3300053177 Ga0500636_0157454 Ga0500636_0157454_185_556 122
360 3300053730 Ga0500645_000116 Ga0500645_000116_42187_42555 122
361 3300053730 Ga0500645_011629 Ga0500645_011629_210_581 122
362 3300053730 Ga0500645_024482 Ga0500645_024482_561_932 122
363 3300053730 Ga0500645_078250 Ga0500645_078250_292_663 122
364 3300053735 Ga0500596_001717 Ga0500596_001717_1071_1439 122
365 3300055283 Ga0500661_045548 Ga0500661_045548_111_479 122
366 3300060346 Ga0587111_0023583 Ga0587111_0023583_267_635 122

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01597

GCV_H

Glycine cleavage H-protein

4

112

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wdn-assembly1.cif.gz_A high-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method 0.9863 1 121
1htp-assembly1.cif.gz_A refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex 0.9861 2 121
1zko-assembly1.cif.gz_A crystal structure of glycine cleavage system h protein (tm0212) from thermotoga maritima at 1.65 a resolution 0.9849 1 120
1onl-assembly3.cif.gz_C crystal structure of thermus thermophilus hb8 h-protein of the glycine cleavage system 0.9726 2 121
3wdn-assembly1.cif.gz_A high-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method 0.9705 1 121
ID Description Score Start End Superfamily
af_Q20634_6_139_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9888 2 118 2.40.50.100
3wdnA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9864 1 121 2.40.50.100
af_Q9U616_24_160_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9789 2 119 2.40.50.100
3wdnA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9705 1 121 2.40.50.100
af_K7TZ76_31_128_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9702 32 122 2.40.50.100
ID Description Score Start End GO Terms
AF-Q70J57-F1-model_v4 Glycine cleavage system H protein 0.9951 2 120 GO:0005739
GO:0005960
GO:0019464
AF-A0A1S8VW58-F1-model_v4 deleted 0.994 2 119
AF-A0A0R3PSR4-F1-model_v4 Glycine cleavage system H protein 0.994 2 121 GO:0005739
GO:0005960
GO:0019464
AF-A0A432VJA8-F1-model_v4 Glycine cleavage system H protein 0.9938 2 122 GO:0005737
GO:0005960
GO:0019464
AF-A0A0N5CY93-F1-model_v4 Glycine cleavage system H protein 0.9938 2 120 GO:0005739
GO:0005960
GO:0019464

Feature Viewer

pLDDT pTM Quality
97.83 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map