F424216

General Info

Members Datasets Scaffolds Average Seq Length
367 232 734 414

Family's Representative Sequence

Representative Sequence 3300003203|JGI25406J46586_10000156|JGI25406J46586_1000015628
Length 452
Sequence MMDTGGGVNSAPRAPHLLFLTIGTGGNRTALENERLIFTPFERAVAFRYLRARKGERFVSVIAIFSLVGIGLGVATLIIVMSVMNGFRQELLSRILGLNGHIGVYATXGPLRDFDPIAERIRTLPGVVSATPVVEGQVLMTSEGGGATGGLARGVRPEDLRARAIIADNIRSGSLEDFHGEDAIVIGIRLANRMRVNIGDQITLVSPQGRTTVFGTVPRVRAYTVVAMYEVGMQEYDGSFAFLPLEAAQIYFQQRDAVTQVEVFVQDPTRVREAMREIRNALPGQPLNIISWESANSSFFNAVQVERNVMFLILTLIIVVAAFNIISSLIMLVKDKGKDIAILRTMGATRGAVMRIFLLCGASVGVVGTAAGFLLGLVFCWNIESIRQALQALSGTELFSPEVYFLTRLPAVVDYHEVVQVVGMGLGLSLLATLYPSWRAAKTDPVEMLRSE

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
69 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
70 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
71 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
72 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
73 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
74 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
75 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
104 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
105 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
106 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
107 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
109 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
110 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
111 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
117 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
124 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
125 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
126 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
127 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
135 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
136 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
137 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
138 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
139 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
142 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
143 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
144 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
145 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
146 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
147 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
148 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
149 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
150 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
151 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
152 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
155 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
158 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
159 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
160 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
161 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
162 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
163 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
176 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
177 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
178 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
179 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
180 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
181 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
184 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
185 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
198 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
199 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
200 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
201 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
202 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
203 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
204 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
205 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
206 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
207 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
208 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
209 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
210 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
211 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
212 2643221659 Ensifer sp. Root127 Isolate Unclassified
213 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
214 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
215 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
216 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
217 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
218 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
219 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
220 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
221 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
222 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
223 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
224 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
225 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
226 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
227 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
228 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
229 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
230 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
231 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
232 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.64
Metatranscriptomes 0.27
Isolates 7.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.72
Nodule 0.54
Rhizoplane 0.27
Rhizosphere 80.38
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000156 3300003203 Bacteria 30235
2 JGI25162J39368_1000696 3300002737 Bacteria 23379
3 JGI25158J39367_1000077 3300002739 Bacteria 22544
4 JGI25152J39213_1000376 3300002773 Bacteria 27463
5 JGI25151J46595_10000465 3300003187 Bacteria 38708
6 JGI25151J46595_10003605 3300003187 Bacteria 8472
7 JGI25406J46586_10008619 3300003203 Bacteria 4607
8 JGI25165J46597_1002868 3300003214 Bacteria 4920
9 JGI25405J52794_10003972 3300003911 Bacteria 2619
10 Ga0065165_1003662 3300005262 Bacteria 10490
11 Ga0070658_10046014 3300005327 Bacteria 3530
12 Ga0070683_100018580 3300005329 Bacteria 6162
13 Ga0070683_100059888 3300005329 Bacteria 3537
14 Ga0070683_100061595 3300005329 Bacteria 3489
15 Ga0068869_100042053 3300005334 Bacteria 3275
16 Ga0070666_10012146 3300005335 Bacteria 5425
17 Ga0070660_100058095 3300005339 Bacteria 2999
18 Ga0070661_100085600 3300005344 Bacteria 2330
19 Ga0070674_100007225 3300005356 Bacteria 6538
20 Ga0070688_100128472 3300005365 Bacteria 1706
21 Ga0070667_100028660 3300005367 Bacteria 4637
22 Ga0070694_100029184 3300005444 Bacteria 3598
23 Ga0070678_100113989 3300005456 Bacteria 2120
24 Ga0070681_10001858 3300005458 Bacteria 19063
25 Ga0070681_10044261 3300005458 Bacteria 4455
26 Ga0070706_100028310 3300005467 Bacteria 5159
27 Ga0070706_100064153 3300005467 Bacteria 3395
28 Ga0070698_100101725 3300005471 Bacteria 2845
29 Ga0070679_100001956 3300005530 Bacteria 18491
30 Ga0070684_100079941 3300005535 Bacteria 2891
31 Ga0068853_100077618 3300005539 Bacteria 2901
32 Ga0068853_100192004 3300005539 Bacteria 1856
33 Ga0068853_100226989 3300005539 Bacteria 1707
34 Ga0070695_100032586 3300005545 Bacteria 3258
35 Ga0070696_100166893 3300005546 Bacteria 1625
36 Ga0070696_100167628 3300005546 Bacteria 1622
37 Ga0068855_100135365 3300005563 Bacteria 2811
38 Ga0068856_100052991 3300005614 Bacteria 4002
39 Ga0068856_100122031 3300005614 Bacteria 2608
40 Ga0068852_100077434 3300005616 Bacteria 2940
41 Ga0068859_100251539 3300005617 Bacteria 1858
42 Ga0068858_100061148 3300005842 Bacteria 3481
43 Ga0081455_10006033 3300005937 Bacteria 13120
44 Ga0081455_10075985 3300005937 Bacteria 2769
45 Ga0081538_10002356 3300005981 Bacteria 18584
46 Ga0081538_10025104 3300005981 Bacteria 4217
47 Ga0081540_1000194 3300005983 Bacteria 62934
48 Ga0081539_10000076 3300005985 Bacteria 229037
49 Ga0081539_10001574 3300005985 Bacteria 37718
50 Ga0081539_10092193 3300005985 Bacteria 1563
51 Ga0070717_10088739 3300006028 Bacteria 2607
52 Ga0070717_10241517 3300006028 Bacteria 1593
53 Ga0075368_10007515 3300006042 Bacteria 3845
54 Ga0075363_100021746 3300006048 Bacteria 3236
55 Ga0070712_100001398 3300006175 Bacteria 14669
56 Ga0075366_10049573 3300006195 Bacteria 2491
57 Ga0097621_100000211 3300006237 Bacteria 38289
58 Ga0068871_100015577 3300006358 Bacteria 5696
59 Ga0068871_100024205 3300006358 Bacteria 4705
60 Ga0075434_100007911 3300006871 Bacteria 9852
61 Ga0075436_100047761 3300006914 Bacteria 2953
62 Ga0097620_100251558 3300006931 Bacteria 1858
63 Ga0105240_10110069 3300009093 Bacteria 3335
64 Ga0105240_10129768 3300009093 Bacteria 3025
65 Ga0111539_10000337 3300009094 Bacteria 57733
66 Ga0111539_10149417 3300009094 Bacteria 2735
67 Ga0111539_10225961 3300009094 Bacteria 2180
68 Ga0105245_10007149 3300009098 Bacteria 9790
69 Ga0105245_10126099 3300009098 Bacteria 2397
70 Ga0114129_10003247 3300009147 Bacteria 22816
71 Ga0105241_10027967 3300009174 Bacteria 4199
72 Ga0105241_10029960 3300009174 Bacteria 4064
73 Ga0105242_10048531 3300009176 Bacteria 3451
74 Ga0105248_10017001 3300009177 Bacteria 8011
75 Ga0105248_10038968 3300009177 Bacteria 5321
76 Ga0105237_10075359 3300009545 Bacteria 3365
77 Ga0105238_10032692 3300009551 Bacteria 5294
78 Ga0105238_10045293 3300009551 Bacteria 4444
79 Ga0105238_10057128 3300009551 Bacteria 3913
80 Ga0105239_10309290 3300010375 Bacteria 1781
81 Ga0105246_10037945 3300011119 Bacteria 3236
82 Ga0157370_10020535 3300013104 Bacteria 6594
83 Ga0157369_10002835 3300013105 Bacteria 20690
84 Ga0157369_10038375 3300013105 Bacteria 5237
85 Ga0157369_10053138 3300013105 Bacteria 4380
86 Ga0157369_10391030 3300013105 Bacteria 1443
87 Ga0157374_10061633 3300013296 Bacteria 3514
88 Ga0157378_10041956 3300013297 Bacteria 4060
89 Ga0157378_10128863 3300013297 Bacteria 2340
90 Ga0157378_10426734 3300013297 Bacteria 1311
91 Ga0163162_10156473 3300013306 Bacteria 2399
92 Ga0163162_10254719 3300013306 Bacteria 1887
93 Ga0157375_10010463 3300013308 Bacteria 8164
94 Ga0163163_10114886 3300014325 Bacteria 2723
95 Ga0163163_10134635 3300014325 Bacteria 2512
96 Ga0157379_10090761 3300014968 Bacteria 2741
97 Ga0157379_10098816 3300014968 Bacteria 2620
98 Ga0157379_10104802 3300014968 Bacteria 2538
99 Ga0157376_10017114 3300014969 Bacteria 5522
100 Ga0157376_10121527 3300014969 Bacteria 2315
101 Ga0163161_10127682 3300017792 Bacteria 1916
102 Ga0213872_10009317 3300021361 Bacteria 4712
103 Ga0213875_10000530 3300021388 Bacteria 31543
104 Ga0213875_10001741 3300021388 Bacteria 13635
105 Ga0213875_10003559 3300021388 Bacteria 8840
106 Ga0213875_10016752 3300021388 Bacteria 3549
107 Ga0209437_100023 3300025233 Bacteria 614195
108 Ga0209233_1000062 3300025261 Bacteria 399685
109 Ga0209130_1000167 3300025284 Bacteria 95517
110 Ga0209025_1000077 3300025294 Bacteria 271958
111 Ga0209025_1000188 3300025294 Bacteria 154209
112 Ga0209758_1007903 3300025297 Bacteria 7063
113 Ga0207426_1000239 3300025302 Bacteria 123307
114 Ga0207688_10073139 3300025901 Bacteria 1948
115 Ga0207680_10032044 3300025903 Bacteria 2983
116 Ga0207647_10112542 3300025904 Bacteria 1609
117 Ga0207707_10022751 3300025912 Bacteria 5481
118 Ga0207707_10130192 3300025912 Bacteria 2201
119 Ga0207707_10206800 3300025912 Bacteria 1711
120 Ga0207695_10120505 3300025913 Bacteria 2592
121 Ga0207693_10003439 3300025915 Bacteria 13511
122 Ga0207657_10007135 3300025919 Bacteria 11475
123 Ga0207652_10043220 3300025921 Bacteria 3837
124 Ga0207659_10281842 3300025926 Bacteria 1359
125 Ga0207687_10082664 3300025927 Bacteria 2324
126 Ga0207700_10085284 3300025928 Bacteria 2479
127 Ga0207706_10144225 3300025933 Bacteria 2095
128 Ga0207686_10017974 3300025934 Bacteria 3995
129 Ga0207686_10025804 3300025934 Bacteria 3423
130 Ga0207711_10029220 3300025941 Bacteria 4647
131 Ga0207661_10036678 3300025944 Bacteria 3829
132 Ga0207658_10081440 3300025986 Bacteria 2482
133 Ga0207677_10098991 3300026023 Bacteria 2140
134 Ga0207677_10137729 3300026023 Bacteria 1864
135 Ga0207703_10087580 3300026035 Bacteria 2611
136 Ga0207639_10116903 3300026041 Bacteria 2184
137 Ga0207678_10032829 3300026067 Bacteria 4524
138 Ga0207678_10064988 3300026067 Bacteria 3134
139 Ga0207702_10035333 3300026078 Bacteria 4179
140 Ga0207702_10165115 3300026078 Bacteria 2025
141 Ga0207641_10021216 3300026088 Bacteria 5339
142 Ga0207648_10009980 3300026089 Bacteria 9037
143 Ga0207676_10149789 3300026095 Bacteria 2008
144 Ga0207676_10305339 3300026095 Bacteria 1454
145 Ga0207683_10027589 3300026121 Bacteria 4906
146 Ga0207683_10042725 3300026121 Bacteria 3959
147 Ga0207428_10051970 3300027907 Bacteria 3274
148 Ga0268266_10016716 3300028379 Bacteria 6272
149 Ga0268266_10023965 3300028379 Bacteria 5193
150 Ga0268266_10040266 3300028379 Bacteria 3982
151 Ga0268266_10176909 3300028379 Bacteria 1940
152 Ga0265334_10019298 3300028573 Bacteria 2807
153 Ga0307515_10000070 3300028794 Bacteria 239322
154 Ga0265338_10011285 3300028800 Bacteria 10339
155 Ga0265338_10071569 3300028800 Bacteria 2965
156 Ga0265324_10013177 3300029957 Bacteria 3090
157 Ga0265760_10005736 3300031090 Bacteria 3550
158 Ga0265330_10053851 3300031235 Bacteria 1760
159 Ga0265332_10056944 3300031238 Bacteria 1675
160 Ga0265331_10076516 3300031250 Bacteria 1559
161 Ga0265327_10046268 3300031251 Bacteria 2305
162 Ga0265316_10068856 3300031344 Bacteria 2732
163 Ga0265316_10133643 3300031344 Bacteria 1867
164 Ga0307408_100107326 3300031548 Bacteria 2138
165 Ga0265313_10009216 3300031595 Bacteria 6436
166 Ga0265314_10014552 3300031711 Bacteria 6286
167 Ga0265314_10041274 3300031711 Bacteria 3304
168 Ga0265314_10046286 3300031711 Bacteria 3070
169 Ga0265314_10055819 3300031711 Bacteria 2723
170 Ga0316576_10067200 3300031727 Bacteria 2639
171 Ga0316578_10002302 3300031728 Bacteria 8303
172 Ga0307413_10019707 3300031824 Bacteria 3571
173 Ga0307407_10036947 3300031903 Bacteria 2695
174 Ga0307412_10109451 3300031911 Bacteria 1970
175 Ga0307409_100008031 3300031995 Bacteria 6364
176 Ga0307411_10007231 3300032005 Bacteria 5632
177 Ga0373953_0052803 3300035117 Bacteria 1646
178 Ga0373954_0011468 3300035118 Bacteria 3928
179 Ga0373946_0023185 3300035171 Bacteria 2423
180 Ga0316574_0003278 3300035398 Bacteria 8320
181 Ga0316574_0012298 3300035398 Bacteria 4893
182 Ga0373933_0002645 3300035724 Bacteria 10030
183 Ga0373933_0040010 3300035724 Bacteria 2760
184 Ga0373937_0001341 3300036401 Bacteria 20589
185 Ga0373937_0023418 3300036401 Bacteria 5560
186 Ga0373937_0097238 3300036401 Bacteria 2731
187 Ga0316584_0013044 3300036712 Bacteria 5873
188 Ga0373925_0147751 3300037068 Bacteria 1843
189 Ga0395905_0007381 3300037471 Bacteria 10935
190 Ga0395905_0067081 3300037471 Bacteria 3360
191 Ga0436364_0022735 3300037853 Bacteria 162985
192 Ga0436364_0966921 3300037853 Bacteria 12120
193 Ga0436364_1129754 3300037853 Bacteria 7608
194 Ga0436364_1184534 3300037853 Bacteria 3466
195 Ga0436364_1561563 3300037853 Bacteria 23976
196 Ga0436365_0816294 3300039437 Bacteria 10089
197 Ga0436360_0954632 3300039438 Bacteria 3721
198 Ga0436360_1228146 3300039438 Bacteria 3464
199 Ga0436360_1275743 3300039438 Bacteria 6530
200 Ga0436361_0215588 3300039447 Bacteria 45530
201 Ga0436361_0276378 3300039447 Bacteria 4221
202 Ga0436361_0300922 3300039447 Bacteria 11064
203 Ga0436361_0378965 3300039447 Bacteria 5108
204 Ga0436363_0601770 3300039450 Bacteria 1673
205 Ga0436363_1258587 3300039450 Bacteria 2581
206 Ga0436362_0802871 3300039453 Bacteria 7529
207 Ga0453683_0022538 3300044673 Bacteria 4018
208 Ga0453684_0000006 3300044712 Bacteria 1364191
209 Ga0453684_0000410 3300044712 Bacteria 175627
210 Ga0453684_0210342 3300044712 Bacteria 2261
211 Ga0451576_0001017 3300045051 Bacteria 51874
212 Ga0451576_0013388 3300045051 Bacteria 9177
213 Ga0451576_0087854 3300045051 Bacteria 3233
214 Ga0495617_018445 3300046452 Bacteria 2360
215 Ga0495592_0164232 3300046454 Bacteria 1525
216 Ga0495629_0086342 3300046459 Bacteria 2189
217 Ga0495580_0013337 3300046472 Bacteria 6278
218 Ga0495580_0049145 3300046472 Bacteria 2985
219 Ga0495582_0004012 3300046473 Bacteria 8264
220 Ga0495662_0087556 3300046476 Bacteria 1517
221 Ga0495585_0062131 3300046492 Bacteria 2052
222 Ga0495608_0163242 3300046511 Bacteria 1416
223 Ga0495610_0020976 3300046512 Bacteria 3606
224 Ga0495610_0025598 3300046512 Bacteria 3163
225 Ga0495610_0069065 3300046512 Bacteria 1654
226 Ga0495618_0090401 3300046514 Bacteria 1958
227 Ga0495622_0007824 3300046557 Bacteria 4963
228 Ga0495658_0016812 3300046683 Bacteria 3769
229 Ga0495674_0075331 3300047319 Bacteria 2904
230 Ga0495672_0031526 3300047320 Bacteria 3309
231 Ga0495673_0019955 3300047469 Bacteria 3348
232 Ga0495684_0039883 3300047471 Bacteria 3600
233 Ga0496101_0032518 3300048904 Bacteria 3673
234 Ga0496117_0006248 3300048920 Bacteria 12145
235 Ga0496122_0000883 3300048925 Bacteria 55831
236 Ga0496122_0004624 3300048925 Bacteria 16932
237 Ga0496123_0001542 3300048926 Bacteria 31818
238 Ga0496125_0000889 3300048928 Bacteria 47420
239 Ga0496125_0124109 3300048928 Bacteria 1834
240 Ga0496126_0028792 3300048929 Bacteria 5286
241 Ga0501031_0182622 3300049568 Bacteria 1370
242 Ga0501032_0010121 3300049569 Bacteria 6806
243 Ga0501032_0026837 3300049569 Bacteria 3959
244 Ga0501033_0002052 3300049570 Bacteria 17521
245 Ga0501033_0008858 3300049570 Bacteria 7773
246 Ga0501033_0076068 3300049570 Bacteria 2464
247 Ga0501034_0010929 3300049571 Bacteria 9433
248 Ga0501034_0075820 3300049571 Bacteria 3370
249 Ga0501034_0379762 3300049571 Bacteria 1338
250 Ga0501037_0000227 3300049573 Bacteria 49134
251 Ga0501037_0004512 3300049573 Bacteria 10116
252 Ga0501038_0003682 3300049574 Bacteria 14277
253 Ga0501039_0002395 3300049575 Bacteria 13948
254 Ga0501039_0077286 3300049575 Bacteria 2589
255 Ga0501041_0054503 3300049577 Bacteria 2439
256 Ga0501043_0000396 3300049579 Bacteria 39180
257 Ga0501043_0001899 3300049579 Bacteria 17912
258 Ga0501043_0013980 3300049579 Bacteria 6281
259 Ga0501043_0041418 3300049579 Bacteria 3619
260 Ga0501043_0137352 3300049579 Bacteria 1915
261 Ga0501046_0001214 3300049580 Bacteria 24970
262 Ga0501046_0146849 3300049580 Bacteria 1781
263 Ga0501047_0017198 3300049581 Bacteria 6922
264 Ga0501047_0028841 3300049581 Bacteria 5354
265 Ga0501047_0036340 3300049581 Bacteria 4761
266 Ga0501047_0078442 3300049581 Bacteria 3176
267 Ga0501047_0191927 3300049581 Bacteria 1906
268 Ga0501047_0275155 3300049581 Bacteria 1529
269 Ga0501048_0158690 3300049582 Bacteria 1600
270 Ga0501067_0042158 3300049583 Bacteria 2534
271 Ga0501067_0067736 3300049583 Bacteria 1977
272 Ga0501068_0021019 3300049584 Bacteria 3809
273 Ga0501069_0000066 3300049585 Bacteria 55164
274 Ga0501069_0000068 3300049585 Bacteria 54324
275 Ga0501069_0010778 3300049585 Bacteria 4846
276 Ga0501069_0025450 3300049585 Bacteria 3235
277 Ga0501070_0005111 3300049586 Bacteria 11184
278 Ga0501070_0006143 3300049586 Bacteria 10240
279 Ga0501070_0067783 3300049586 Bacteria 2955
280 Ga0501070_0071849 3300049586 Bacteria 2865
281 Ga0501070_0113872 3300049586 Bacteria 2234
282 Ga0501071_0011166 3300049587 Bacteria 6041
283 Ga0501072_0068103 3300049588 Bacteria 2810
284 Ga0501072_0124267 3300049588 Bacteria 2056
285 Ga0501073_0001156 3300049589 Bacteria 19243
286 Ga0501073_0023833 3300049589 Bacteria 4395
287 Ga0501074_0000239 3300049590 Bacteria 30690
288 Ga0501074_0007293 3300049590 Bacteria 7993
289 Ga0501075_0069622 3300049591 Bacteria 2659
290 Ga0501076_0030286 3300049592 Bacteria 4215
291 Ga0501076_0031862 3300049592 Bacteria 4114
292 Ga0501076_0074312 3300049592 Bacteria 2723
293 Ga0501077_0121867 3300049593 Bacteria 1653
294 Ga0501080_0003335 3300049742 Bacteria 14175
295 Ga0501080_0003618 3300049742 Bacteria 13617
296 Ga0501080_0041884 3300049742 Bacteria 4265
297 Ga0501080_0072760 3300049742 Bacteria 3198
298 Ga0501080_0111736 3300049742 Bacteria 2533
299 Ga0501083_0001381 3300049744 Bacteria 16485
300 Ga0501083_0003711 3300049744 Bacteria 10728
301 Ga0501083_0033143 3300049744 Bacteria 3538
302 Ga0501083_0058667 3300049744 Bacteria 2575
303 Ga0501035_0000185 3300049822 Bacteria 76291
304 Ga0501035_0002631 3300049822 Bacteria 17503
305 Ga0501035_0010445 3300049822 Bacteria 8605
306 Ga0501035_0061010 3300049822 Bacteria 3357
307 Ga0501035_0075745 3300049822 Bacteria 2976
308 Ga0501044_0000003 3300049823 Bacteria 345647
309 Ga0501044_0007053 3300049823 Bacteria 12364
310 Ga0501044_0031309 3300049823 Bacteria 5600
311 Ga0501044_0045759 3300049823 Bacteria 4533
312 Ga0501044_0137213 3300049823 Bacteria 2436
313 nmdc:mga06z11_54263_c1 3300050494 Bacteria 2065
314 nmdc:mga05p37_225_c1 3300050507 Bacteria 57238
315 nmdc:mga09592_244_c1 3300050508 Bacteria 39424
316 nmdc:mga0qj67_2611_c1 3300050509 Bacteria 12909
317 nmdc:mga06r32_731_c1 3300050510 Bacteria 28813
318 nmdc:mga08y16_307116_c1 3300050511 Bacteria 1634
319 nmdc:mga08y16_35316_c1 3300050511 Bacteria 5249
320 nmdc:mga08y16_617_c1 3300050511 Bacteria 33261
321 nmdc:mga0n895_457_c1 3300050512 Bacteria 27383
322 nmdc:mga08x19_21397_c1 3300050514 Bacteria 3991
323 nmdc:mga0a205_1019_c1 3300050515 Bacteria 23295
324 Ga0495612_0069578 3300053078 Bacteria 1466
325 Ga0500610_0043554 3300053079 Bacteria 2326
326 Ga0500569_003456 3300053109 Bacteria 3232
327 Ga0500593_000050 3300053117 Bacteria 42339
328 Ga0500595_006462 3300053119 Bacteria 4969
329 Ga0500595_008161 3300053119 Bacteria 4294
330 Ga0500652_000750 3300053131 Bacteria 10968
331 Ga0500568_0000001 3300053139 Bacteria 988705
332 Ga0500568_0005282 3300053139 Bacteria 6711
333 Ga0500568_0008233 3300053139 Bacteria 5047
334 Ga0500568_0021171 3300053139 Bacteria 2801
335 Ga0500573_0000008 3300053140 Bacteria 237795
336 Ga0500573_0042483 3300053140 Bacteria 2625
337 Ga0500616_0001786 3300053153 Bacteria 19621
338 Ga0500620_000077 3300053155 Bacteria 18369
339 Ga0501082_0004543 3300060353 Bacteria 12114
340 Ga0501082_0056325 3300060353 Bacteria 3386
341 Ga0501082_0097535 3300060353 Bacteria 2541
342 2512033959 2511231221 Bacteria 6846400
343 2523105278 2522572158 Bacteria 6514390
344 2644332269 2643221659 Bacteria 7890716
345 2724109510 2721755823 Bacteria 6752556
346 2821447850 2821443989 Bacteria 7658172
347 2821447852 2821443989 Bacteria 7658172
348 2842778347 2842775625 Bacteria 5587290
349 2844536495 2844533157 Bacteria 7517899
350 2874123857 2874123672 Bacteria 7238285
351 2883294332 2883291878 Bacteria 5894118
352 2883357144 2883354860 Bacteria 5865246
353 2883580533 2883577096 Bacteria 4709178
354 2891377228 2891373044 Bacteria 5202277
355 2894772799 2894772417 Bacteria 5305674
356 2897809950 2897803580 Bacteria 7000062
357 2909400393 2909399089 Bacteria 3922598
358 2924767200 2924762789 Bacteria 6561353
359 2929203567 2929199973 Bacteria 7260745
360 2929203568 2929199973 Bacteria 7260745
361 2937847270 2937843397 Bacteria 5256375
362 2987669036 2987666974 Bacteria 6509233
363 641336973 641228493 Bacteria 3999591
364 643392858 643348555 Bacteria 3914947
365 8054004555 8054002106 Bacteria 7987183
366 8055911242 8055909800 Bacteria 7278581
367 8055911243 8055909800 Bacteria 7278581
368 JGI25406J46586_10000156
369 JGI25162J39368_1000696
370 JGI25158J39367_1000077
371 JGI25152J39213_1000376
372 JGI25151J46595_10000465
373 JGI25151J46595_10003605
374 JGI25406J46586_10008619
375 JGI25165J46597_1002868
376 JGI25405J52794_10003972
377 Ga0065165_1003662
378 Ga0070658_10046014
379 Ga0070683_100018580
380 Ga0070683_100059888
381 Ga0070683_100061595
382 Ga0068869_100042053
383 Ga0070666_10012146
384 Ga0070660_100058095
385 Ga0070661_100085600
386 Ga0070674_100007225
387 Ga0070688_100128472
388 Ga0070667_100028660
389 Ga0070694_100029184
390 Ga0070678_100113989
391 Ga0070681_10001858
392 Ga0070681_10044261
393 Ga0070706_100028310
394 Ga0070706_100064153
395 Ga0070698_100101725
396 Ga0070679_100001956
397 Ga0070684_100079941
398 Ga0068853_100077618
399 Ga0068853_100192004
400 Ga0068853_100226989
401 Ga0070695_100032586
402 Ga0070696_100166893
403 Ga0070696_100167628
404 Ga0068855_100135365
405 Ga0068856_100052991
406 Ga0068856_100122031
407 Ga0068852_100077434
408 Ga0068859_100251539
409 Ga0068858_100061148
410 Ga0081455_10006033
411 Ga0081455_10075985
412 Ga0081538_10002356
413 Ga0081538_10025104
414 Ga0081540_1000194
415 Ga0081539_10000076
416 Ga0081539_10001574
417 Ga0081539_10092193
418 Ga0070717_10088739
419 Ga0070717_10241517
420 Ga0075368_10007515
421 Ga0075363_100021746
422 Ga0070712_100001398
423 Ga0075366_10049573
424 Ga0097621_100000211
425 Ga0068871_100015577
426 Ga0068871_100024205
427 Ga0075434_100007911
428 Ga0075436_100047761
429 Ga0097620_100251558
430 Ga0105240_10110069
431 Ga0105240_10129768
432 Ga0111539_10000337
433 Ga0111539_10149417
434 Ga0111539_10225961
435 Ga0105245_10007149
436 Ga0105245_10126099
437 Ga0114129_10003247
438 Ga0105241_10027967
439 Ga0105241_10029960
440 Ga0105242_10048531
441 Ga0105248_10017001
442 Ga0105248_10038968
443 Ga0105237_10075359
444 Ga0105238_10032692
445 Ga0105238_10045293
446 Ga0105238_10057128
447 Ga0105239_10309290
448 Ga0105246_10037945
449 Ga0157370_10020535
450 Ga0157369_10002835
451 Ga0157369_10038375
452 Ga0157369_10053138
453 Ga0157369_10391030
454 Ga0157374_10061633
455 Ga0157378_10041956
456 Ga0157378_10128863
457 Ga0157378_10426734
458 Ga0163162_10156473
459 Ga0163162_10254719
460 Ga0157375_10010463
461 Ga0163163_10114886
462 Ga0163163_10134635
463 Ga0157379_10090761
464 Ga0157379_10098816
465 Ga0157379_10104802
466 Ga0157376_10017114
467 Ga0157376_10121527
468 Ga0163161_10127682
469 Ga0213872_10009317
470 Ga0213875_10000530
471 Ga0213875_10001741
472 Ga0213875_10003559
473 Ga0213875_10016752
474 Ga0209437_100023
475 Ga0209233_1000062
476 Ga0209130_1000167
477 Ga0209025_1000077
478 Ga0209025_1000188
479 Ga0209758_1007903
480 Ga0207426_1000239
481 Ga0207688_10073139
482 Ga0207680_10032044
483 Ga0207647_10112542
484 Ga0207707_10022751
485 Ga0207707_10130192
486 Ga0207707_10206800
487 Ga0207695_10120505
488 Ga0207693_10003439
489 Ga0207657_10007135
490 Ga0207652_10043220
491 Ga0207659_10281842
492 Ga0207687_10082664
493 Ga0207700_10085284
494 Ga0207706_10144225
495 Ga0207686_10017974
496 Ga0207686_10025804
497 Ga0207711_10029220
498 Ga0207661_10036678
499 Ga0207658_10081440
500 Ga0207677_10098991
501 Ga0207677_10137729
502 Ga0207703_10087580
503 Ga0207639_10116903
504 Ga0207678_10032829
505 Ga0207678_10064988
506 Ga0207702_10035333
507 Ga0207702_10165115
508 Ga0207641_10021216
509 Ga0207648_10009980
510 Ga0207676_10149789
511 Ga0207676_10305339
512 Ga0207683_10027589
513 Ga0207683_10042725
514 Ga0207428_10051970
515 Ga0268266_10016716
516 Ga0268266_10023965
517 Ga0268266_10040266
518 Ga0268266_10176909
519 Ga0265334_10019298
520 Ga0307515_10000070
521 Ga0265338_10011285
522 Ga0265338_10071569
523 Ga0265324_10013177
524 Ga0265760_10005736
525 Ga0265330_10053851
526 Ga0265332_10056944
527 Ga0265331_10076516
528 Ga0265327_10046268
529 Ga0265316_10068856
530 Ga0265316_10133643
531 Ga0307408_100107326
532 Ga0265313_10009216
533 Ga0265314_10014552
534 Ga0265314_10041274
535 Ga0265314_10046286
536 Ga0265314_10055819
537 Ga0316576_10067200
538 Ga0316578_10002302
539 Ga0307413_10019707
540 Ga0307407_10036947
541 Ga0307412_10109451
542 Ga0307409_100008031
543 Ga0307411_10007231
544 Ga0373953_0052803
545 Ga0373954_0011468
546 Ga0373946_0023185
547 Ga0316574_0003278
548 Ga0316574_0012298
549 Ga0373933_0002645
550 Ga0373933_0040010
551 Ga0373937_0001341
552 Ga0373937_0023418
553 Ga0373937_0097238
554 Ga0316584_0013044
555 Ga0373925_0147751
556 Ga0395905_0007381
557 Ga0395905_0067081
558 Ga0436364_0022735
559 Ga0436364_0966921
560 Ga0436364_1129754
561 Ga0436364_1184534
562 Ga0436364_1561563
563 Ga0436365_0816294
564 Ga0436360_0954632
565 Ga0436360_1228146
566 Ga0436360_1275743
567 Ga0436361_0215588
568 Ga0436361_0276378
569 Ga0436361_0300922
570 Ga0436361_0378965
571 Ga0436363_0601770
572 Ga0436363_1258587
573 Ga0436362_0802871
574 Ga0453683_0022538
575 Ga0453684_0000006
576 Ga0453684_0000410
577 Ga0453684_0210342
578 Ga0451576_0001017
579 Ga0451576_0013388
580 Ga0451576_0087854
581 Ga0495617_018445
582 Ga0495592_0164232
583 Ga0495629_0086342
584 Ga0495580_0013337
585 Ga0495580_0049145
586 Ga0495582_0004012
587 Ga0495662_0087556
588 Ga0495585_0062131
589 Ga0495608_0163242
590 Ga0495610_0020976
591 Ga0495610_0025598
592 Ga0495610_0069065
593 Ga0495618_0090401
594 Ga0495622_0007824
595 Ga0495658_0016812
596 Ga0495674_0075331
597 Ga0495672_0031526
598 Ga0495673_0019955
599 Ga0495684_0039883
600 Ga0496101_0032518
601 Ga0496117_0006248
602 Ga0496122_0000883
603 Ga0496122_0004624
604 Ga0496123_0001542
605 Ga0496125_0000889
606 Ga0496125_0124109
607 Ga0496126_0028792
608 Ga0501031_0182622
609 Ga0501032_0010121
610 Ga0501032_0026837
611 Ga0501033_0002052
612 Ga0501033_0008858
613 Ga0501033_0076068
614 Ga0501034_0010929
615 Ga0501034_0075820
616 Ga0501034_0379762
617 Ga0501037_0000227
618 Ga0501037_0004512
619 Ga0501038_0003682
620 Ga0501039_0002395
621 Ga0501039_0077286
622 Ga0501041_0054503
623 Ga0501043_0000396
624 Ga0501043_0001899
625 Ga0501043_0013980
626 Ga0501043_0041418
627 Ga0501043_0137352
628 Ga0501046_0001214
629 Ga0501046_0146849
630 Ga0501047_0017198
631 Ga0501047_0028841
632 Ga0501047_0036340
633 Ga0501047_0078442
634 Ga0501047_0191927
635 Ga0501047_0275155
636 Ga0501048_0158690
637 Ga0501067_0042158
638 Ga0501067_0067736
639 Ga0501068_0021019
640 Ga0501069_0000066
641 Ga0501069_0000068
642 Ga0501069_0010778
643 Ga0501069_0025450
644 Ga0501070_0005111
645 Ga0501070_0006143
646 Ga0501070_0067783
647 Ga0501070_0071849
648 Ga0501070_0113872
649 Ga0501071_0011166
650 Ga0501072_0068103
651 Ga0501072_0124267
652 Ga0501073_0001156
653 Ga0501073_0023833
654 Ga0501074_0000239
655 Ga0501074_0007293
656 Ga0501075_0069622
657 Ga0501076_0030286
658 Ga0501076_0031862
659 Ga0501076_0074312
660 Ga0501077_0121867
661 Ga0501080_0003335
662 Ga0501080_0003618
663 Ga0501080_0041884
664 Ga0501080_0072760
665 Ga0501080_0111736
666 Ga0501083_0001381
667 Ga0501083_0003711
668 Ga0501083_0033143
669 Ga0501083_0058667
670 Ga0501035_0000185
671 Ga0501035_0002631
672 Ga0501035_0010445
673 Ga0501035_0061010
674 Ga0501035_0075745
675 Ga0501044_0000003
676 Ga0501044_0007053
677 Ga0501044_0031309
678 Ga0501044_0045759
679 Ga0501044_0137213
680 nmdc:mga06z11_54263_c1
681 nmdc:mga05p37_225_c1
682 nmdc:mga09592_244_c1
683 nmdc:mga0qj67_2611_c1
684 nmdc:mga06r32_731_c1
685 nmdc:mga08y16_307116_c1
686 nmdc:mga08y16_35316_c1
687 nmdc:mga08y16_617_c1
688 nmdc:mga0n895_457_c1
689 nmdc:mga08x19_21397_c1
690 nmdc:mga0a205_1019_c1
691 Ga0495612_0069578
692 Ga0500610_0043554
693 Ga0500569_003456
694 Ga0500593_000050
695 Ga0500595_006462
696 Ga0500595_008161
697 Ga0500652_000750
698 Ga0500568_0000001
699 Ga0500568_0005282
700 Ga0500568_0008233
701 Ga0500568_0021171
702 Ga0500573_0000008
703 Ga0500573_0042483
704 Ga0500616_0001786
705 Ga0500620_000077
706 Ga0501082_0004543
707 Ga0501082_0056325
708 Ga0501082_0097535
709 2512033959
710 2523105278
711 2644332269
712 2724109510
713 2821447850
714 2821447852
715 2842778347
716 2844536495
717 2874123857
718 2883294332
719 2883357144
720 2883580533
721 2891377228
722 2894772799
723 2897809950
724 2909400393
725 2924767200
726 2929203567
727 2929203568
728 2937847270
729 2987669036
730 641336973
731 643392858
732 8054004555
733 8055911242
734 8055911243

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02687

FtsX

FtsX-like permease family

311

445

0.97

PF12704

MacB_PCD

MacB-like periplasmic core domain

63

281

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
5udf-assembly1.cif.gz_B structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.8807 53 255
5udf-assembly1.cif.gz_D structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.8698 53 255
5udf-assembly1.cif.gz_C structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.8667 53 255
5udf-assembly1.cif.gz_D structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.85 53 255
5udf-assembly1.cif.gz_B structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.8476 53 255
ID Description Score Start End Superfamily
af_I1MEU9_21_98_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6738 63 94 3.30.70.100
1cz5A01 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.5601 145 229 2.40.40.20
af_Q9BPU3_378_783_3.40.850.10 Alpha Beta;3-Layer(aba) Sandwich;Kinesin;Kinesin motor domain 0.5455 165 197 3.40.850.10
af_Q4DUB6_274_435_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.5018 278 413 1.10.1760.20
af_A4IBQ2_333_497_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.4948 278 413 1.10.1760.20
ID Description Score Start End GO Terms
AF-A0A7V7FKS1-F1-model_v4 FtsX-like permease family protein 0.9481 242 415 GO:0044874
GO:0098797
AF-A0A2D5LV36-F1-model_v4 Transporter 0.9455 274 415 GO:0044874
GO:0098797
AF-A0A2X3M198-F1-model_v4 Lipoprotein-releasing system transmembrane protein 0.938 274 415 GO:0044874
GO:0098797
AF-A0A7V7FKS1-F1-model_v4 FtsX-like permease family protein 0.9376 242 415 GO:0044874
GO:0098797
AF-A0A3M3M7Q0-F1-model_v4 deleted 0.9345 296 415

Map