F424232

General Info

Members Datasets Scaffolds Average Seq Length
367 290 734 263

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10114530|Ga0065704_101145302
Length 301
Sequence MFFLIENRNRIDMDNFKFEMKILRFVFSKFEADNFFAMQNYLDLLQHILDNGTDKTDRTGTGTRSVFGYQLRYDLSKGFPLVTTKKVHLKSIIYELLWFIKGDTNTKYLKDNGVSIWDEWADENGNLGPVYGAQWRSWNGANGKVVDQFSDVIEQIKKNPDSRRLIVSAWNAAEIPNMALAPCHALFQFYVADGKLSLQLYQRSADVFLGVPFNIASYALLLMMVAQVTGLEVGDYVHTFGDVHIYNNHFEQVQKQLSRAPRALPKMKLNPEIKDIFDFDFEDFTLENYDPHPGIKAPVAI

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
7 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
8 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
9 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
114 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
115 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
116 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
117 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
120 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
131 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
132 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
133 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
139 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
140 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
141 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
142 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
143 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
144 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
145 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
146 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
147 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
148 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
149 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
150 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
151 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
152 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
153 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
156 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
157 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
158 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
159 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
160 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
161 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
162 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
163 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
164 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
165 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
166 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
167 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
168 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
172 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
173 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
174 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
175 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
176 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
177 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
178 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
179 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
180 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
181 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
182 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
193 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
194 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
195 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
196 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
197 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
200 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
201 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
202 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
203 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
204 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
207 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
208 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
212 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
213 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
214 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
215 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
216 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
217 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
218 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
219 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
220 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
221 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
222 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
223 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
224 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
225 2524614857 Deinococcus ficus DSM 19119 Isolate Rhizosphere
226 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
227 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
228 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
229 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
230 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
231 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
232 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
233 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
234 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
235 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
236 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
237 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
238 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
239 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
240 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
241 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
242 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
243 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
244 2643221580 Devosia sp. Root635 Isolate Unclassified
245 2643221615 Nocardioides sp. Root224 Isolate Unclassified
246 2643221641 Nocardioides sp. Root122 Isolate Unclassified
247 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
248 2643221674 Devosia sp. Root436 Isolate Unclassified
249 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
250 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
251 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
252 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
253 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
254 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
255 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
256 2738541305 Nocardioides sp. CF167 Isolate Unclassified
257 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
258 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
259 2739367875 Deinococcus ficus CC-FR2-10 Isolate Unclassified
260 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
261 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
262 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
263 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
264 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
265 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
266 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
267 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
268 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
269 2858438669 Leuconostoc mesenteroides YL48 Isolate Unclassified
270 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
271 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
272 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
273 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
274 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
275 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
276 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
277 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
278 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
279 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
280 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
281 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
282 2932401849 Devosia sp. 2618 Isolate Rhizosphere
283 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
284 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
285 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
286 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
287 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
288 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
289 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
290 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80.65
Metatranscriptomes 0
Isolates 19.35

Biome Distribution

Category Percentage (%)
Aerial Root 0.54
Bulb 0
Endosphere 12.53
Nodule 1.09
Rhizoplane 1.09
Rhizosphere 70.03
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10114530 3300005289 Bacteria 1889
2 SwRhRL2b_contig_750015 2162886007 Bacteria 2158
3 JGI24739J22299_10107228 3300001989 Bacteria 840
4 JGI25151J46595_10001824 3300003187 Bacteria 13733
5 JGI25151J46595_10013385 3300003187 Bacteria 3692
6 rootH1_10054680 3300003323 Bacteria 8196
7 Ga0055532_1000064 3300003758 Bacteria 143144
8 Ga0055525_1000021 3300003759 Bacteria 370802
9 Ga0055527_1000685 3300003760 Bacteria 10030
10 Ga0055535_1001814 3300003761 Bacteria 9257
11 Ga0055542_1001646 3300003762 Bacteria 10030
12 Ga0055529_1000388 3300003763 Bacteria 47502
13 Ga0055524_1007380 3300003775 Bacteria 4674
14 Ga0055530_10001698 3300003791 Bacteria 15597
15 Ga0065714_10065189 3300005288 Bacteria 12111
16 Ga0065704_10074612 3300005289 Bacteria 6137
17 Ga0065704_10074747 3300005289 Bacteria 6041
18 Ga0070658_10108996 3300005327 Bacteria 2292
19 Ga0070683_100001412 3300005329 Bacteria 18434
20 Ga0070683_100442482 3300005329 Bacteria 1240
21 Ga0070682_100000005 3300005337 Bacteria 386439
22 Ga0070682_100000238 3300005337 Bacteria 39996
23 Ga0070682_100017081 3300005337 Bacteria 4227
24 Ga0068868_100204626 3300005338 Bacteria 1647
25 Ga0070660_100034428 3300005339 Bacteria 3827
26 Ga0070689_100372382 3300005340 Bacteria 1202
27 Ga0070668_100039712 3300005347 Bacteria 3599
28 Ga0070668_100094610 3300005347 Bacteria 2359
29 Ga0070667_100153116 3300005367 Bacteria 2027
30 Ga0070711_100366113 3300005439 Bacteria 1162
31 Ga0070700_100471067 3300005441 Bacteria 960
32 Ga0070663_100202714 3300005455 Bacteria 1549
33 Ga0070681_10148686 3300005458 Bacteria 2270
34 Ga0068867_100098223 3300005459 Bacteria 2232
35 Ga0070679_100005027 3300005530 Bacteria 12206
36 Ga0070679_100041314 3300005530 Bacteria 4590
37 Ga0070679_100493433 3300005530 Bacteria 1169
38 Ga0070684_100046851 3300005535 Bacteria 3746
39 Ga0068853_100153789 3300005539 Bacteria 2072
40 Ga0070672_100441089 3300005543 Bacteria 1120
41 Ga0070665_100312549 3300005548 Bacteria 1575
42 Ga0068855_100022034 3300005563 Bacteria 7638
43 Ga0068854_100111733 3300005578 Bacteria 2062
44 Ga0070702_100023774 3300005615 Bacteria 3260
45 Ga0068852_100010167 3300005616 Bacteria 7011
46 Ga0068852_100048097 3300005616 Bacteria 3643
47 Ga0068859_100000522 3300005617 Bacteria 38186
48 Ga0068864_100089505 3300005618 Bacteria 2712
49 Ga0068851_10105916 3300005834 Bacteria 1497
50 Ga0068860_100002199 3300005843 Bacteria 20515
51 Ga0075365_10005655 3300006038 Bacteria 6770
52 Ga0075365_10022323 3300006038 Bacteria 3964
53 Ga0075368_10018688 3300006042 Bacteria 2607
54 Ga0075363_100002471 3300006048 Bacteria 7560
55 Ga0075364_10119037 3300006051 Bacteria 1767
56 Ga0075369_10011520 3300006186 Bacteria 3481
57 Ga0075370_10010103 3300006353 Bacteria 4923
58 Ga0075428_100000205 3300006844 Bacteria 56652
59 Ga0075431_100000119 3300006847 Bacteria 51177
60 Ga0075434_100244923 3300006871 Bacteria 1813
61 Ga0075429_100001803 3300006880 Bacteria 17742
62 Ga0075429_100228962 3300006880 Bacteria 1628
63 Ga0097620_100000522 3300006931 Bacteria 38186
64 Ga0105244_10000001 3300009036 Bacteria 1034899
65 Ga0111539_10001586 3300009094 Bacteria 30280
66 Ga0111539_10043635 3300009094 Bacteria 5374
67 Ga0114129_10000640 3300009147 Bacteria 43706
68 Ga0105243_10002198 3300009148 Bacteria 16443
69 Ga0105243_10182855 3300009148 Bacteria 1825
70 Ga0105241_10072493 3300009174 Bacteria 2677
71 Ga0105237_10020546 3300009545 Bacteria 6805
72 Ga0105239_10276836 3300010375 Bacteria 1888
73 Ga0157373_10000004 3300013100 Bacteria 275553
74 Ga0157371_10000201 3300013102 Bacteria 87780
75 Ga0157371_10144213 3300013102 Bacteria 1697
76 Ga0157370_10010456 3300013104 Bacteria 9777
77 Ga0157370_10042623 3300013104 Bacteria 4372
78 Ga0157370_10078585 3300013104 Bacteria 3107
79 Ga0157370_10211808 3300013104 Bacteria 1796
80 Ga0157370_10212102 3300013104 Bacteria 1795
81 Ga0157369_10000815 3300013105 Bacteria 39822
82 Ga0157369_10051022 3300013105 Bacteria 4478
83 Ga0157369_10064575 3300013105 Bacteria 3942
84 Ga0157369_10099528 3300013105 Bacteria 3099
85 Ga0163162_10335495 3300013306 Bacteria 1644
86 Ga0157372_10041116 3300013307 Bacteria 5110
87 Ga0157375_10001608 3300013308 Bacteria 19412
88 Ga0157375_10035257 3300013308 Bacteria 4774
89 Ga0157375_10319052 3300013308 Bacteria 1718
90 Ga0157375_10866636 3300013308 Bacteria 1049
91 Ga0163163_10065261 3300014325 Bacteria 3613
92 Ga0163163_10206434 3300014325 Bacteria 2013
93 Ga0182008_10000007 3300014497 Bacteria 372461
94 Ga0182006_1000003 3300015261 Bacteria 826681
95 Ga0163161_10000884 3300017792 Bacteria 23288
96 Ga0163161_10008842 3300017792 Bacteria 6965
97 Ga0209672_100005 3300025228 Bacteria 1069303
98 Ga0209147_100014 3300025229 Bacteria 597841
99 Ga0209563_100005 3300025230 Bacteria 1774893
100 Ga0209563_100023 3300025230 Bacteria 636844
101 Ga0209258_100006 3300025242 Bacteria 1069303
102 Ga0209148_1000012 3300025254 Bacteria 1069303
103 Ga0209455_1000008 3300025272 Bacteria 1069303
104 Ga0209675_1000057 3300025291 Bacteria 185467
105 Ga0209676_1009066 3300025292 Bacteria 4343
106 Ga0209025_1000564 3300025294 Bacteria 67936
107 Ga0209025_1001125 3300025294 Bacteria 38283
108 Ga0209564_1018170 3300025295 Bacteria 2695
109 Ga0209256_1008122 3300025299 Bacteria 4945
110 Ga0209051_1031992 3300025303 Bacteria 2014
111 Ga0209257_1004746 3300025304 Bacteria 10154
112 Ga0207655_1000013 3300025728 Bacteria 637510
113 Ga0207705_10057300 3300025909 Bacteria 2810
114 Ga0207707_10118402 3300025912 Bacteria 2315
115 Ga0207707_10323477 3300025912 Bacteria 1331
116 Ga0207695_10026281 3300025913 Bacteria 6498
117 Ga0207695_10047555 3300025913 Bacteria 4539
118 Ga0207657_10043680 3300025919 Bacteria 3946
119 Ga0207657_10073406 3300025919 Bacteria 2891
120 Ga0207652_10001352 3300025921 Bacteria 21786
121 Ga0207652_10032499 3300025921 Bacteria 4388
122 Ga0207650_10281908 3300025925 Bacteria 1353
123 Ga0207709_10000149 3300025935 Bacteria 96374
124 Ga0207709_10117270 3300025935 Bacteria 1791
125 Ga0207670_10313864 3300025936 Bacteria 1232
126 Ga0207661_10001192 3300025944 Bacteria 17402
127 Ga0207667_10035659 3300025949 Bacteria 5336
128 Ga0207668_10029234 3300025972 Bacteria 3611
129 Ga0207668_10088378 3300025972 Bacteria 2269
130 Ga0207658_10162654 3300025986 Bacteria 1831
131 Ga0207639_10131546 3300026041 Bacteria 2072
132 Ga0207678_10394465 3300026067 Bacteria 1198
133 Ga0207648_10097844 3300026089 Bacteria 2568
134 Ga0207676_10049085 3300026095 Bacteria 3281
135 Ga0207698_10002164 3300026142 Bacteria 11607
136 Ga0209969_1005687 3300027360 Bacteria 1753
137 Ga0209967_1001865 3300027364 Bacteria 2708
138 Ga0209984_1002993 3300027424 Bacteria 1910
139 Ga0210000_1006946 3300027462 Bacteria 1652
140 Ga0209995_1028714 3300027471 Bacteria 929
141 Ga0209999_1003781 3300027543 Bacteria 2715
142 Ga0209982_1000931 3300027552 Bacteria 3856
143 Ga0209983_1000298 3300027665 Bacteria 10335
144 Ga0209971_1000333 3300027682 Bacteria 13030
145 Ga0209974_10001733 3300027876 Bacteria 7924
146 Ga0268266_10265505 3300028379 Bacteria 1592
147 Ga0268265_10099440 3300028380 Bacteria 2345
148 Ga0268265_10814625 3300028380 Bacteria 911
149 Ga0265331_10021642 3300031250 Bacteria 3288
150 Ga0265327_10000139 3300031251 Bacteria 159492
151 Ga0316579_10094330 3300031691 Bacteria 1430
152 Ga0316578_10147716 3300031728 Bacteria 1416
153 Ga0307516_10314317 3300031730 Bacteria 1239
154 Ga0307405_10361931 3300031731 Bacteria 1123
155 Ga0316577_10044102 3300031733 Bacteria 2494
156 Ga0307413_10151011 3300031824 Bacteria 1619
157 Ga0307410_10339557 3300031852 Bacteria 1197
158 Ga0307406_10311482 3300031901 Bacteria 1214
159 Ga0307407_10221075 3300031903 Bacteria 1281
160 Ga0307407_10399579 3300031903 Bacteria 985
161 Ga0307412_10000102 3300031911 Bacteria 69906
162 Ga0307412_10000900 3300031911 Bacteria 17099
163 Ga0307412_10003100 3300031911 Bacteria 9229
164 Ga0307412_10165057 3300031911 Bacteria 1650
165 Ga0307412_10342098 3300031911 Bacteria 1198
166 Ga0307409_100789405 3300031995 Bacteria 956
167 Ga0307409_101076733 3300031995 Bacteria 824
168 Ga0307416_100000031 3300032002 Bacteria 159059
169 Ga0307416_100387855 3300032002 Bacteria 1430
170 Ga0307416_100570074 3300032002 Bacteria 1208
171 Ga0307414_10000010 3300032004 Bacteria 357863
172 Ga0307414_10005674 3300032004 Bacteria 6889
173 Ga0307414_10006175 3300032004 Bacteria 6660
174 Ga0307414_10189866 3300032004 Bacteria 1661
175 Ga0307414_10401427 3300032004 Bacteria 1191
176 Ga0307414_10452263 3300032004 Bacteria 1126
177 Ga0307411_10221589 3300032005 Bacteria 1468
178 Ga0307411_10406625 3300032005 Bacteria 1127
179 Ga0307415_100499543 3300032126 Bacteria 1063
180 Ga0316583_10003601 3300032133 Bacteria 5472
181 Ga0316580_10040752 3300032139 Bacteria 1435
182 Ga0316582_0067957 3300036647 Bacteria 2300
183 Ga0316584_0083544 3300036712 Bacteria 2392
184 Ga0316584_0113145 3300036712 Bacteria 2031
185 Ga0395900_0025688 3300037418 Bacteria 6030
186 Ga0395898_0190338 3300037466 Bacteria 1960
187 Ga0395901_0500181 3300038443 Bacteria 1237
188 Ga0436365_0691100 3300039437 Bacteria 2328
189 Ga0439465_0002051 3300041413 Bacteria 6606
190 Ga0451795_1594654 3300041456 Bacteria 1162
191 Ga0451837_0842085 3300041494 Bacteria 1204
192 Ga0451839_1056440 3300041496 Bacteria 3048
193 Ga0451853_0562319 3300041512 Bacteria 1757
194 Ga0439445_0000217 3300042004 Bacteria 10610
195 Ga0439449_0015560 3300042007 Bacteria 2859
196 Ga0439457_035726 3300042014 Bacteria 1105
197 Ga0450904_005604 3300042139 Bacteria 1265
198 Ga0451577_0153059 3300042876 Bacteria 2075
199 Ga0466977_0011435 3300044666 Bacteria 5108
200 Ga0466965_0033666 3300044683 Bacteria 2505
201 Ga0453684_0011922 3300044712 Bacteria 14473
202 Ga0453684_0178840 3300044712 Bacteria 2492
203 Ga0466970_0054057 3300044765 Bacteria 2144
204 Ga0466970_0152458 3300044765 Bacteria 1276
205 Ga0466960_0036091 3300044901 Bacteria 2314
206 Ga0466959_0307950 3300045049 Bacteria 1084
207 Ga0451576_0507370 3300045051 Bacteria 1267
208 Ga0466967_0030255 3300045976 Bacteria 4542
209 Ga0495627_000002 3300046453 Bacteria 903861
210 Ga0495590_0069190 3300046457 Bacteria 1237
211 Ga0495596_0010040 3300046500 Bacteria 4140
212 Ga0495610_0000006 3300046512 Bacteria 856822
213 Ga0495663_0000128 3300046525 Bacteria 31809
214 Ga0495654_0000006 3300046530 Bacteria 451432
215 Ga0495609_0000047 3300046538 Bacteria 156247
216 Ga0495633_0000003 3300046558 Bacteria 472476
217 Ga0495633_0002315 3300046558 Bacteria 13577
218 Ga0495668_0000301 3300046616 Bacteria 68097
219 Ga0495625_0003536 3300046660 Bacteria 15468
220 Ga0495625_0079656 3300046660 Bacteria 2283
221 Ga0495661_0001246 3300046665 Bacteria 21980
222 Ga0495672_0070231 3300047320 Bacteria 1985
223 Ga0495686_0000017 3300047472 Bacteria 435554
224 Ga0495686_0000206 3300047472 Bacteria 110350
225 Ga0495686_0002572 3300047472 Bacteria 16900
226 Ga0496101_0052223 3300048904 Bacteria 2947
227 Ga0496110_0236253 3300048913 Bacteria 1663
228 Ga0496116_0000006 3300048919 Bacteria 811937
229 Ga0496117_0000027 3300048920 Bacteria 412234
230 Ga0496117_0034182 3300048920 Bacteria 3835
231 Ga0496118_0001435 3300048921 Bacteria 35889
232 Ga0496118_0002826 3300048921 Bacteria 22723
233 Ga0496119_0000205 3300048922 Bacteria 84036
234 Ga0496120_0115313 3300048923 Bacteria 1397
235 Ga0496121_0150624 3300048924 Bacteria 1712
236 Ga0496122_0000073 3300048925 Bacteria 222403
237 Ga0496122_0001327 3300048925 Bacteria 40506
238 Ga0496122_0001417 3300048925 Bacteria 38842
239 Ga0496122_0006041 3300048925 Bacteria 14120
240 Ga0496122_0032228 3300048925 Bacteria 4339
241 Ga0496123_0001190 3300048926 Bacteria 38293
242 Ga0496123_0022199 3300048926 Bacteria 4900
243 Ga0496123_0095077 3300048926 Bacteria 1754
244 Ga0496123_0114216 3300048926 Bacteria 1536
245 Ga0496124_0001294 3300048927 Bacteria 37979
246 Ga0496125_0000180 3300048928 Bacteria 138952
247 Ga0496125_0000622 3300048928 Bacteria 59554
248 Ga0496125_0001900 3300048928 Bacteria 28607
249 Ga0496126_0005470 3300048929 Bacteria 14481
250 Ga0501032_0043979 3300049569 Bacteria 3023
251 Ga0501033_0090126 3300049570 Bacteria 2243
252 Ga0501034_0011801 3300049571 Bacteria 9042
253 Ga0501034_0036479 3300049571 Bacteria 4980
254 Ga0501034_0214131 3300049571 Bacteria 1881
255 Ga0501034_0512978 3300049571 Bacteria 1111
256 Ga0501036_0339764 3300049572 Bacteria 1254
257 Ga0501038_0078944 3300049574 Bacteria 2776
258 Ga0501039_0019458 3300049575 Bacteria 5206
259 Ga0501040_0107162 3300049576 Bacteria 1953
260 Ga0501040_0177089 3300049576 Bacteria 1511
261 Ga0501042_0164670 3300049578 Bacteria 1600
262 Ga0501043_0161206 3300049579 Bacteria 1752
263 Ga0501048_0237222 3300049582 Bacteria 1294
264 Ga0501048_0297976 3300049582 Bacteria 1147
265 Ga0501067_0125367 3300049583 Bacteria 1429
266 Ga0501076_0589352 3300049592 Bacteria 917
267 Ga0501081_0049145 3300049743 Bacteria 2904
268 Ga0501241_000399 3300049758 Bacteria 9520
269 Ga0501269_000428 3300049766 Bacteria 9482
270 Ga0501035_0161106 3300049822 Bacteria 1942
271 Ga0501045_0211563 3300049824 Bacteria 1444
272 nmdc:mga03683_110172_c1 3300050489 Bacteria 1216
273 nmdc:mga03n38_74446_c1 3300050490 Bacteria 1579
274 nmdc:mga03n38_9544_c1 3300050490 Bacteria 3536
275 nmdc:mga00v17_16395_c1 3300050491 Bacteria 4175
276 nmdc:mga00v17_42556_c1 3300050491 Bacteria 2733
277 nmdc:mga0yw44_106931_c1 3300050492 Bacteria 1789
278 nmdc:mga04h51_31155_c1 3300050495 Bacteria 1684
279 nmdc:mga07m45_10552_c1 3300050496 Bacteria 4829
280 nmdc:mga05p37_1058783_c1 3300050507 Bacteria 854
281 nmdc:mga05p37_504_c1 3300050507 Bacteria 43013
282 nmdc:mga09592_74915_c1 3300050508 Bacteria 2877
283 nmdc:mga0qj67_50560_c1 3300050509 Bacteria 3287
284 nmdc:mga06r32_64_c1 3300050510 Bacteria 67984
285 nmdc:mga08y16_102203_c1 3300050511 Bacteria 2984
286 nmdc:mga08y16_906_c1 3300050511 Bacteria 28665
287 nmdc:mga0n895_95950_c1 3300050512 Bacteria 2970
288 nmdc:mga0a205_305774_c1 3300050515 Bacteria 1462
289 nmdc:mga0sz30_5629_c1 3300050516 Bacteria 4604
290 Ga0495595_0188973 3300053084 Bacteria 1023
291 Ga0495619_0069461 3300053085 Bacteria 2355
292 Ga0500643_087433 3300053087 Bacteria 852
293 Ga0500556_0000513 3300053104 Bacteria 26475
294 Ga0500568_0056255 3300053139 Bacteria 1534
295 Ga0500604_0000235 3300053151 Bacteria 15825
296 Ga0500634_0000081 3300053161 Bacteria 37292
297 2511232502 2511231000 Bacteria 4488346
298 2513955927 2513237150 Bacteria 6553639
299 2514043986 2513237165 Bacteria 6771773
300 2523470787 2523231067 Bacteria 5230452
301 2524006796 2523533629 Bacteria 2982326
302 2526063574 2524614857 Bacteria 4146328
303 2585143859 2582581278 Bacteria 5296881
304 2585158708 2582581281 Bacteria 4487904
305 2585162995 2582581282 Bacteria 4495830
306 2585386559 2582581865 Bacteria 6644329
307 2585424366 2582581873 Bacteria 3032664
308 2587681341 2585428045 Bacteria 5203023
309 2587745869 2585428060 Bacteria 5304711
310 2587751065 2585428061 Bacteria 3939663
311 2587865273 2585428095 Bacteria 3789702
312 2587944127 2585428115 Bacteria 4420269
313 2588210067 2585428182 Bacteria 5007281
314 2588214730 2585428183 Bacteria 5166119
315 2588217958 2585428184 Bacteria 4978681
316 2588222839 2585428185 Bacteria 4969476
317 2588231325 2585428187 Bacteria 4629388
318 2588444388 2588253712 Bacteria 5403181
319 2590601308 2588254255 Bacteria 5014294
320 2590613238 2588254257 Bacteria 5436094
321 2643911275 2643221580 Bacteria 3816678
322 2644093626 2643221615 Bacteria 5487866
323 2644230097 2643221641 Bacteria 4490190
324 2644323468 2643221657 Bacteria 5490246
325 2644411337 2643221674 Bacteria 3919126
326 2644456697 2643221681 Bacteria 3707866
327 2645720083 2643221961 Bacteria 3919167
328 2645726940 2643221962 Bacteria 3874254
329 2671693326 2671180139 Bacteria 4196045
330 2712196632 2711768088 Bacteria 3195027
331 2729199788 2728369107 Bacteria 5082720
332 2738699917 2738541273 Bacteria 4048577
333 2738871840 2738541305 Bacteria 4910150
334 2739253666 2738543014 Bacteria 4048139
335 2740058809 2739367874 Bacteria 4872888
336 2740061924 2739367875 Bacteria 4157290
337 2753674335 2751185877 Bacteria 4921427
338 2757565827 2757320391 Bacteria 4746095
339 2765573971 2765235839 Bacteria 5314748
340 2772605046 2772190705 Bacteria 4666226
341 2775672130 2775506739 Bacteria 3855222
342 2816874186 2816332188 Bacteria 5133218
343 2840677412 2840677318 Bacteria 2664183
344 2842086139 2842083920 Bacteria 4857652
345 2857485708 2857481737 Bacteria 4761446
346 2858439149 2858438669 Bacteria 2058402
347 2871720419 2871720351 Bacteria 4862476
348 2883072843 2883068021 Bacteria 6192739
349 2889295532 2889290771 Bacteria 5530962
350 2895499573 2895498888 Bacteria 5283788
351 2895512596 2895511927 Bacteria 6802080
352 2895522610 2895522137 Bacteria 3284416
353 2895525628 2895525241 Bacteria 3388457
354 2896085230 2896085136 Bacteria 6129793
355 2906002887 2905999023 Bacteria 4591259
356 2915611705 2915606848 Bacteria 6032732
357 2919100556 2919097161 Bacteria 3860339
358 2919401073 2919399522 Bacteria 5164947
359 2932402752 2932401849 Bacteria 4262978
360 2945926184 2945924605 Bacteria 4296724
361 2946022435 2946019816 Bacteria 4621265
362 2977245168 2977243572 Bacteria 4374394
363 2984572921 2984572630 Bacteria 4186940
364 2984610370 2984606641 Bacteria 4186971
365 2993374466 2993372514 Bacteria 4214139
366 2993481352 2993480792 Bacteria 4022225
367 643598469 643348564 Bacteria 8839022
368 Ga0065704_10114530
369 SwRhRL2b_contig_750015
370 JGI24739J22299_10107228
371 JGI25151J46595_10001824
372 JGI25151J46595_10013385
373 rootH1_10054680
374 Ga0055532_1000064
375 Ga0055525_1000021
376 Ga0055527_1000685
377 Ga0055535_1001814
378 Ga0055542_1001646
379 Ga0055529_1000388
380 Ga0055524_1007380
381 Ga0055530_10001698
382 Ga0065714_10065189
383 Ga0065704_10074612
384 Ga0065704_10074747
385 Ga0070658_10108996
386 Ga0070683_100001412
387 Ga0070683_100442482
388 Ga0070682_100000005
389 Ga0070682_100000238
390 Ga0070682_100017081
391 Ga0068868_100204626
392 Ga0070660_100034428
393 Ga0070689_100372382
394 Ga0070668_100039712
395 Ga0070668_100094610
396 Ga0070667_100153116
397 Ga0070711_100366113
398 Ga0070700_100471067
399 Ga0070663_100202714
400 Ga0070681_10148686
401 Ga0068867_100098223
402 Ga0070679_100005027
403 Ga0070679_100041314
404 Ga0070679_100493433
405 Ga0070684_100046851
406 Ga0068853_100153789
407 Ga0070672_100441089
408 Ga0070665_100312549
409 Ga0068855_100022034
410 Ga0068854_100111733
411 Ga0070702_100023774
412 Ga0068852_100010167
413 Ga0068852_100048097
414 Ga0068859_100000522
415 Ga0068864_100089505
416 Ga0068851_10105916
417 Ga0068860_100002199
418 Ga0075365_10005655
419 Ga0075365_10022323
420 Ga0075368_10018688
421 Ga0075363_100002471
422 Ga0075364_10119037
423 Ga0075369_10011520
424 Ga0075370_10010103
425 Ga0075428_100000205
426 Ga0075431_100000119
427 Ga0075434_100244923
428 Ga0075429_100001803
429 Ga0075429_100228962
430 Ga0097620_100000522
431 Ga0105244_10000001
432 Ga0111539_10001586
433 Ga0111539_10043635
434 Ga0114129_10000640
435 Ga0105243_10002198
436 Ga0105243_10182855
437 Ga0105241_10072493
438 Ga0105237_10020546
439 Ga0105239_10276836
440 Ga0157373_10000004
441 Ga0157371_10000201
442 Ga0157371_10144213
443 Ga0157370_10010456
444 Ga0157370_10042623
445 Ga0157370_10078585
446 Ga0157370_10211808
447 Ga0157370_10212102
448 Ga0157369_10000815
449 Ga0157369_10051022
450 Ga0157369_10064575
451 Ga0157369_10099528
452 Ga0163162_10335495
453 Ga0157372_10041116
454 Ga0157375_10001608
455 Ga0157375_10035257
456 Ga0157375_10319052
457 Ga0157375_10866636
458 Ga0163163_10065261
459 Ga0163163_10206434
460 Ga0182008_10000007
461 Ga0182006_1000003
462 Ga0163161_10000884
463 Ga0163161_10008842
464 Ga0209672_100005
465 Ga0209147_100014
466 Ga0209563_100005
467 Ga0209563_100023
468 Ga0209258_100006
469 Ga0209148_1000012
470 Ga0209455_1000008
471 Ga0209675_1000057
472 Ga0209676_1009066
473 Ga0209025_1000564
474 Ga0209025_1001125
475 Ga0209564_1018170
476 Ga0209256_1008122
477 Ga0209051_1031992
478 Ga0209257_1004746
479 Ga0207655_1000013
480 Ga0207705_10057300
481 Ga0207707_10118402
482 Ga0207707_10323477
483 Ga0207695_10026281
484 Ga0207695_10047555
485 Ga0207657_10043680
486 Ga0207657_10073406
487 Ga0207652_10001352
488 Ga0207652_10032499
489 Ga0207650_10281908
490 Ga0207709_10000149
491 Ga0207709_10117270
492 Ga0207670_10313864
493 Ga0207661_10001192
494 Ga0207667_10035659
495 Ga0207668_10029234
496 Ga0207668_10088378
497 Ga0207658_10162654
498 Ga0207639_10131546
499 Ga0207678_10394465
500 Ga0207648_10097844
501 Ga0207676_10049085
502 Ga0207698_10002164
503 Ga0209969_1005687
504 Ga0209967_1001865
505 Ga0209984_1002993
506 Ga0210000_1006946
507 Ga0209995_1028714
508 Ga0209999_1003781
509 Ga0209982_1000931
510 Ga0209983_1000298
511 Ga0209971_1000333
512 Ga0209974_10001733
513 Ga0268266_10265505
514 Ga0268265_10099440
515 Ga0268265_10814625
516 Ga0265331_10021642
517 Ga0265327_10000139
518 Ga0316579_10094330
519 Ga0316578_10147716
520 Ga0307516_10314317
521 Ga0307405_10361931
522 Ga0316577_10044102
523 Ga0307413_10151011
524 Ga0307410_10339557
525 Ga0307406_10311482
526 Ga0307407_10221075
527 Ga0307407_10399579
528 Ga0307412_10000102
529 Ga0307412_10000900
530 Ga0307412_10003100
531 Ga0307412_10165057
532 Ga0307412_10342098
533 Ga0307409_100789405
534 Ga0307409_101076733
535 Ga0307416_100000031
536 Ga0307416_100387855
537 Ga0307416_100570074
538 Ga0307414_10000010
539 Ga0307414_10005674
540 Ga0307414_10006175
541 Ga0307414_10189866
542 Ga0307414_10401427
543 Ga0307414_10452263
544 Ga0307411_10221589
545 Ga0307411_10406625
546 Ga0307415_100499543
547 Ga0316583_10003601
548 Ga0316580_10040752
549 Ga0316582_0067957
550 Ga0316584_0083544
551 Ga0316584_0113145
552 Ga0395900_0025688
553 Ga0395898_0190338
554 Ga0395901_0500181
555 Ga0436365_0691100
556 Ga0439465_0002051
557 Ga0451795_1594654
558 Ga0451837_0842085
559 Ga0451839_1056440
560 Ga0451853_0562319
561 Ga0439445_0000217
562 Ga0439449_0015560
563 Ga0439457_035726
564 Ga0450904_005604
565 Ga0451577_0153059
566 Ga0466977_0011435
567 Ga0466965_0033666
568 Ga0453684_0011922
569 Ga0453684_0178840
570 Ga0466970_0054057
571 Ga0466970_0152458
572 Ga0466960_0036091
573 Ga0466959_0307950
574 Ga0451576_0507370
575 Ga0466967_0030255
576 Ga0495627_000002
577 Ga0495590_0069190
578 Ga0495596_0010040
579 Ga0495610_0000006
580 Ga0495663_0000128
581 Ga0495654_0000006
582 Ga0495609_0000047
583 Ga0495633_0000003
584 Ga0495633_0002315
585 Ga0495668_0000301
586 Ga0495625_0003536
587 Ga0495625_0079656
588 Ga0495661_0001246
589 Ga0495672_0070231
590 Ga0495686_0000017
591 Ga0495686_0000206
592 Ga0495686_0002572
593 Ga0496101_0052223
594 Ga0496110_0236253
595 Ga0496116_0000006
596 Ga0496117_0000027
597 Ga0496117_0034182
598 Ga0496118_0001435
599 Ga0496118_0002826
600 Ga0496119_0000205
601 Ga0496120_0115313
602 Ga0496121_0150624
603 Ga0496122_0000073
604 Ga0496122_0001327
605 Ga0496122_0001417
606 Ga0496122_0006041
607 Ga0496122_0032228
608 Ga0496123_0001190
609 Ga0496123_0022199
610 Ga0496123_0095077
611 Ga0496123_0114216
612 Ga0496124_0001294
613 Ga0496125_0000180
614 Ga0496125_0000622
615 Ga0496125_0001900
616 Ga0496126_0005470
617 Ga0501032_0043979
618 Ga0501033_0090126
619 Ga0501034_0011801
620 Ga0501034_0036479
621 Ga0501034_0214131
622 Ga0501034_0512978
623 Ga0501036_0339764
624 Ga0501038_0078944
625 Ga0501039_0019458
626 Ga0501040_0107162
627 Ga0501040_0177089
628 Ga0501042_0164670
629 Ga0501043_0161206
630 Ga0501048_0237222
631 Ga0501048_0297976
632 Ga0501067_0125367
633 Ga0501076_0589352
634 Ga0501081_0049145
635 Ga0501241_000399
636 Ga0501269_000428
637 Ga0501035_0161106
638 Ga0501045_0211563
639 nmdc:mga03683_110172_c1
640 nmdc:mga03n38_74446_c1
641 nmdc:mga03n38_9544_c1
642 nmdc:mga00v17_16395_c1
643 nmdc:mga00v17_42556_c1
644 nmdc:mga0yw44_106931_c1
645 nmdc:mga04h51_31155_c1
646 nmdc:mga07m45_10552_c1
647 nmdc:mga05p37_1058783_c1
648 nmdc:mga05p37_504_c1
649 nmdc:mga09592_74915_c1
650 nmdc:mga0qj67_50560_c1
651 nmdc:mga06r32_64_c1
652 nmdc:mga08y16_102203_c1
653 nmdc:mga08y16_906_c1
654 nmdc:mga0n895_95950_c1
655 nmdc:mga0a205_305774_c1
656 nmdc:mga0sz30_5629_c1
657 Ga0495595_0188973
658 Ga0495619_0069461
659 Ga0500643_087433
660 Ga0500556_0000513
661 Ga0500568_0056255
662 Ga0500604_0000235
663 Ga0500634_0000081
664 2511232502
665 2513955927
666 2514043986
667 2523470787
668 2524006796
669 2526063574
670 2585143859
671 2585158708
672 2585162995
673 2585386559
674 2585424366
675 2587681341
676 2587745869
677 2587751065
678 2587865273
679 2587944127
680 2588210067
681 2588214730
682 2588217958
683 2588222839
684 2588231325
685 2588444388
686 2590601308
687 2590613238
688 2643911275
689 2644093626
690 2644230097
691 2644323468
692 2644411337
693 2644456697
694 2645720083
695 2645726940
696 2671693326
697 2712196632
698 2729199788
699 2738699917
700 2738871840
701 2739253666
702 2740058809
703 2740061924
704 2753674335
705 2757565827
706 2765573971
707 2772605046
708 2775672130
709 2816874186
710 2840677412
711 2842086139
712 2857485708
713 2858439149
714 2871720419
715 2883072843
716 2889295532
717 2895499573
718 2895512596
719 2895522610
720 2895525628
721 2896085230
722 2906002887
723 2915611705
724 2919100556
725 2919401073
726 2932402752
727 2945926184
728 2946022435
729 2977245168
730 2984572921
731 2984610370
732 2993374466
733 2993481352
734 643598469

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00303

Thymidylat_synt

Thymidylate synthase

39

301

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bfi-assembly1.cif.gz_A-2 e. coli thymidylate synthase y209m mutant complexed with 5-nitro-dump 0.9922 3 264
3qj7-assembly2.cif.gz_B crystal structure of the mycobacterium tuberculosis thymidylate synthase (thya) bound to dump 0.9919 1 261
2g8x-assembly1.cif.gz_B escherichia coli y209w apoprotein 0.9915 4 262
1nce-assembly1.cif.gz_B crystal structure of a ternary complex of e. coli thymidylate synthase d169c with dump and the antifolate cb3717 0.9909 4 264
4fog-assembly2.cif.gz_B crystal structure of mtb thya in complex with 5-fluoro-dump and 5-methyltetrahydrofolic acid 0.9909 1 261
ID Description Score Start End Superfamily
1bo7A00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9753 2 264 3.30.572.10
3ix6B00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9751 2 251 3.30.572.10
1bo7A00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.968 2 264 3.30.572.10
6qyaC00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9623 2 262 3.30.572.10
3dgaC00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9619 2 259 3.30.572.10
ID Description Score Start End GO Terms
AF-A0A059X1I7-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9989 29 209 GO:0004799
GO:0005829
GO:0006231
GO:0032259
AF-A0A528BC42-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9986 49 237 GO:0004799
GO:0005829
GO:0006231
GO:0032259
AF-A0A059WML7-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9978 1 205 GO:0004799
GO:0005829
GO:0006231
GO:0032259
AF-A0A059WVQ7-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9978 29 201 GO:0004799
GO:0005829
GO:0006231
GO:0032259
AF-A0A2J0MA32-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9977 1 228 GO:0004799
GO:0005829
GO:0006231
GO:0032259

Map