F424232
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 367 | 290 | 734 | 263 |
Family's Representative Sequence
| Representative Sequence | 3300005289|Ga0065704_10114530|Ga0065704_101145302 |
| Length | 301 |
| Sequence | MFFLIENRNRIDMDNFKFEMKILRFVFSKFEADNFFAMQNYLDLLQHILDNGTDKTDRTGTGTRSVFGYQLRYDLSKGFPLVTTKKVHLKSIIYELLWFIKGDTNTKYLKDNGVSIWDEWADENGNLGPVYGAQWRSWNGANGKVVDQFSDVIEQIKKNPDSRRLIVSAWNAAEIPNMALAPCHALFQFYVADGKLSLQLYQRSADVFLGVPFNIASYALLLMMVAQVTGLEVGDYVHTFGDVHIYNNHFEQVQKQLSRAPRALPKMKLNPEIKDIFDFDFEDFTLENYDPHPGIKAPVAI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 7 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 9 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 35 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 38 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 39 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 40 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 41 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 42 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 43 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 44 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 45 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 46 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 47 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 48 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 49 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 50 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 51 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 68 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 69 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 77 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 80 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 81 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 114 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 115 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 116 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 117 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 118 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 119 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 120 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 121 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 122 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 123 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 124 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 125 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 126 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 127 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 128 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 129 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 130 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 131 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 132 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 133 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 134 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 135 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 136 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 137 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 138 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 139 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 140 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 141 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 142 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 143 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 144 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 145 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 146 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 147 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 148 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 149 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 150 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 151 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 152 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 153 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 154 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 155 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 156 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 170 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 171 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 172 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 173 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 174 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 175 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 176 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 177 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 178 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 179 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 180 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 181 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 182 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 196 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 197 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 200 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 201 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 202 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 203 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 204 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 205 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 206 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 208 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 209 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 210 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 211 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 212 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 213 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 216 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 217 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 218 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 219 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 220 | 2511231000 | Chryseobacterium populi CF314 | Isolate | Rhizosphere |
| 221 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 222 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 223 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 224 | 2523533629 | Kaistella palustris DSM 21579 | Isolate | Rhizosphere |
| 225 | 2524614857 | Deinococcus ficus DSM 19119 | Isolate | Rhizosphere |
| 226 | 2582581278 | Chryseobacterium sp. CF365 | Isolate | Rhizosphere |
| 227 | 2582581281 | Chryseobacterium sp. CF284 | Isolate | Rhizosphere |
| 228 | 2582581282 | Chryseobacterium sp. CF299 | Isolate | Rhizosphere |
| 229 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 230 | 2582581873 | Chryseobacterium sp. OV259 | Isolate | Rhizosphere |
| 231 | 2585428045 | Chryseobacterium sp. OV705 | Isolate | Rhizosphere |
| 232 | 2585428060 | Chryseobacterium sp. OV715 | Isolate | Rhizosphere |
| 233 | 2585428061 | Chryseobacterium sp. CF356 | Isolate | Rhizosphere |
| 234 | 2585428095 | Chryseobacterium sp. YR005 | Isolate | Rhizosphere |
| 235 | 2585428115 | Chryseobacterium sp. YR561 | Isolate | Rhizosphere |
| 236 | 2585428182 | Chryseobacterium sp. YR477 | Isolate | Rhizosphere |
| 237 | 2585428183 | Chryseobacterium sp. YR485 | Isolate | Rhizosphere |
| 238 | 2585428184 | Chryseobacterium sp. YR480 | Isolate | Rhizosphere |
| 239 | 2585428185 | Chryseobacterium sp. YR459 | Isolate | Rhizosphere |
| 240 | 2585428187 | Chryseobacterium sp. YR460 | Isolate | Rhizosphere |
| 241 | 2588253712 | Chryseobacterium sp. OV279 | Isolate | Rhizosphere |
| 242 | 2588254255 | Chryseobacterium sp. YR221 | Isolate | Rhizosphere |
| 243 | 2588254257 | Chryseobacterium sp. YR203 | Isolate | Rhizosphere |
| 244 | 2643221580 | Devosia sp. Root635 | Isolate | Unclassified |
| 245 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 246 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 247 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 248 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
| 249 | 2643221681 | Aeromicrobium sp. Root472D3 | Isolate | Unclassified |
| 250 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 251 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 252 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 253 | 2711768088 | Sporolactobacillus terrae DSM 11697 | Isolate | Rhizosphere |
| 254 | 2728369107 | Chryseobacterium kwangjuense KJ1R5 | Isolate | Unclassified |
| 255 | 2738541273 | Elizabethkingia sp. YR214 | Isolate | Unclassified |
| 256 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 257 | 2738543014 | Elizabethkingia sp. YR191 | Isolate | Unclassified |
| 258 | 2739367874 | Chryseobacterium sp. T16E-39 | Isolate | Unclassified |
| 259 | 2739367875 | Deinococcus ficus CC-FR2-10 | Isolate | Unclassified |
| 260 | 2751185877 | Chryseobacterium artocarpi UTM-3 | Isolate | Rhizosphere |
| 261 | 2757320391 | Bacillus sp. NFR08 | Isolate | Rhizoplane |
| 262 | 2765235839 | Chryseobacterium indologenes AA5 | Isolate | Unclassified |
| 263 | 2772190705 | Chryseobacterium contaminans C-26 | Isolate | Rhizosphere |
| 264 | 2775506739 | Chryseobacterium sp. 1335 | Isolate | Unclassified |
| 265 | 2816332188 | Chryseobacterium aquifrigidense 110 (version 2) | Isolate | Unclassified |
| 266 | 2840677318 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 267 | 2842083920 | Chryseobacterium lathyri KCTC 22544 | Isolate | Rhizosphere |
| 268 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 269 | 2858438669 | Leuconostoc mesenteroides YL48 | Isolate | Unclassified |
| 270 | 2871720351 | Chryseobacterium sp. KLBC 52 | Isolate | Nodule |
| 271 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 272 | 2889290771 | Chryseobacterium sp. PvR013 | Isolate | Rhizosphere |
| 273 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 274 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 275 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 276 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 277 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 278 | 2905999023 | Chryseobacterium elymi KCTC 22547 | Isolate | Rhizosphere |
| 279 | 2915606848 | Brevibacillus sp. HD1.4A | Isolate | Rhizosphere |
| 280 | 2919097161 | Chryseobacterium ginsenosidimutans 1394 | Isolate | Rhizosphere |
| 281 | 2919399522 | Chryseobacterium sp. 2987 | Isolate | Unclassified |
| 282 | 2932401849 | Devosia sp. 2618 | Isolate | Rhizosphere |
| 283 | 2945924605 | Chryseobacterium ginsenosidimutans W1I9 | Isolate | Rhizosphere |
| 284 | 2946019816 | Chryseobacterium sp. W4I1 | Isolate | Rhizosphere |
| 285 | 2977243572 | Chryseobacterium sp. SORGH_AS 447 | Isolate | Unclassified |
| 286 | 2984572630 | Chryseobacterium sp. SORGH_AS909 | Isolate | Aerial Root |
| 287 | 2984606641 | Chryseobacterium sp. SORGH_AS1175 | Isolate | Aerial Root |
| 288 | 2993372514 | Chryseobacterium sp. SLBN-27 | Isolate | Rhizosphere |
| 289 | 2993480792 | Chryseobacterium nepalense SLBN-92 | Isolate | Rhizosphere |
| 290 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 80.65 |
| Metatranscriptomes | 0 |
| Isolates | 19.35 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.54 |
| Bulb | 0 |
| Endosphere | 12.53 |
| Nodule | 1.09 |
| Rhizoplane | 1.09 |
| Rhizosphere | 70.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065704_10114530 | 3300005289 | Bacteria | 1889 |
| 2 | SwRhRL2b_contig_750015 | 2162886007 | Bacteria | 2158 |
| 3 | JGI24739J22299_10107228 | 3300001989 | Bacteria | 840 |
| 4 | JGI25151J46595_10001824 | 3300003187 | Bacteria | 13733 |
| 5 | JGI25151J46595_10013385 | 3300003187 | Bacteria | 3692 |
| 6 | rootH1_10054680 | 3300003323 | Bacteria | 8196 |
| 7 | Ga0055532_1000064 | 3300003758 | Bacteria | 143144 |
| 8 | Ga0055525_1000021 | 3300003759 | Bacteria | 370802 |
| 9 | Ga0055527_1000685 | 3300003760 | Bacteria | 10030 |
| 10 | Ga0055535_1001814 | 3300003761 | Bacteria | 9257 |
| 11 | Ga0055542_1001646 | 3300003762 | Bacteria | 10030 |
| 12 | Ga0055529_1000388 | 3300003763 | Bacteria | 47502 |
| 13 | Ga0055524_1007380 | 3300003775 | Bacteria | 4674 |
| 14 | Ga0055530_10001698 | 3300003791 | Bacteria | 15597 |
| 15 | Ga0065714_10065189 | 3300005288 | Bacteria | 12111 |
| 16 | Ga0065704_10074612 | 3300005289 | Bacteria | 6137 |
| 17 | Ga0065704_10074747 | 3300005289 | Bacteria | 6041 |
| 18 | Ga0070658_10108996 | 3300005327 | Bacteria | 2292 |
| 19 | Ga0070683_100001412 | 3300005329 | Bacteria | 18434 |
| 20 | Ga0070683_100442482 | 3300005329 | Bacteria | 1240 |
| 21 | Ga0070682_100000005 | 3300005337 | Bacteria | 386439 |
| 22 | Ga0070682_100000238 | 3300005337 | Bacteria | 39996 |
| 23 | Ga0070682_100017081 | 3300005337 | Bacteria | 4227 |
| 24 | Ga0068868_100204626 | 3300005338 | Bacteria | 1647 |
| 25 | Ga0070660_100034428 | 3300005339 | Bacteria | 3827 |
| 26 | Ga0070689_100372382 | 3300005340 | Bacteria | 1202 |
| 27 | Ga0070668_100039712 | 3300005347 | Bacteria | 3599 |
| 28 | Ga0070668_100094610 | 3300005347 | Bacteria | 2359 |
| 29 | Ga0070667_100153116 | 3300005367 | Bacteria | 2027 |
| 30 | Ga0070711_100366113 | 3300005439 | Bacteria | 1162 |
| 31 | Ga0070700_100471067 | 3300005441 | Bacteria | 960 |
| 32 | Ga0070663_100202714 | 3300005455 | Bacteria | 1549 |
| 33 | Ga0070681_10148686 | 3300005458 | Bacteria | 2270 |
| 34 | Ga0068867_100098223 | 3300005459 | Bacteria | 2232 |
| 35 | Ga0070679_100005027 | 3300005530 | Bacteria | 12206 |
| 36 | Ga0070679_100041314 | 3300005530 | Bacteria | 4590 |
| 37 | Ga0070679_100493433 | 3300005530 | Bacteria | 1169 |
| 38 | Ga0070684_100046851 | 3300005535 | Bacteria | 3746 |
| 39 | Ga0068853_100153789 | 3300005539 | Bacteria | 2072 |
| 40 | Ga0070672_100441089 | 3300005543 | Bacteria | 1120 |
| 41 | Ga0070665_100312549 | 3300005548 | Bacteria | 1575 |
| 42 | Ga0068855_100022034 | 3300005563 | Bacteria | 7638 |
| 43 | Ga0068854_100111733 | 3300005578 | Bacteria | 2062 |
| 44 | Ga0070702_100023774 | 3300005615 | Bacteria | 3260 |
| 45 | Ga0068852_100010167 | 3300005616 | Bacteria | 7011 |
| 46 | Ga0068852_100048097 | 3300005616 | Bacteria | 3643 |
| 47 | Ga0068859_100000522 | 3300005617 | Bacteria | 38186 |
| 48 | Ga0068864_100089505 | 3300005618 | Bacteria | 2712 |
| 49 | Ga0068851_10105916 | 3300005834 | Bacteria | 1497 |
| 50 | Ga0068860_100002199 | 3300005843 | Bacteria | 20515 |
| 51 | Ga0075365_10005655 | 3300006038 | Bacteria | 6770 |
| 52 | Ga0075365_10022323 | 3300006038 | Bacteria | 3964 |
| 53 | Ga0075368_10018688 | 3300006042 | Bacteria | 2607 |
| 54 | Ga0075363_100002471 | 3300006048 | Bacteria | 7560 |
| 55 | Ga0075364_10119037 | 3300006051 | Bacteria | 1767 |
| 56 | Ga0075369_10011520 | 3300006186 | Bacteria | 3481 |
| 57 | Ga0075370_10010103 | 3300006353 | Bacteria | 4923 |
| 58 | Ga0075428_100000205 | 3300006844 | Bacteria | 56652 |
| 59 | Ga0075431_100000119 | 3300006847 | Bacteria | 51177 |
| 60 | Ga0075434_100244923 | 3300006871 | Bacteria | 1813 |
| 61 | Ga0075429_100001803 | 3300006880 | Bacteria | 17742 |
| 62 | Ga0075429_100228962 | 3300006880 | Bacteria | 1628 |
| 63 | Ga0097620_100000522 | 3300006931 | Bacteria | 38186 |
| 64 | Ga0105244_10000001 | 3300009036 | Bacteria | 1034899 |
| 65 | Ga0111539_10001586 | 3300009094 | Bacteria | 30280 |
| 66 | Ga0111539_10043635 | 3300009094 | Bacteria | 5374 |
| 67 | Ga0114129_10000640 | 3300009147 | Bacteria | 43706 |
| 68 | Ga0105243_10002198 | 3300009148 | Bacteria | 16443 |
| 69 | Ga0105243_10182855 | 3300009148 | Bacteria | 1825 |
| 70 | Ga0105241_10072493 | 3300009174 | Bacteria | 2677 |
| 71 | Ga0105237_10020546 | 3300009545 | Bacteria | 6805 |
| 72 | Ga0105239_10276836 | 3300010375 | Bacteria | 1888 |
| 73 | Ga0157373_10000004 | 3300013100 | Bacteria | 275553 |
| 74 | Ga0157371_10000201 | 3300013102 | Bacteria | 87780 |
| 75 | Ga0157371_10144213 | 3300013102 | Bacteria | 1697 |
| 76 | Ga0157370_10010456 | 3300013104 | Bacteria | 9777 |
| 77 | Ga0157370_10042623 | 3300013104 | Bacteria | 4372 |
| 78 | Ga0157370_10078585 | 3300013104 | Bacteria | 3107 |
| 79 | Ga0157370_10211808 | 3300013104 | Bacteria | 1796 |
| 80 | Ga0157370_10212102 | 3300013104 | Bacteria | 1795 |
| 81 | Ga0157369_10000815 | 3300013105 | Bacteria | 39822 |
| 82 | Ga0157369_10051022 | 3300013105 | Bacteria | 4478 |
| 83 | Ga0157369_10064575 | 3300013105 | Bacteria | 3942 |
| 84 | Ga0157369_10099528 | 3300013105 | Bacteria | 3099 |
| 85 | Ga0163162_10335495 | 3300013306 | Bacteria | 1644 |
| 86 | Ga0157372_10041116 | 3300013307 | Bacteria | 5110 |
| 87 | Ga0157375_10001608 | 3300013308 | Bacteria | 19412 |
| 88 | Ga0157375_10035257 | 3300013308 | Bacteria | 4774 |
| 89 | Ga0157375_10319052 | 3300013308 | Bacteria | 1718 |
| 90 | Ga0157375_10866636 | 3300013308 | Bacteria | 1049 |
| 91 | Ga0163163_10065261 | 3300014325 | Bacteria | 3613 |
| 92 | Ga0163163_10206434 | 3300014325 | Bacteria | 2013 |
| 93 | Ga0182008_10000007 | 3300014497 | Bacteria | 372461 |
| 94 | Ga0182006_1000003 | 3300015261 | Bacteria | 826681 |
| 95 | Ga0163161_10000884 | 3300017792 | Bacteria | 23288 |
| 96 | Ga0163161_10008842 | 3300017792 | Bacteria | 6965 |
| 97 | Ga0209672_100005 | 3300025228 | Bacteria | 1069303 |
| 98 | Ga0209147_100014 | 3300025229 | Bacteria | 597841 |
| 99 | Ga0209563_100005 | 3300025230 | Bacteria | 1774893 |
| 100 | Ga0209563_100023 | 3300025230 | Bacteria | 636844 |
| 101 | Ga0209258_100006 | 3300025242 | Bacteria | 1069303 |
| 102 | Ga0209148_1000012 | 3300025254 | Bacteria | 1069303 |
| 103 | Ga0209455_1000008 | 3300025272 | Bacteria | 1069303 |
| 104 | Ga0209675_1000057 | 3300025291 | Bacteria | 185467 |
| 105 | Ga0209676_1009066 | 3300025292 | Bacteria | 4343 |
| 106 | Ga0209025_1000564 | 3300025294 | Bacteria | 67936 |
| 107 | Ga0209025_1001125 | 3300025294 | Bacteria | 38283 |
| 108 | Ga0209564_1018170 | 3300025295 | Bacteria | 2695 |
| 109 | Ga0209256_1008122 | 3300025299 | Bacteria | 4945 |
| 110 | Ga0209051_1031992 | 3300025303 | Bacteria | 2014 |
| 111 | Ga0209257_1004746 | 3300025304 | Bacteria | 10154 |
| 112 | Ga0207655_1000013 | 3300025728 | Bacteria | 637510 |
| 113 | Ga0207705_10057300 | 3300025909 | Bacteria | 2810 |
| 114 | Ga0207707_10118402 | 3300025912 | Bacteria | 2315 |
| 115 | Ga0207707_10323477 | 3300025912 | Bacteria | 1331 |
| 116 | Ga0207695_10026281 | 3300025913 | Bacteria | 6498 |
| 117 | Ga0207695_10047555 | 3300025913 | Bacteria | 4539 |
| 118 | Ga0207657_10043680 | 3300025919 | Bacteria | 3946 |
| 119 | Ga0207657_10073406 | 3300025919 | Bacteria | 2891 |
| 120 | Ga0207652_10001352 | 3300025921 | Bacteria | 21786 |
| 121 | Ga0207652_10032499 | 3300025921 | Bacteria | 4388 |
| 122 | Ga0207650_10281908 | 3300025925 | Bacteria | 1353 |
| 123 | Ga0207709_10000149 | 3300025935 | Bacteria | 96374 |
| 124 | Ga0207709_10117270 | 3300025935 | Bacteria | 1791 |
| 125 | Ga0207670_10313864 | 3300025936 | Bacteria | 1232 |
| 126 | Ga0207661_10001192 | 3300025944 | Bacteria | 17402 |
| 127 | Ga0207667_10035659 | 3300025949 | Bacteria | 5336 |
| 128 | Ga0207668_10029234 | 3300025972 | Bacteria | 3611 |
| 129 | Ga0207668_10088378 | 3300025972 | Bacteria | 2269 |
| 130 | Ga0207658_10162654 | 3300025986 | Bacteria | 1831 |
| 131 | Ga0207639_10131546 | 3300026041 | Bacteria | 2072 |
| 132 | Ga0207678_10394465 | 3300026067 | Bacteria | 1198 |
| 133 | Ga0207648_10097844 | 3300026089 | Bacteria | 2568 |
| 134 | Ga0207676_10049085 | 3300026095 | Bacteria | 3281 |
| 135 | Ga0207698_10002164 | 3300026142 | Bacteria | 11607 |
| 136 | Ga0209969_1005687 | 3300027360 | Bacteria | 1753 |
| 137 | Ga0209967_1001865 | 3300027364 | Bacteria | 2708 |
| 138 | Ga0209984_1002993 | 3300027424 | Bacteria | 1910 |
| 139 | Ga0210000_1006946 | 3300027462 | Bacteria | 1652 |
| 140 | Ga0209995_1028714 | 3300027471 | Bacteria | 929 |
| 141 | Ga0209999_1003781 | 3300027543 | Bacteria | 2715 |
| 142 | Ga0209982_1000931 | 3300027552 | Bacteria | 3856 |
| 143 | Ga0209983_1000298 | 3300027665 | Bacteria | 10335 |
| 144 | Ga0209971_1000333 | 3300027682 | Bacteria | 13030 |
| 145 | Ga0209974_10001733 | 3300027876 | Bacteria | 7924 |
| 146 | Ga0268266_10265505 | 3300028379 | Bacteria | 1592 |
| 147 | Ga0268265_10099440 | 3300028380 | Bacteria | 2345 |
| 148 | Ga0268265_10814625 | 3300028380 | Bacteria | 911 |
| 149 | Ga0265331_10021642 | 3300031250 | Bacteria | 3288 |
| 150 | Ga0265327_10000139 | 3300031251 | Bacteria | 159492 |
| 151 | Ga0316579_10094330 | 3300031691 | Bacteria | 1430 |
| 152 | Ga0316578_10147716 | 3300031728 | Bacteria | 1416 |
| 153 | Ga0307516_10314317 | 3300031730 | Bacteria | 1239 |
| 154 | Ga0307405_10361931 | 3300031731 | Bacteria | 1123 |
| 155 | Ga0316577_10044102 | 3300031733 | Bacteria | 2494 |
| 156 | Ga0307413_10151011 | 3300031824 | Bacteria | 1619 |
| 157 | Ga0307410_10339557 | 3300031852 | Bacteria | 1197 |
| 158 | Ga0307406_10311482 | 3300031901 | Bacteria | 1214 |
| 159 | Ga0307407_10221075 | 3300031903 | Bacteria | 1281 |
| 160 | Ga0307407_10399579 | 3300031903 | Bacteria | 985 |
| 161 | Ga0307412_10000102 | 3300031911 | Bacteria | 69906 |
| 162 | Ga0307412_10000900 | 3300031911 | Bacteria | 17099 |
| 163 | Ga0307412_10003100 | 3300031911 | Bacteria | 9229 |
| 164 | Ga0307412_10165057 | 3300031911 | Bacteria | 1650 |
| 165 | Ga0307412_10342098 | 3300031911 | Bacteria | 1198 |
| 166 | Ga0307409_100789405 | 3300031995 | Bacteria | 956 |
| 167 | Ga0307409_101076733 | 3300031995 | Bacteria | 824 |
| 168 | Ga0307416_100000031 | 3300032002 | Bacteria | 159059 |
| 169 | Ga0307416_100387855 | 3300032002 | Bacteria | 1430 |
| 170 | Ga0307416_100570074 | 3300032002 | Bacteria | 1208 |
| 171 | Ga0307414_10000010 | 3300032004 | Bacteria | 357863 |
| 172 | Ga0307414_10005674 | 3300032004 | Bacteria | 6889 |
| 173 | Ga0307414_10006175 | 3300032004 | Bacteria | 6660 |
| 174 | Ga0307414_10189866 | 3300032004 | Bacteria | 1661 |
| 175 | Ga0307414_10401427 | 3300032004 | Bacteria | 1191 |
| 176 | Ga0307414_10452263 | 3300032004 | Bacteria | 1126 |
| 177 | Ga0307411_10221589 | 3300032005 | Bacteria | 1468 |
| 178 | Ga0307411_10406625 | 3300032005 | Bacteria | 1127 |
| 179 | Ga0307415_100499543 | 3300032126 | Bacteria | 1063 |
| 180 | Ga0316583_10003601 | 3300032133 | Bacteria | 5472 |
| 181 | Ga0316580_10040752 | 3300032139 | Bacteria | 1435 |
| 182 | Ga0316582_0067957 | 3300036647 | Bacteria | 2300 |
| 183 | Ga0316584_0083544 | 3300036712 | Bacteria | 2392 |
| 184 | Ga0316584_0113145 | 3300036712 | Bacteria | 2031 |
| 185 | Ga0395900_0025688 | 3300037418 | Bacteria | 6030 |
| 186 | Ga0395898_0190338 | 3300037466 | Bacteria | 1960 |
| 187 | Ga0395901_0500181 | 3300038443 | Bacteria | 1237 |
| 188 | Ga0436365_0691100 | 3300039437 | Bacteria | 2328 |
| 189 | Ga0439465_0002051 | 3300041413 | Bacteria | 6606 |
| 190 | Ga0451795_1594654 | 3300041456 | Bacteria | 1162 |
| 191 | Ga0451837_0842085 | 3300041494 | Bacteria | 1204 |
| 192 | Ga0451839_1056440 | 3300041496 | Bacteria | 3048 |
| 193 | Ga0451853_0562319 | 3300041512 | Bacteria | 1757 |
| 194 | Ga0439445_0000217 | 3300042004 | Bacteria | 10610 |
| 195 | Ga0439449_0015560 | 3300042007 | Bacteria | 2859 |
| 196 | Ga0439457_035726 | 3300042014 | Bacteria | 1105 |
| 197 | Ga0450904_005604 | 3300042139 | Bacteria | 1265 |
| 198 | Ga0451577_0153059 | 3300042876 | Bacteria | 2075 |
| 199 | Ga0466977_0011435 | 3300044666 | Bacteria | 5108 |
| 200 | Ga0466965_0033666 | 3300044683 | Bacteria | 2505 |
| 201 | Ga0453684_0011922 | 3300044712 | Bacteria | 14473 |
| 202 | Ga0453684_0178840 | 3300044712 | Bacteria | 2492 |
| 203 | Ga0466970_0054057 | 3300044765 | Bacteria | 2144 |
| 204 | Ga0466970_0152458 | 3300044765 | Bacteria | 1276 |
| 205 | Ga0466960_0036091 | 3300044901 | Bacteria | 2314 |
| 206 | Ga0466959_0307950 | 3300045049 | Bacteria | 1084 |
| 207 | Ga0451576_0507370 | 3300045051 | Bacteria | 1267 |
| 208 | Ga0466967_0030255 | 3300045976 | Bacteria | 4542 |
| 209 | Ga0495627_000002 | 3300046453 | Bacteria | 903861 |
| 210 | Ga0495590_0069190 | 3300046457 | Bacteria | 1237 |
| 211 | Ga0495596_0010040 | 3300046500 | Bacteria | 4140 |
| 212 | Ga0495610_0000006 | 3300046512 | Bacteria | 856822 |
| 213 | Ga0495663_0000128 | 3300046525 | Bacteria | 31809 |
| 214 | Ga0495654_0000006 | 3300046530 | Bacteria | 451432 |
| 215 | Ga0495609_0000047 | 3300046538 | Bacteria | 156247 |
| 216 | Ga0495633_0000003 | 3300046558 | Bacteria | 472476 |
| 217 | Ga0495633_0002315 | 3300046558 | Bacteria | 13577 |
| 218 | Ga0495668_0000301 | 3300046616 | Bacteria | 68097 |
| 219 | Ga0495625_0003536 | 3300046660 | Bacteria | 15468 |
| 220 | Ga0495625_0079656 | 3300046660 | Bacteria | 2283 |
| 221 | Ga0495661_0001246 | 3300046665 | Bacteria | 21980 |
| 222 | Ga0495672_0070231 | 3300047320 | Bacteria | 1985 |
| 223 | Ga0495686_0000017 | 3300047472 | Bacteria | 435554 |
| 224 | Ga0495686_0000206 | 3300047472 | Bacteria | 110350 |
| 225 | Ga0495686_0002572 | 3300047472 | Bacteria | 16900 |
| 226 | Ga0496101_0052223 | 3300048904 | Bacteria | 2947 |
| 227 | Ga0496110_0236253 | 3300048913 | Bacteria | 1663 |
| 228 | Ga0496116_0000006 | 3300048919 | Bacteria | 811937 |
| 229 | Ga0496117_0000027 | 3300048920 | Bacteria | 412234 |
| 230 | Ga0496117_0034182 | 3300048920 | Bacteria | 3835 |
| 231 | Ga0496118_0001435 | 3300048921 | Bacteria | 35889 |
| 232 | Ga0496118_0002826 | 3300048921 | Bacteria | 22723 |
| 233 | Ga0496119_0000205 | 3300048922 | Bacteria | 84036 |
| 234 | Ga0496120_0115313 | 3300048923 | Bacteria | 1397 |
| 235 | Ga0496121_0150624 | 3300048924 | Bacteria | 1712 |
| 236 | Ga0496122_0000073 | 3300048925 | Bacteria | 222403 |
| 237 | Ga0496122_0001327 | 3300048925 | Bacteria | 40506 |
| 238 | Ga0496122_0001417 | 3300048925 | Bacteria | 38842 |
| 239 | Ga0496122_0006041 | 3300048925 | Bacteria | 14120 |
| 240 | Ga0496122_0032228 | 3300048925 | Bacteria | 4339 |
| 241 | Ga0496123_0001190 | 3300048926 | Bacteria | 38293 |
| 242 | Ga0496123_0022199 | 3300048926 | Bacteria | 4900 |
| 243 | Ga0496123_0095077 | 3300048926 | Bacteria | 1754 |
| 244 | Ga0496123_0114216 | 3300048926 | Bacteria | 1536 |
| 245 | Ga0496124_0001294 | 3300048927 | Bacteria | 37979 |
| 246 | Ga0496125_0000180 | 3300048928 | Bacteria | 138952 |
| 247 | Ga0496125_0000622 | 3300048928 | Bacteria | 59554 |
| 248 | Ga0496125_0001900 | 3300048928 | Bacteria | 28607 |
| 249 | Ga0496126_0005470 | 3300048929 | Bacteria | 14481 |
| 250 | Ga0501032_0043979 | 3300049569 | Bacteria | 3023 |
| 251 | Ga0501033_0090126 | 3300049570 | Bacteria | 2243 |
| 252 | Ga0501034_0011801 | 3300049571 | Bacteria | 9042 |
| 253 | Ga0501034_0036479 | 3300049571 | Bacteria | 4980 |
| 254 | Ga0501034_0214131 | 3300049571 | Bacteria | 1881 |
| 255 | Ga0501034_0512978 | 3300049571 | Bacteria | 1111 |
| 256 | Ga0501036_0339764 | 3300049572 | Bacteria | 1254 |
| 257 | Ga0501038_0078944 | 3300049574 | Bacteria | 2776 |
| 258 | Ga0501039_0019458 | 3300049575 | Bacteria | 5206 |
| 259 | Ga0501040_0107162 | 3300049576 | Bacteria | 1953 |
| 260 | Ga0501040_0177089 | 3300049576 | Bacteria | 1511 |
| 261 | Ga0501042_0164670 | 3300049578 | Bacteria | 1600 |
| 262 | Ga0501043_0161206 | 3300049579 | Bacteria | 1752 |
| 263 | Ga0501048_0237222 | 3300049582 | Bacteria | 1294 |
| 264 | Ga0501048_0297976 | 3300049582 | Bacteria | 1147 |
| 265 | Ga0501067_0125367 | 3300049583 | Bacteria | 1429 |
| 266 | Ga0501076_0589352 | 3300049592 | Bacteria | 917 |
| 267 | Ga0501081_0049145 | 3300049743 | Bacteria | 2904 |
| 268 | Ga0501241_000399 | 3300049758 | Bacteria | 9520 |
| 269 | Ga0501269_000428 | 3300049766 | Bacteria | 9482 |
| 270 | Ga0501035_0161106 | 3300049822 | Bacteria | 1942 |
| 271 | Ga0501045_0211563 | 3300049824 | Bacteria | 1444 |
| 272 | nmdc:mga03683_110172_c1 | 3300050489 | Bacteria | 1216 |
| 273 | nmdc:mga03n38_74446_c1 | 3300050490 | Bacteria | 1579 |
| 274 | nmdc:mga03n38_9544_c1 | 3300050490 | Bacteria | 3536 |
| 275 | nmdc:mga00v17_16395_c1 | 3300050491 | Bacteria | 4175 |
| 276 | nmdc:mga00v17_42556_c1 | 3300050491 | Bacteria | 2733 |
| 277 | nmdc:mga0yw44_106931_c1 | 3300050492 | Bacteria | 1789 |
| 278 | nmdc:mga04h51_31155_c1 | 3300050495 | Bacteria | 1684 |
| 279 | nmdc:mga07m45_10552_c1 | 3300050496 | Bacteria | 4829 |
| 280 | nmdc:mga05p37_1058783_c1 | 3300050507 | Bacteria | 854 |
| 281 | nmdc:mga05p37_504_c1 | 3300050507 | Bacteria | 43013 |
| 282 | nmdc:mga09592_74915_c1 | 3300050508 | Bacteria | 2877 |
| 283 | nmdc:mga0qj67_50560_c1 | 3300050509 | Bacteria | 3287 |
| 284 | nmdc:mga06r32_64_c1 | 3300050510 | Bacteria | 67984 |
| 285 | nmdc:mga08y16_102203_c1 | 3300050511 | Bacteria | 2984 |
| 286 | nmdc:mga08y16_906_c1 | 3300050511 | Bacteria | 28665 |
| 287 | nmdc:mga0n895_95950_c1 | 3300050512 | Bacteria | 2970 |
| 288 | nmdc:mga0a205_305774_c1 | 3300050515 | Bacteria | 1462 |
| 289 | nmdc:mga0sz30_5629_c1 | 3300050516 | Bacteria | 4604 |
| 290 | Ga0495595_0188973 | 3300053084 | Bacteria | 1023 |
| 291 | Ga0495619_0069461 | 3300053085 | Bacteria | 2355 |
| 292 | Ga0500643_087433 | 3300053087 | Bacteria | 852 |
| 293 | Ga0500556_0000513 | 3300053104 | Bacteria | 26475 |
| 294 | Ga0500568_0056255 | 3300053139 | Bacteria | 1534 |
| 295 | Ga0500604_0000235 | 3300053151 | Bacteria | 15825 |
| 296 | Ga0500634_0000081 | 3300053161 | Bacteria | 37292 |
| 297 | 2511232502 | 2511231000 | Bacteria | 4488346 |
| 298 | 2513955927 | 2513237150 | Bacteria | 6553639 |
| 299 | 2514043986 | 2513237165 | Bacteria | 6771773 |
| 300 | 2523470787 | 2523231067 | Bacteria | 5230452 |
| 301 | 2524006796 | 2523533629 | Bacteria | 2982326 |
| 302 | 2526063574 | 2524614857 | Bacteria | 4146328 |
| 303 | 2585143859 | 2582581278 | Bacteria | 5296881 |
| 304 | 2585158708 | 2582581281 | Bacteria | 4487904 |
| 305 | 2585162995 | 2582581282 | Bacteria | 4495830 |
| 306 | 2585386559 | 2582581865 | Bacteria | 6644329 |
| 307 | 2585424366 | 2582581873 | Bacteria | 3032664 |
| 308 | 2587681341 | 2585428045 | Bacteria | 5203023 |
| 309 | 2587745869 | 2585428060 | Bacteria | 5304711 |
| 310 | 2587751065 | 2585428061 | Bacteria | 3939663 |
| 311 | 2587865273 | 2585428095 | Bacteria | 3789702 |
| 312 | 2587944127 | 2585428115 | Bacteria | 4420269 |
| 313 | 2588210067 | 2585428182 | Bacteria | 5007281 |
| 314 | 2588214730 | 2585428183 | Bacteria | 5166119 |
| 315 | 2588217958 | 2585428184 | Bacteria | 4978681 |
| 316 | 2588222839 | 2585428185 | Bacteria | 4969476 |
| 317 | 2588231325 | 2585428187 | Bacteria | 4629388 |
| 318 | 2588444388 | 2588253712 | Bacteria | 5403181 |
| 319 | 2590601308 | 2588254255 | Bacteria | 5014294 |
| 320 | 2590613238 | 2588254257 | Bacteria | 5436094 |
| 321 | 2643911275 | 2643221580 | Bacteria | 3816678 |
| 322 | 2644093626 | 2643221615 | Bacteria | 5487866 |
| 323 | 2644230097 | 2643221641 | Bacteria | 4490190 |
| 324 | 2644323468 | 2643221657 | Bacteria | 5490246 |
| 325 | 2644411337 | 2643221674 | Bacteria | 3919126 |
| 326 | 2644456697 | 2643221681 | Bacteria | 3707866 |
| 327 | 2645720083 | 2643221961 | Bacteria | 3919167 |
| 328 | 2645726940 | 2643221962 | Bacteria | 3874254 |
| 329 | 2671693326 | 2671180139 | Bacteria | 4196045 |
| 330 | 2712196632 | 2711768088 | Bacteria | 3195027 |
| 331 | 2729199788 | 2728369107 | Bacteria | 5082720 |
| 332 | 2738699917 | 2738541273 | Bacteria | 4048577 |
| 333 | 2738871840 | 2738541305 | Bacteria | 4910150 |
| 334 | 2739253666 | 2738543014 | Bacteria | 4048139 |
| 335 | 2740058809 | 2739367874 | Bacteria | 4872888 |
| 336 | 2740061924 | 2739367875 | Bacteria | 4157290 |
| 337 | 2753674335 | 2751185877 | Bacteria | 4921427 |
| 338 | 2757565827 | 2757320391 | Bacteria | 4746095 |
| 339 | 2765573971 | 2765235839 | Bacteria | 5314748 |
| 340 | 2772605046 | 2772190705 | Bacteria | 4666226 |
| 341 | 2775672130 | 2775506739 | Bacteria | 3855222 |
| 342 | 2816874186 | 2816332188 | Bacteria | 5133218 |
| 343 | 2840677412 | 2840677318 | Bacteria | 2664183 |
| 344 | 2842086139 | 2842083920 | Bacteria | 4857652 |
| 345 | 2857485708 | 2857481737 | Bacteria | 4761446 |
| 346 | 2858439149 | 2858438669 | Bacteria | 2058402 |
| 347 | 2871720419 | 2871720351 | Bacteria | 4862476 |
| 348 | 2883072843 | 2883068021 | Bacteria | 6192739 |
| 349 | 2889295532 | 2889290771 | Bacteria | 5530962 |
| 350 | 2895499573 | 2895498888 | Bacteria | 5283788 |
| 351 | 2895512596 | 2895511927 | Bacteria | 6802080 |
| 352 | 2895522610 | 2895522137 | Bacteria | 3284416 |
| 353 | 2895525628 | 2895525241 | Bacteria | 3388457 |
| 354 | 2896085230 | 2896085136 | Bacteria | 6129793 |
| 355 | 2906002887 | 2905999023 | Bacteria | 4591259 |
| 356 | 2915611705 | 2915606848 | Bacteria | 6032732 |
| 357 | 2919100556 | 2919097161 | Bacteria | 3860339 |
| 358 | 2919401073 | 2919399522 | Bacteria | 5164947 |
| 359 | 2932402752 | 2932401849 | Bacteria | 4262978 |
| 360 | 2945926184 | 2945924605 | Bacteria | 4296724 |
| 361 | 2946022435 | 2946019816 | Bacteria | 4621265 |
| 362 | 2977245168 | 2977243572 | Bacteria | 4374394 |
| 363 | 2984572921 | 2984572630 | Bacteria | 4186940 |
| 364 | 2984610370 | 2984606641 | Bacteria | 4186971 |
| 365 | 2993374466 | 2993372514 | Bacteria | 4214139 |
| 366 | 2993481352 | 2993480792 | Bacteria | 4022225 |
| 367 | 643598469 | 643348564 | Bacteria | 8839022 |
| 368 | Ga0065704_10114530 | |||
| 369 | SwRhRL2b_contig_750015 | |||
| 370 | JGI24739J22299_10107228 | |||
| 371 | JGI25151J46595_10001824 | |||
| 372 | JGI25151J46595_10013385 | |||
| 373 | rootH1_10054680 | |||
| 374 | Ga0055532_1000064 | |||
| 375 | Ga0055525_1000021 | |||
| 376 | Ga0055527_1000685 | |||
| 377 | Ga0055535_1001814 | |||
| 378 | Ga0055542_1001646 | |||
| 379 | Ga0055529_1000388 | |||
| 380 | Ga0055524_1007380 | |||
| 381 | Ga0055530_10001698 | |||
| 382 | Ga0065714_10065189 | |||
| 383 | Ga0065704_10074612 | |||
| 384 | Ga0065704_10074747 | |||
| 385 | Ga0070658_10108996 | |||
| 386 | Ga0070683_100001412 | |||
| 387 | Ga0070683_100442482 | |||
| 388 | Ga0070682_100000005 | |||
| 389 | Ga0070682_100000238 | |||
| 390 | Ga0070682_100017081 | |||
| 391 | Ga0068868_100204626 | |||
| 392 | Ga0070660_100034428 | |||
| 393 | Ga0070689_100372382 | |||
| 394 | Ga0070668_100039712 | |||
| 395 | Ga0070668_100094610 | |||
| 396 | Ga0070667_100153116 | |||
| 397 | Ga0070711_100366113 | |||
| 398 | Ga0070700_100471067 | |||
| 399 | Ga0070663_100202714 | |||
| 400 | Ga0070681_10148686 | |||
| 401 | Ga0068867_100098223 | |||
| 402 | Ga0070679_100005027 | |||
| 403 | Ga0070679_100041314 | |||
| 404 | Ga0070679_100493433 | |||
| 405 | Ga0070684_100046851 | |||
| 406 | Ga0068853_100153789 | |||
| 407 | Ga0070672_100441089 | |||
| 408 | Ga0070665_100312549 | |||
| 409 | Ga0068855_100022034 | |||
| 410 | Ga0068854_100111733 | |||
| 411 | Ga0070702_100023774 | |||
| 412 | Ga0068852_100010167 | |||
| 413 | Ga0068852_100048097 | |||
| 414 | Ga0068859_100000522 | |||
| 415 | Ga0068864_100089505 | |||
| 416 | Ga0068851_10105916 | |||
| 417 | Ga0068860_100002199 | |||
| 418 | Ga0075365_10005655 | |||
| 419 | Ga0075365_10022323 | |||
| 420 | Ga0075368_10018688 | |||
| 421 | Ga0075363_100002471 | |||
| 422 | Ga0075364_10119037 | |||
| 423 | Ga0075369_10011520 | |||
| 424 | Ga0075370_10010103 | |||
| 425 | Ga0075428_100000205 | |||
| 426 | Ga0075431_100000119 | |||
| 427 | Ga0075434_100244923 | |||
| 428 | Ga0075429_100001803 | |||
| 429 | Ga0075429_100228962 | |||
| 430 | Ga0097620_100000522 | |||
| 431 | Ga0105244_10000001 | |||
| 432 | Ga0111539_10001586 | |||
| 433 | Ga0111539_10043635 | |||
| 434 | Ga0114129_10000640 | |||
| 435 | Ga0105243_10002198 | |||
| 436 | Ga0105243_10182855 | |||
| 437 | Ga0105241_10072493 | |||
| 438 | Ga0105237_10020546 | |||
| 439 | Ga0105239_10276836 | |||
| 440 | Ga0157373_10000004 | |||
| 441 | Ga0157371_10000201 | |||
| 442 | Ga0157371_10144213 | |||
| 443 | Ga0157370_10010456 | |||
| 444 | Ga0157370_10042623 | |||
| 445 | Ga0157370_10078585 | |||
| 446 | Ga0157370_10211808 | |||
| 447 | Ga0157370_10212102 | |||
| 448 | Ga0157369_10000815 | |||
| 449 | Ga0157369_10051022 | |||
| 450 | Ga0157369_10064575 | |||
| 451 | Ga0157369_10099528 | |||
| 452 | Ga0163162_10335495 | |||
| 453 | Ga0157372_10041116 | |||
| 454 | Ga0157375_10001608 | |||
| 455 | Ga0157375_10035257 | |||
| 456 | Ga0157375_10319052 | |||
| 457 | Ga0157375_10866636 | |||
| 458 | Ga0163163_10065261 | |||
| 459 | Ga0163163_10206434 | |||
| 460 | Ga0182008_10000007 | |||
| 461 | Ga0182006_1000003 | |||
| 462 | Ga0163161_10000884 | |||
| 463 | Ga0163161_10008842 | |||
| 464 | Ga0209672_100005 | |||
| 465 | Ga0209147_100014 | |||
| 466 | Ga0209563_100005 | |||
| 467 | Ga0209563_100023 | |||
| 468 | Ga0209258_100006 | |||
| 469 | Ga0209148_1000012 | |||
| 470 | Ga0209455_1000008 | |||
| 471 | Ga0209675_1000057 | |||
| 472 | Ga0209676_1009066 | |||
| 473 | Ga0209025_1000564 | |||
| 474 | Ga0209025_1001125 | |||
| 475 | Ga0209564_1018170 | |||
| 476 | Ga0209256_1008122 | |||
| 477 | Ga0209051_1031992 | |||
| 478 | Ga0209257_1004746 | |||
| 479 | Ga0207655_1000013 | |||
| 480 | Ga0207705_10057300 | |||
| 481 | Ga0207707_10118402 | |||
| 482 | Ga0207707_10323477 | |||
| 483 | Ga0207695_10026281 | |||
| 484 | Ga0207695_10047555 | |||
| 485 | Ga0207657_10043680 | |||
| 486 | Ga0207657_10073406 | |||
| 487 | Ga0207652_10001352 | |||
| 488 | Ga0207652_10032499 | |||
| 489 | Ga0207650_10281908 | |||
| 490 | Ga0207709_10000149 | |||
| 491 | Ga0207709_10117270 | |||
| 492 | Ga0207670_10313864 | |||
| 493 | Ga0207661_10001192 | |||
| 494 | Ga0207667_10035659 | |||
| 495 | Ga0207668_10029234 | |||
| 496 | Ga0207668_10088378 | |||
| 497 | Ga0207658_10162654 | |||
| 498 | Ga0207639_10131546 | |||
| 499 | Ga0207678_10394465 | |||
| 500 | Ga0207648_10097844 | |||
| 501 | Ga0207676_10049085 | |||
| 502 | Ga0207698_10002164 | |||
| 503 | Ga0209969_1005687 | |||
| 504 | Ga0209967_1001865 | |||
| 505 | Ga0209984_1002993 | |||
| 506 | Ga0210000_1006946 | |||
| 507 | Ga0209995_1028714 | |||
| 508 | Ga0209999_1003781 | |||
| 509 | Ga0209982_1000931 | |||
| 510 | Ga0209983_1000298 | |||
| 511 | Ga0209971_1000333 | |||
| 512 | Ga0209974_10001733 | |||
| 513 | Ga0268266_10265505 | |||
| 514 | Ga0268265_10099440 | |||
| 515 | Ga0268265_10814625 | |||
| 516 | Ga0265331_10021642 | |||
| 517 | Ga0265327_10000139 | |||
| 518 | Ga0316579_10094330 | |||
| 519 | Ga0316578_10147716 | |||
| 520 | Ga0307516_10314317 | |||
| 521 | Ga0307405_10361931 | |||
| 522 | Ga0316577_10044102 | |||
| 523 | Ga0307413_10151011 | |||
| 524 | Ga0307410_10339557 | |||
| 525 | Ga0307406_10311482 | |||
| 526 | Ga0307407_10221075 | |||
| 527 | Ga0307407_10399579 | |||
| 528 | Ga0307412_10000102 | |||
| 529 | Ga0307412_10000900 | |||
| 530 | Ga0307412_10003100 | |||
| 531 | Ga0307412_10165057 | |||
| 532 | Ga0307412_10342098 | |||
| 533 | Ga0307409_100789405 | |||
| 534 | Ga0307409_101076733 | |||
| 535 | Ga0307416_100000031 | |||
| 536 | Ga0307416_100387855 | |||
| 537 | Ga0307416_100570074 | |||
| 538 | Ga0307414_10000010 | |||
| 539 | Ga0307414_10005674 | |||
| 540 | Ga0307414_10006175 | |||
| 541 | Ga0307414_10189866 | |||
| 542 | Ga0307414_10401427 | |||
| 543 | Ga0307414_10452263 | |||
| 544 | Ga0307411_10221589 | |||
| 545 | Ga0307411_10406625 | |||
| 546 | Ga0307415_100499543 | |||
| 547 | Ga0316583_10003601 | |||
| 548 | Ga0316580_10040752 | |||
| 549 | Ga0316582_0067957 | |||
| 550 | Ga0316584_0083544 | |||
| 551 | Ga0316584_0113145 | |||
| 552 | Ga0395900_0025688 | |||
| 553 | Ga0395898_0190338 | |||
| 554 | Ga0395901_0500181 | |||
| 555 | Ga0436365_0691100 | |||
| 556 | Ga0439465_0002051 | |||
| 557 | Ga0451795_1594654 | |||
| 558 | Ga0451837_0842085 | |||
| 559 | Ga0451839_1056440 | |||
| 560 | Ga0451853_0562319 | |||
| 561 | Ga0439445_0000217 | |||
| 562 | Ga0439449_0015560 | |||
| 563 | Ga0439457_035726 | |||
| 564 | Ga0450904_005604 | |||
| 565 | Ga0451577_0153059 | |||
| 566 | Ga0466977_0011435 | |||
| 567 | Ga0466965_0033666 | |||
| 568 | Ga0453684_0011922 | |||
| 569 | Ga0453684_0178840 | |||
| 570 | Ga0466970_0054057 | |||
| 571 | Ga0466970_0152458 | |||
| 572 | Ga0466960_0036091 | |||
| 573 | Ga0466959_0307950 | |||
| 574 | Ga0451576_0507370 | |||
| 575 | Ga0466967_0030255 | |||
| 576 | Ga0495627_000002 | |||
| 577 | Ga0495590_0069190 | |||
| 578 | Ga0495596_0010040 | |||
| 579 | Ga0495610_0000006 | |||
| 580 | Ga0495663_0000128 | |||
| 581 | Ga0495654_0000006 | |||
| 582 | Ga0495609_0000047 | |||
| 583 | Ga0495633_0000003 | |||
| 584 | Ga0495633_0002315 | |||
| 585 | Ga0495668_0000301 | |||
| 586 | Ga0495625_0003536 | |||
| 587 | Ga0495625_0079656 | |||
| 588 | Ga0495661_0001246 | |||
| 589 | Ga0495672_0070231 | |||
| 590 | Ga0495686_0000017 | |||
| 591 | Ga0495686_0000206 | |||
| 592 | Ga0495686_0002572 | |||
| 593 | Ga0496101_0052223 | |||
| 594 | Ga0496110_0236253 | |||
| 595 | Ga0496116_0000006 | |||
| 596 | Ga0496117_0000027 | |||
| 597 | Ga0496117_0034182 | |||
| 598 | Ga0496118_0001435 | |||
| 599 | Ga0496118_0002826 | |||
| 600 | Ga0496119_0000205 | |||
| 601 | Ga0496120_0115313 | |||
| 602 | Ga0496121_0150624 | |||
| 603 | Ga0496122_0000073 | |||
| 604 | Ga0496122_0001327 | |||
| 605 | Ga0496122_0001417 | |||
| 606 | Ga0496122_0006041 | |||
| 607 | Ga0496122_0032228 | |||
| 608 | Ga0496123_0001190 | |||
| 609 | Ga0496123_0022199 | |||
| 610 | Ga0496123_0095077 | |||
| 611 | Ga0496123_0114216 | |||
| 612 | Ga0496124_0001294 | |||
| 613 | Ga0496125_0000180 | |||
| 614 | Ga0496125_0000622 | |||
| 615 | Ga0496125_0001900 | |||
| 616 | Ga0496126_0005470 | |||
| 617 | Ga0501032_0043979 | |||
| 618 | Ga0501033_0090126 | |||
| 619 | Ga0501034_0011801 | |||
| 620 | Ga0501034_0036479 | |||
| 621 | Ga0501034_0214131 | |||
| 622 | Ga0501034_0512978 | |||
| 623 | Ga0501036_0339764 | |||
| 624 | Ga0501038_0078944 | |||
| 625 | Ga0501039_0019458 | |||
| 626 | Ga0501040_0107162 | |||
| 627 | Ga0501040_0177089 | |||
| 628 | Ga0501042_0164670 | |||
| 629 | Ga0501043_0161206 | |||
| 630 | Ga0501048_0237222 | |||
| 631 | Ga0501048_0297976 | |||
| 632 | Ga0501067_0125367 | |||
| 633 | Ga0501076_0589352 | |||
| 634 | Ga0501081_0049145 | |||
| 635 | Ga0501241_000399 | |||
| 636 | Ga0501269_000428 | |||
| 637 | Ga0501035_0161106 | |||
| 638 | Ga0501045_0211563 | |||
| 639 | nmdc:mga03683_110172_c1 | |||
| 640 | nmdc:mga03n38_74446_c1 | |||
| 641 | nmdc:mga03n38_9544_c1 | |||
| 642 | nmdc:mga00v17_16395_c1 | |||
| 643 | nmdc:mga00v17_42556_c1 | |||
| 644 | nmdc:mga0yw44_106931_c1 | |||
| 645 | nmdc:mga04h51_31155_c1 | |||
| 646 | nmdc:mga07m45_10552_c1 | |||
| 647 | nmdc:mga05p37_1058783_c1 | |||
| 648 | nmdc:mga05p37_504_c1 | |||
| 649 | nmdc:mga09592_74915_c1 | |||
| 650 | nmdc:mga0qj67_50560_c1 | |||
| 651 | nmdc:mga06r32_64_c1 | |||
| 652 | nmdc:mga08y16_102203_c1 | |||
| 653 | nmdc:mga08y16_906_c1 | |||
| 654 | nmdc:mga0n895_95950_c1 | |||
| 655 | nmdc:mga0a205_305774_c1 | |||
| 656 | nmdc:mga0sz30_5629_c1 | |||
| 657 | Ga0495595_0188973 | |||
| 658 | Ga0495619_0069461 | |||
| 659 | Ga0500643_087433 | |||
| 660 | Ga0500556_0000513 | |||
| 661 | Ga0500568_0056255 | |||
| 662 | Ga0500604_0000235 | |||
| 663 | Ga0500634_0000081 | |||
| 664 | 2511232502 | |||
| 665 | 2513955927 | |||
| 666 | 2514043986 | |||
| 667 | 2523470787 | |||
| 668 | 2524006796 | |||
| 669 | 2526063574 | |||
| 670 | 2585143859 | |||
| 671 | 2585158708 | |||
| 672 | 2585162995 | |||
| 673 | 2585386559 | |||
| 674 | 2585424366 | |||
| 675 | 2587681341 | |||
| 676 | 2587745869 | |||
| 677 | 2587751065 | |||
| 678 | 2587865273 | |||
| 679 | 2587944127 | |||
| 680 | 2588210067 | |||
| 681 | 2588214730 | |||
| 682 | 2588217958 | |||
| 683 | 2588222839 | |||
| 684 | 2588231325 | |||
| 685 | 2588444388 | |||
| 686 | 2590601308 | |||
| 687 | 2590613238 | |||
| 688 | 2643911275 | |||
| 689 | 2644093626 | |||
| 690 | 2644230097 | |||
| 691 | 2644323468 | |||
| 692 | 2644411337 | |||
| 693 | 2644456697 | |||
| 694 | 2645720083 | |||
| 695 | 2645726940 | |||
| 696 | 2671693326 | |||
| 697 | 2712196632 | |||
| 698 | 2729199788 | |||
| 699 | 2738699917 | |||
| 700 | 2738871840 | |||
| 701 | 2739253666 | |||
| 702 | 2740058809 | |||
| 703 | 2740061924 | |||
| 704 | 2753674335 | |||
| 705 | 2757565827 | |||
| 706 | 2765573971 | |||
| 707 | 2772605046 | |||
| 708 | 2775672130 | |||
| 709 | 2816874186 | |||
| 710 | 2840677412 | |||
| 711 | 2842086139 | |||
| 712 | 2857485708 | |||
| 713 | 2858439149 | |||
| 714 | 2871720419 | |||
| 715 | 2883072843 | |||
| 716 | 2889295532 | |||
| 717 | 2895499573 | |||
| 718 | 2895512596 | |||
| 719 | 2895522610 | |||
| 720 | 2895525628 | |||
| 721 | 2896085230 | |||
| 722 | 2906002887 | |||
| 723 | 2915611705 | |||
| 724 | 2919100556 | |||
| 725 | 2919401073 | |||
| 726 | 2932402752 | |||
| 727 | 2945926184 | |||
| 728 | 2946022435 | |||
| 729 | 2977245168 | |||
| 730 | 2984572921 | |||
| 731 | 2984610370 | |||
| 732 | 2993374466 | |||
| 733 | 2993481352 | |||
| 734 | 643598469 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3bfi-assembly1.cif.gz_A-2 | e. coli thymidylate synthase y209m mutant complexed with 5-nitro-dump | 0.9922 | 3 | 264 |
| 3qj7-assembly2.cif.gz_B | crystal structure of the mycobacterium tuberculosis thymidylate synthase (thya) bound to dump | 0.9919 | 1 | 261 |
| 2g8x-assembly1.cif.gz_B | escherichia coli y209w apoprotein | 0.9915 | 4 | 262 |
| 1nce-assembly1.cif.gz_B | crystal structure of a ternary complex of e. coli thymidylate synthase d169c with dump and the antifolate cb3717 | 0.9909 | 4 | 264 |
| 4fog-assembly2.cif.gz_B | crystal structure of mtb thya in complex with 5-fluoro-dump and 5-methyltetrahydrofolic acid | 0.9909 | 1 | 261 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1bo7A00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.9753 | 2 | 264 | 3.30.572.10 |
| 3ix6B00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.9751 | 2 | 251 | 3.30.572.10 |
| 1bo7A00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.968 | 2 | 264 | 3.30.572.10 |
| 6qyaC00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.9623 | 2 | 262 | 3.30.572.10 |
| 3dgaC00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.9619 | 2 | 259 | 3.30.572.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A059X1I7-F1-model_v4 | Thymidylate synthase (EC 2.1.1.45) | 0.9989 | 29 | 209 |
GO:0004799
GO:0005829 GO:0006231 GO:0032259 |
| AF-A0A528BC42-F1-model_v4 | Thymidylate synthase (EC 2.1.1.45) | 0.9986 | 49 | 237 |
GO:0004799
GO:0005829 GO:0006231 GO:0032259 |
| AF-A0A059WML7-F1-model_v4 | Thymidylate synthase (EC 2.1.1.45) | 0.9978 | 1 | 205 |
GO:0004799
GO:0005829 GO:0006231 GO:0032259 |
| AF-A0A059WVQ7-F1-model_v4 | Thymidylate synthase (EC 2.1.1.45) | 0.9978 | 29 | 201 |
GO:0004799
GO:0005829 GO:0006231 GO:0032259 |
| AF-A0A2J0MA32-F1-model_v4 | Thymidylate synthase (EC 2.1.1.45) | 0.9977 | 1 | 228 |
GO:0004799
GO:0005829 GO:0006231 GO:0032259 |