F424261

General Info

Members Datasets Scaffolds Average Seq Length
367 175 734 225

Family's Representative Sequence

Representative Sequence 3300005367|Ga0070667_100434168|Ga0070667_1004341683
Length 232
Sequence MILFYMGSVEFLNNQFLICSHIITYGNASTPEITEQMRQEIETMWNEPEGIIKFDGSLWRVIFKVTASHQPAIQALEVYQNLDPRNNYFRIEEFAYGNISFVDGLGCNSGYFKLENLYKGSTTAAHEYGHTLGLDHPKHLDIREEGVPGIMYPRGTLVDPQFQYDPTKPAGVTGGTMHPMYRKVRQEDIDHLKLHRLEFKDGLSLVGDFTNIYHMNHAEISPGEFTRPATSG

Samples

Sample ID Description Type Environment
1 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
132 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
133 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
139 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
140 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
141 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
142 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
143 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
144 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
145 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
146 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
147 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
148 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
149 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
152 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
153 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
154 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
155 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
156 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
157 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
158 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
159 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
167 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
168 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
169 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
170 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
171 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
172 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
173 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.82
Nodule 0
Rhizoplane 1.36
Rhizosphere 96.73
Stem 0
Stem Tuber 0
Unclassified 16.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070667_100434168 3300005367 Bacteria 1199
2 MRS1b_contig_7420789 2162886011 Bacteria 931
3 rootL2_10169684 3300003322 Unclassified 1080
4 rootL2_10291789 3300003322 Bacteria 1042
5 Ga0065704_10112900 3300005289 Bacteria 1923
6 Ga0070676_10001515 3300005328 Bacteria 11743
7 Ga0070676_10010827 3300005328 Bacteria 4949
8 Ga0070676_10021579 3300005328 Unclassified 3605
9 Ga0070676_10321636 3300005328 Bacteria 1055
10 Ga0070683_100005552 3300005329 Bacteria 10533
11 Ga0070683_100035348 3300005329 Unclassified 4568
12 Ga0070683_100035868 3300005329 Bacteria 4536
13 Ga0070683_100037874 3300005329 Bacteria 4416
14 Ga0070683_100203331 3300005329 Bacteria 1881
15 Ga0070690_100003882 3300005330 Bacteria 8242
16 Ga0070670_100047895 3300005331 Bacteria 3679
17 Ga0070670_100171422 3300005331 Unclassified 1882
18 Ga0070677_10183463 3300005333 Bacteria 998
19 Ga0068869_100013158 3300005334 Bacteria 5496
20 Ga0068869_100045550 3300005334 Unclassified 3159
21 Ga0068869_100184333 3300005334 Bacteria 1638
22 Ga0070666_10027916 3300005335 Bacteria 3701
23 Ga0070682_100082082 3300005337 Bacteria 2089
24 Ga0070682_100165604 3300005337 Bacteria 1531
25 Ga0070682_100389101 3300005337 Bacteria 1051
26 Ga0068868_100004920 3300005338 Bacteria 9381
27 Ga0068868_100011145 3300005338 Bacteria 6544
28 Ga0070660_100844475 3300005339 Bacteria 771
29 Ga0070689_100044417 3300005340 Bacteria 3418
30 Ga0070689_100112170 3300005340 Unclassified 2170
31 Ga0070687_100232664 3300005343 Bacteria 1135
32 Ga0070661_100006494 3300005344 Bacteria 8066
33 Ga0070661_100141097 3300005344 Bacteria 1816
34 Ga0070661_100305298 3300005344 Unclassified 1240
35 Ga0070668_100027912 3300005347 Bacteria 4284
36 Ga0070668_100033294 3300005347 Bacteria 3923
37 Ga0070668_100080264 3300005347 Bacteria 2555
38 Ga0070669_100018060 3300005353 Bacteria 5038
39 Ga0070669_100031577 3300005353 Bacteria 3826
40 Ga0070669_100518906 3300005353 Bacteria 990
41 Ga0070675_100012164 3300005354 Bacteria 6746
42 Ga0070675_100122097 3300005354 Bacteria 2213
43 Ga0070675_100148113 3300005354 Unclassified 2011
44 Ga0070675_100155993 3300005354 Bacteria 1960
45 Ga0070675_100498477 3300005354 Bacteria 1097
46 Ga0070671_100163855 3300005355 Bacteria 1879
47 Ga0070671_100372947 3300005355 Bacteria 1219
48 Ga0070674_100236388 3300005356 Bacteria 1428
49 Ga0070674_100472307 3300005356 Bacteria 1039
50 Ga0070674_100473136 3300005356 Bacteria 1038
51 Ga0070673_100254582 3300005364 Unclassified 1532
52 Ga0070673_100518529 3300005364 Bacteria 1080
53 Ga0070688_100062438 3300005365 Bacteria 2358
54 Ga0070688_100095841 3300005365 Unclassified 1948
55 Ga0070659_100039942 3300005366 Unclassified 3665
56 Ga0070667_100020385 3300005367 Bacteria 5504
57 Ga0070667_100029868 3300005367 Bacteria 4544
58 Ga0070667_100087040 3300005367 Bacteria 2681
59 Ga0070667_100867574 3300005367 Bacteria 839
60 Ga0070705_100208884 3300005440 Unclassified 1344
61 Ga0070700_100298552 3300005441 Bacteria 1175
62 Ga0070678_100060533 3300005456 Bacteria 2787
63 Ga0070678_100061161 3300005456 Unclassified 2775
64 Ga0070662_100002103 3300005457 Bacteria 12218
65 Ga0070662_100011052 3300005457 Bacteria 5944
66 Ga0070662_100027716 3300005457 Bacteria 3936
67 Ga0070662_100086659 3300005457 Bacteria 2343
68 Ga0070662_100141322 3300005457 Unclassified 1866
69 Ga0068867_100024913 3300005459 Bacteria 4289
70 Ga0068867_100029725 3300005459 Unclassified 3938
71 Ga0068867_100078449 3300005459 Bacteria 2484
72 Ga0068867_100223429 3300005459 Bacteria 1519
73 Ga0068867_100367372 3300005459 Bacteria 1205
74 Ga0070685_10045927 3300005466 Bacteria 2506
75 Ga0070698_100005163 3300005471 Bacteria 14280
76 Ga0070684_100005324 3300005535 Bacteria 9853
77 Ga0070684_100150674 3300005535 Unclassified 2107
78 Ga0068853_100001293 3300005539 Bacteria 17972
79 Ga0068853_100263969 3300005539 Bacteria 1584
80 Ga0070672_100026121 3300005543 Bacteria 4341
81 Ga0070672_100027467 3300005543 Bacteria 4244
82 Ga0070672_100047619 3300005543 Bacteria 3328
83 Ga0070672_100262765 3300005543 Bacteria 1456
84 Ga0070693_100309261 3300005547 Unclassified 1068
85 Ga0070665_100225150 3300005548 Bacteria 1876
86 Ga0070665_100951601 3300005548 Bacteria 871
87 Ga0070664_100001919 3300005564 Bacteria 16698
88 Ga0070664_100232886 3300005564 Bacteria 1651
89 Ga0070664_100253540 3300005564 Bacteria 1582
90 Ga0068857_100007228 3300005577 Bacteria 9562
91 Ga0068857_100329092 3300005577 Bacteria 1412
92 Ga0068854_100028321 3300005578 Bacteria 3870
93 Ga0068854_100543101 3300005578 Bacteria 985
94 Ga0068852_100131754 3300005616 Bacteria 2303
95 Ga0068852_100250891 3300005616 Bacteria 1695
96 Ga0068852_101174383 3300005616 Bacteria 788
97 Ga0068859_100009531 3300005617 Bacteria 9805
98 Ga0068859_100064707 3300005617 Bacteria 3689
99 Ga0068859_100077799 3300005617 Bacteria 3358
100 Ga0068859_100145888 3300005617 Unclassified 2441
101 Ga0068859_100225866 3300005617 Unclassified 1960
102 Ga0068864_100030337 3300005618 Bacteria 4582
103 Ga0068864_100036943 3300005618 Bacteria 4165
104 Ga0068864_100074147 3300005618 Bacteria 2969
105 Ga0068866_10003856 3300005718 Bacteria 6154
106 Ga0068866_10061644 3300005718 Unclassified 1949
107 Ga0068861_100001200 3300005719 Bacteria 16129
108 Ga0068861_100009551 3300005719 Bacteria 6701
109 Ga0068861_100060041 3300005719 Bacteria 2913
110 Ga0068861_100138968 3300005719 Unclassified 1980
111 Ga0068861_100153103 3300005719 Bacteria 1894
112 Ga0068870_10190816 3300005840 Bacteria 1236
113 Ga0068870_10200109 3300005840 Bacteria 1211
114 Ga0068870_10226442 3300005840 Unclassified 1147
115 Ga0068863_100019671 3300005841 Bacteria 6459
116 Ga0068863_100042261 3300005841 Bacteria 4331
117 Ga0068863_100139022 3300005841 Bacteria 2321
118 Ga0068863_100188533 3300005841 Bacteria 1981
119 Ga0068863_100719291 3300005841 Bacteria 993
120 Ga0068858_100165468 3300005842 Bacteria 2084
121 Ga0068858_100371659 3300005842 Bacteria 1371
122 Ga0068860_100088651 3300005843 Bacteria 2945
123 Ga0068860_100333623 3300005843 Bacteria 1490
124 Ga0068860_100844240 3300005843 Bacteria 930
125 Ga0068862_100032903 3300005844 Bacteria 4379
126 Ga0068862_100248438 3300005844 Bacteria 1620
127 Ga0081539_10064033 3300005985 Bacteria 2003
128 Ga0070715_10048907 3300006163 Bacteria 1810
129 Ga0075366_10025088 3300006195 Unclassified 3479
130 Ga0075366_10026997 3300006195 Bacteria 3367
131 Ga0097621_100002207 3300006237 Bacteria 13328
132 Ga0097621_100027932 3300006237 Bacteria 4442
133 Ga0097621_100302018 3300006237 Bacteria 1414
134 Ga0097621_100573331 3300006237 Unclassified 1029
135 Ga0068871_100056755 3300006358 Bacteria 3184
136 Ga0068871_100077891 3300006358 Bacteria 2740
137 Ga0068871_100116194 3300006358 Unclassified 2255
138 Ga0068871_100471616 3300006358 Bacteria 1128
139 Ga0068865_100144786 3300006881 Bacteria 1796
140 Ga0097620_100009530 3300006931 Bacteria 9805
141 Ga0097620_100064709 3300006931 Bacteria 3689
142 Ga0097620_100077797 3300006931 Bacteria 3358
143 Ga0097620_100145887 3300006931 Unclassified 2441
144 Ga0097620_100225871 3300006931 Unclassified 1960
145 Ga0111539_10014263 3300009094 Bacteria 9927
146 Ga0111539_10831209 3300009094 Bacteria 1075
147 Ga0105247_10000897 3300009101 Bacteria 22403
148 Ga0105247_10260730 3300009101 Bacteria 1188
149 Ga0105243_10191785 3300009148 Bacteria 1785
150 Ga0105241_10071909 3300009174 Bacteria 2686
151 Ga0105242_10065751 3300009176 Bacteria 2992
152 Ga0105242_10079128 3300009176 Unclassified 2745
153 Ga0105242_10283205 3300009176 Bacteria 1506
154 Ga0105242_10375495 3300009176 Bacteria 1320
155 Ga0105242_10544861 3300009176 Bacteria 1111
156 Ga0105242_10713448 3300009176 Bacteria 983
157 Ga0105242_10916897 3300009176 Bacteria 877
158 Ga0105248_10632199 3300009177 Bacteria 1208
159 Ga0105248_10813874 3300009177 Bacteria 1054
160 Ga0105249_10035193 3300009553 Bacteria 4541
161 Ga0105249_10115543 3300009553 Bacteria 2543
162 Ga0105249_10282386 3300009553 Bacteria 1659
163 Ga0157324_1004224 3300012506 Unclassified 984
164 Ga0157373_10203303 3300013100 Bacteria 1396
165 Ga0157371_10077184 3300013102 Bacteria 2359
166 Ga0157371_10208906 3300013102 Unclassified 1401
167 Ga0157370_10477011 3300013104 Bacteria 1146
168 Ga0157374_10001964 3300013296 Bacteria 17254
169 Ga0157374_10072213 3300013296 Bacteria 3256
170 Ga0157374_10169296 3300013296 Bacteria 2130
171 Ga0157378_10036527 3300013297 Unclassified 4348
172 Ga0157378_10044744 3300013297 Unclassified 3932
173 Ga0157378_10282515 3300013297 Bacteria 1600
174 Ga0163162_10004917 3300013306 Bacteria 12885
175 Ga0163162_10006127 3300013306 Bacteria 11646
176 Ga0163162_10006683 3300013306 Bacteria 11189
177 Ga0163162_10046618 3300013306 Bacteria 4345
178 Ga0163162_10067001 3300013306 Bacteria 3640
179 Ga0163162_10081126 3300013306 Bacteria 3314
180 Ga0163162_10577326 3300013306 Bacteria 1251
181 Ga0157372_10195752 3300013307 Bacteria 2341
182 Ga0157375_10029200 3300013308 Bacteria 5183
183 Ga0157375_10052160 3300013308 Bacteria 4020
184 Ga0157375_10089933 3300013308 Unclassified 3127
185 Ga0157375_10101488 3300013308 Bacteria 2960
186 Ga0163163_10093736 3300014325 Bacteria 3020
187 Ga0163163_10097697 3300014325 Bacteria 2957
188 Ga0163163_10758226 3300014325 Unclassified 1034
189 Ga0157380_10010441 3300014326 Bacteria 6681
190 Ga0157380_10145139 3300014326 Bacteria 2044
191 Ga0157380_10517857 3300014326 Unclassified 1163
192 Ga0157377_10015371 3300014745 Bacteria 3915
193 Ga0157377_10135075 3300014745 Bacteria 1510
194 Ga0157379_10111771 3300014968 Bacteria 2454
195 Ga0157379_10141706 3300014968 Bacteria 2167
196 Ga0157376_10003969 3300014969 Bacteria 10230
197 Ga0157376_10088807 3300014969 Bacteria 2671
198 Ga0157376_10203587 3300014969 Bacteria 1823
199 Ga0157376_10416855 3300014969 Unclassified 1302
200 Ga0163161_10006244 3300017792 Bacteria 8254
201 Ga0163161_10183722 3300017792 Bacteria 1605
202 Ga0207697_10045960 3300025315 Bacteria 1797
203 Ga0207682_10066793 3300025893 Bacteria 1516
204 Ga0207710_10000888 3300025900 Bacteria 16015
205 Ga0207647_10010016 3300025904 Bacteria 6712
206 Ga0207685_10170684 3300025905 Bacteria 1001
207 Ga0207645_10000606 3300025907 Bacteria 29699
208 Ga0207645_10003608 3300025907 Bacteria 11711
209 Ga0207645_10019953 3300025907 Unclassified 4388
210 Ga0207645_10100245 3300025907 Bacteria 1868
211 Ga0207645_10219665 3300025907 Unclassified 1252
212 Ga0207643_10003957 3300025908 Bacteria 7975
213 Ga0207643_10015070 3300025908 Bacteria 4203
214 Ga0207643_10052750 3300025908 Bacteria 2310
215 Ga0207643_10226175 3300025908 Unclassified 1147
216 Ga0207662_10515142 3300025918 Bacteria 825
217 Ga0207657_10666608 3300025919 Bacteria 809
218 Ga0207681_10048192 3300025923 Bacteria 2875
219 Ga0207681_10054524 3300025923 Bacteria 2719
220 Ga0207681_10073908 3300025923 Unclassified 2386
221 Ga0207650_10436595 3300025925 Unclassified 1088
222 Ga0207659_10062610 3300025926 Bacteria 2686
223 Ga0207659_10176343 3300025926 Bacteria 1690
224 Ga0207659_10216098 3300025926 Bacteria 1539
225 Ga0207659_10225276 3300025926 Bacteria 1509
226 Ga0207644_10345644 3300025931 Bacteria 1207
227 Ga0207690_10026283 3300025932 Unclassified 3665
228 Ga0207706_10001202 3300025933 Bacteria 26151
229 Ga0207706_10019187 3300025933 Bacteria 6148
230 Ga0207706_10041084 3300025933 Bacteria 4100
231 Ga0207706_10186818 3300025933 Bacteria 1820
232 Ga0207686_10053699 3300025934 Unclassified 2521
233 Ga0207686_10136216 3300025934 Bacteria 1691
234 Ga0207670_10249573 3300025936 Bacteria 1371
235 Ga0207669_10256205 3300025937 Bacteria 1306
236 Ga0207669_10521967 3300025937 Bacteria 954
237 Ga0207704_10033750 3300025938 Bacteria 2914
238 Ga0207704_10046082 3300025938 Bacteria 2596
239 Ga0207704_10241985 3300025938 Bacteria 1349
240 Ga0207691_10007396 3300025940 Bacteria 10580
241 Ga0207691_10007578 3300025940 Bacteria 10446
242 Ga0207691_10320570 3300025940 Bacteria 1329
243 Ga0207689_10002537 3300025942 Bacteria 16958
244 Ga0207689_10009956 3300025942 Bacteria 8198
245 Ga0207689_10024938 3300025942 Bacteria 5012
246 Ga0207689_10056866 3300025942 Bacteria 3219
247 Ga0207689_10065861 3300025942 Bacteria 2980
248 Ga0207689_10092740 3300025942 Bacteria 2481
249 Ga0207661_10003319 3300025944 Bacteria 11166
250 Ga0207661_10059407 3300025944 Bacteria 3081
251 Ga0207661_10206859 3300025944 Bacteria 1728
252 Ga0207661_10606127 3300025944 Bacteria 1005
253 Ga0207679_10002248 3300025945 Bacteria 11914
254 Ga0207679_10056061 3300025945 Bacteria 2908
255 Ga0207679_10230560 3300025945 Bacteria 1563
256 Ga0207651_10031123 3300025960 Bacteria 3407
257 Ga0207651_10262528 3300025960 Unclassified 1419
258 Ga0207651_10287846 3300025960 Bacteria 1361
259 Ga0207651_10297835 3300025960 Bacteria 1340
260 Ga0207712_10028997 3300025961 Bacteria 3708
261 Ga0207712_10057728 3300025961 Bacteria 2740
262 Ga0207712_10134852 3300025961 Bacteria 1886
263 Ga0207712_10341301 3300025961 Bacteria 1242
264 Ga0207668_10046559 3300025972 Bacteria 2964
265 Ga0207668_10284235 3300025972 Bacteria 1358
266 Ga0207658_10059935 3300025986 Bacteria 2838
267 Ga0207658_10143488 3300025986 Unclassified 1936
268 Ga0207658_10482853 3300025986 Bacteria 1101
269 Ga0207677_10008946 3300026023 Bacteria 5617
270 Ga0207677_10306255 3300026023 Bacteria 1314
271 Ga0207703_10020894 3300026035 Bacteria 5122
272 Ga0207703_10245887 3300026035 Bacteria 1610
273 Ga0207703_10295417 3300026035 Bacteria 1476
274 Ga0207703_10931647 3300026035 Unclassified 832
275 Ga0207639_10284604 3300026041 Bacteria 1455
276 Ga0207678_10057499 3300026067 Unclassified 3347
277 Ga0207708_10098776 3300026075 Bacteria 2257
278 Ga0207702_10320938 3300026078 Bacteria 1475
279 Ga0207641_10004474 3300026088 Bacteria 12099
280 Ga0207641_10499109 3300026088 Bacteria 1181
281 Ga0207648_10000649 3300026089 Bacteria 39082
282 Ga0207648_10002545 3300026089 Bacteria 19559
283 Ga0207648_10038706 3300026089 Bacteria 4195
284 Ga0207648_10041994 3300026089 Bacteria 4015
285 Ga0207648_10085065 3300026089 Bacteria 2759
286 Ga0207648_10141892 3300026089 Bacteria 2117
287 Ga0207648_10316961 3300026089 Bacteria 1401
288 Ga0207648_10381082 3300026089 Bacteria 1275
289 Ga0207676_10003098 3300026095 Bacteria 11862
290 Ga0207676_10115701 3300026095 Bacteria 2252
291 Ga0207676_10164044 3300026095 Bacteria 1928
292 Ga0207674_10001468 3300026116 Bacteria 30467
293 Ga0207674_10005631 3300026116 Bacteria 14853
294 Ga0207674_10082090 3300026116 Bacteria 3225
295 Ga0207674_10218818 3300026116 Unclassified 1852
296 Ga0207674_10234710 3300026116 Bacteria 1782
297 Ga0207675_100005014 3300026118 Bacteria 12753
298 Ga0207675_100008085 3300026118 Bacteria 9907
299 Ga0207675_100047346 3300026118 Bacteria 4015
300 Ga0207675_100065870 3300026118 Bacteria 3386
301 Ga0207675_100141287 3300026118 Bacteria 2287
302 Ga0207675_100352264 3300026118 Bacteria 1443
303 Ga0207683_10000439 3300026121 Bacteria 38420
304 Ga0207698_10099999 3300026142 Bacteria 2401
305 Ga0209996_1012324 3300027395 Bacteria 1148
306 Ga0209966_1031215 3300027695 Unclassified 1080
307 Ga0268265_10130938 3300028380 Bacteria 2084
308 Ga0268265_10252538 3300028380 Bacteria 1563
309 Ga0268265_10300504 3300028380 Bacteria 1445
310 Ga0268264_10354995 3300028381 Bacteria 1396
311 Ga0268264_10759860 3300028381 Unclassified 966
312 Ga0307516_10123450 3300031730 Bacteria 2377
313 Ga0307413_10147466 3300031824 Unclassified 1635
314 Ga0307406_10252748 3300031901 Bacteria 1329
315 Ga0307407_10139350 3300031903 Unclassified 1563
316 Ga0307409_100967817 3300031995 Unclassified 868
317 Ga0307416_100193943 3300032002 Bacteria 1919
318 Ga0307415_100040950 3300032126 Bacteria 3073
319 Ga0307415_100285391 3300032126 Unclassified 1360
320 Ga0373934_0014734 3300035086 Bacteria 2962
321 Ga0373955_0385831 3300035172 Bacteria 850
322 Ga0373924_0098321 3300035410 Bacteria 1257
323 Ga0373937_0022689 3300036401 Bacteria 5646
324 Ga0373925_0141893 3300037068 Bacteria 1881
325 Ga0395900_0224023 3300037418 Bacteria 1894
326 Ga0395905_0001155 3300037471 Bacteria 33052
327 Ga0451793_1575503 3300041452 Bacteria 658
328 Ga0451804_0355368 3300041463 Unclassified 979
329 Ga0451807_1320780 3300041486 Bacteria 1977
330 Ga0451843_1590095 3300041509 Unclassified 1349
331 Ga0439431_0031024 3300041997 Bacteria 1327
332 Ga0439433_0022744 3300041999 Bacteria 1408
333 Ga0439442_010378 3300042002 Bacteria 1888
334 Ga0439449_0001248 3300042007 Bacteria 9978
335 Ga0439457_008707 3300042014 Bacteria 2383
336 Ga0439457_038117 3300042014 Bacteria 1070
337 Ga0450897_002394 3300042128 Bacteria 1403
338 Ga0439434_0012704 3300042435 Bacteria 2494
339 Ga0451577_0402853 3300042876 Unclassified 1242
340 Ga0466967_0098181 3300045976 Bacteria 2674
341 Ga0466967_0674437 3300045976 Unclassified 1023
342 Ga0495650_0025158 3300046471 Bacteria 2796
343 Ga0495664_0339650 3300046477 Bacteria 905
344 Ga0495630_0008032 3300046517 Bacteria 7584
345 Ga0495586_0029881 3300046535 Bacteria 2917
346 Ga0495587_0229056 3300046536 Bacteria 1047
347 Ga0495634_0022692 3300046642 Bacteria 4422
348 Ga0495611_0111064 3300046648 Bacteria 1276
349 Ga0495604_0090521 3300047317 Bacteria 2272
350 Ga0495686_0016444 3300047472 Bacteria 5016
351 Ga0495686_0038700 3300047472 Bacteria 3049
352 Ga0496109_0627820 3300048912 Bacteria 1011
353 Ga0496112_0485517 3300048915 Bacteria 1172
354 Ga0501037_0017667 3300049573 Bacteria 5251
355 Ga0501038_0009357 3300049574 Bacteria 8988
356 Ga0501039_0019190 3300049575 Bacteria 5246
357 Ga0501047_0137632 3300049581 Bacteria 2322
358 Ga0501073_0058652 3300049589 Bacteria 2690
359 Ga0501233_069634 3300049668 Bacteria 889
360 Ga0501243_013283 3300049675 Bacteria 1306
361 Ga0501221_031059 3300049704 Bacteria 1114
362 Ga0501080_0332023 3300049742 Bacteria 1375
363 Ga0501272_007628 3300049769 Bacteria 1176
364 Ga0501044_0005426 3300049823 Bacteria 14162
365 nmdc:mga0k408_35040_c1 3300050493 Unclassified 2877
366 nmdc:mga05p37_41037_c1 3300050507 Bacteria 5682
367 nmdc:mga08y16_13437_c1 3300050511 Bacteria 8615
368 Ga0070667_100434168
369 MRS1b_contig_7420789
370 rootL2_10169684
371 rootL2_10291789
372 Ga0065704_10112900
373 Ga0070676_10001515
374 Ga0070676_10010827
375 Ga0070676_10021579
376 Ga0070676_10321636
377 Ga0070683_100005552
378 Ga0070683_100035348
379 Ga0070683_100035868
380 Ga0070683_100037874
381 Ga0070683_100203331
382 Ga0070690_100003882
383 Ga0070670_100047895
384 Ga0070670_100171422
385 Ga0070677_10183463
386 Ga0068869_100013158
387 Ga0068869_100045550
388 Ga0068869_100184333
389 Ga0070666_10027916
390 Ga0070682_100082082
391 Ga0070682_100165604
392 Ga0070682_100389101
393 Ga0068868_100004920
394 Ga0068868_100011145
395 Ga0070660_100844475
396 Ga0070689_100044417
397 Ga0070689_100112170
398 Ga0070687_100232664
399 Ga0070661_100006494
400 Ga0070661_100141097
401 Ga0070661_100305298
402 Ga0070668_100027912
403 Ga0070668_100033294
404 Ga0070668_100080264
405 Ga0070669_100018060
406 Ga0070669_100031577
407 Ga0070669_100518906
408 Ga0070675_100012164
409 Ga0070675_100122097
410 Ga0070675_100148113
411 Ga0070675_100155993
412 Ga0070675_100498477
413 Ga0070671_100163855
414 Ga0070671_100372947
415 Ga0070674_100236388
416 Ga0070674_100472307
417 Ga0070674_100473136
418 Ga0070673_100254582
419 Ga0070673_100518529
420 Ga0070688_100062438
421 Ga0070688_100095841
422 Ga0070659_100039942
423 Ga0070667_100020385
424 Ga0070667_100029868
425 Ga0070667_100087040
426 Ga0070667_100867574
427 Ga0070705_100208884
428 Ga0070700_100298552
429 Ga0070678_100060533
430 Ga0070678_100061161
431 Ga0070662_100002103
432 Ga0070662_100011052
433 Ga0070662_100027716
434 Ga0070662_100086659
435 Ga0070662_100141322
436 Ga0068867_100024913
437 Ga0068867_100029725
438 Ga0068867_100078449
439 Ga0068867_100223429
440 Ga0068867_100367372
441 Ga0070685_10045927
442 Ga0070698_100005163
443 Ga0070684_100005324
444 Ga0070684_100150674
445 Ga0068853_100001293
446 Ga0068853_100263969
447 Ga0070672_100026121
448 Ga0070672_100027467
449 Ga0070672_100047619
450 Ga0070672_100262765
451 Ga0070693_100309261
452 Ga0070665_100225150
453 Ga0070665_100951601
454 Ga0070664_100001919
455 Ga0070664_100232886
456 Ga0070664_100253540
457 Ga0068857_100007228
458 Ga0068857_100329092
459 Ga0068854_100028321
460 Ga0068854_100543101
461 Ga0068852_100131754
462 Ga0068852_100250891
463 Ga0068852_101174383
464 Ga0068859_100009531
465 Ga0068859_100064707
466 Ga0068859_100077799
467 Ga0068859_100145888
468 Ga0068859_100225866
469 Ga0068864_100030337
470 Ga0068864_100036943
471 Ga0068864_100074147
472 Ga0068866_10003856
473 Ga0068866_10061644
474 Ga0068861_100001200
475 Ga0068861_100009551
476 Ga0068861_100060041
477 Ga0068861_100138968
478 Ga0068861_100153103
479 Ga0068870_10190816
480 Ga0068870_10200109
481 Ga0068870_10226442
482 Ga0068863_100019671
483 Ga0068863_100042261
484 Ga0068863_100139022
485 Ga0068863_100188533
486 Ga0068863_100719291
487 Ga0068858_100165468
488 Ga0068858_100371659
489 Ga0068860_100088651
490 Ga0068860_100333623
491 Ga0068860_100844240
492 Ga0068862_100032903
493 Ga0068862_100248438
494 Ga0081539_10064033
495 Ga0070715_10048907
496 Ga0075366_10025088
497 Ga0075366_10026997
498 Ga0097621_100002207
499 Ga0097621_100027932
500 Ga0097621_100302018
501 Ga0097621_100573331
502 Ga0068871_100056755
503 Ga0068871_100077891
504 Ga0068871_100116194
505 Ga0068871_100471616
506 Ga0068865_100144786
507 Ga0097620_100009530
508 Ga0097620_100064709
509 Ga0097620_100077797
510 Ga0097620_100145887
511 Ga0097620_100225871
512 Ga0111539_10014263
513 Ga0111539_10831209
514 Ga0105247_10000897
515 Ga0105247_10260730
516 Ga0105243_10191785
517 Ga0105241_10071909
518 Ga0105242_10065751
519 Ga0105242_10079128
520 Ga0105242_10283205
521 Ga0105242_10375495
522 Ga0105242_10544861
523 Ga0105242_10713448
524 Ga0105242_10916897
525 Ga0105248_10632199
526 Ga0105248_10813874
527 Ga0105249_10035193
528 Ga0105249_10115543
529 Ga0105249_10282386
530 Ga0157324_1004224
531 Ga0157373_10203303
532 Ga0157371_10077184
533 Ga0157371_10208906
534 Ga0157370_10477011
535 Ga0157374_10001964
536 Ga0157374_10072213
537 Ga0157374_10169296
538 Ga0157378_10036527
539 Ga0157378_10044744
540 Ga0157378_10282515
541 Ga0163162_10004917
542 Ga0163162_10006127
543 Ga0163162_10006683
544 Ga0163162_10046618
545 Ga0163162_10067001
546 Ga0163162_10081126
547 Ga0163162_10577326
548 Ga0157372_10195752
549 Ga0157375_10029200
550 Ga0157375_10052160
551 Ga0157375_10089933
552 Ga0157375_10101488
553 Ga0163163_10093736
554 Ga0163163_10097697
555 Ga0163163_10758226
556 Ga0157380_10010441
557 Ga0157380_10145139
558 Ga0157380_10517857
559 Ga0157377_10015371
560 Ga0157377_10135075
561 Ga0157379_10111771
562 Ga0157379_10141706
563 Ga0157376_10003969
564 Ga0157376_10088807
565 Ga0157376_10203587
566 Ga0157376_10416855
567 Ga0163161_10006244
568 Ga0163161_10183722
569 Ga0207697_10045960
570 Ga0207682_10066793
571 Ga0207710_10000888
572 Ga0207647_10010016
573 Ga0207685_10170684
574 Ga0207645_10000606
575 Ga0207645_10003608
576 Ga0207645_10019953
577 Ga0207645_10100245
578 Ga0207645_10219665
579 Ga0207643_10003957
580 Ga0207643_10015070
581 Ga0207643_10052750
582 Ga0207643_10226175
583 Ga0207662_10515142
584 Ga0207657_10666608
585 Ga0207681_10048192
586 Ga0207681_10054524
587 Ga0207681_10073908
588 Ga0207650_10436595
589 Ga0207659_10062610
590 Ga0207659_10176343
591 Ga0207659_10216098
592 Ga0207659_10225276
593 Ga0207644_10345644
594 Ga0207690_10026283
595 Ga0207706_10001202
596 Ga0207706_10019187
597 Ga0207706_10041084
598 Ga0207706_10186818
599 Ga0207686_10053699
600 Ga0207686_10136216
601 Ga0207670_10249573
602 Ga0207669_10256205
603 Ga0207669_10521967
604 Ga0207704_10033750
605 Ga0207704_10046082
606 Ga0207704_10241985
607 Ga0207691_10007396
608 Ga0207691_10007578
609 Ga0207691_10320570
610 Ga0207689_10002537
611 Ga0207689_10009956
612 Ga0207689_10024938
613 Ga0207689_10056866
614 Ga0207689_10065861
615 Ga0207689_10092740
616 Ga0207661_10003319
617 Ga0207661_10059407
618 Ga0207661_10206859
619 Ga0207661_10606127
620 Ga0207679_10002248
621 Ga0207679_10056061
622 Ga0207679_10230560
623 Ga0207651_10031123
624 Ga0207651_10262528
625 Ga0207651_10287846
626 Ga0207651_10297835
627 Ga0207712_10028997
628 Ga0207712_10057728
629 Ga0207712_10134852
630 Ga0207712_10341301
631 Ga0207668_10046559
632 Ga0207668_10284235
633 Ga0207658_10059935
634 Ga0207658_10143488
635 Ga0207658_10482853
636 Ga0207677_10008946
637 Ga0207677_10306255
638 Ga0207703_10020894
639 Ga0207703_10245887
640 Ga0207703_10295417
641 Ga0207703_10931647
642 Ga0207639_10284604
643 Ga0207678_10057499
644 Ga0207708_10098776
645 Ga0207702_10320938
646 Ga0207641_10004474
647 Ga0207641_10499109
648 Ga0207648_10000649
649 Ga0207648_10002545
650 Ga0207648_10038706
651 Ga0207648_10041994
652 Ga0207648_10085065
653 Ga0207648_10141892
654 Ga0207648_10316961
655 Ga0207648_10381082
656 Ga0207676_10003098
657 Ga0207676_10115701
658 Ga0207676_10164044
659 Ga0207674_10001468
660 Ga0207674_10005631
661 Ga0207674_10082090
662 Ga0207674_10218818
663 Ga0207674_10234710
664 Ga0207675_100005014
665 Ga0207675_100008085
666 Ga0207675_100047346
667 Ga0207675_100065870
668 Ga0207675_100141287
669 Ga0207675_100352264
670 Ga0207683_10000439
671 Ga0207698_10099999
672 Ga0209996_1012324
673 Ga0209966_1031215
674 Ga0268265_10130938
675 Ga0268265_10252538
676 Ga0268265_10300504
677 Ga0268264_10354995
678 Ga0268264_10759860
679 Ga0307516_10123450
680 Ga0307413_10147466
681 Ga0307406_10252748
682 Ga0307407_10139350
683 Ga0307409_100967817
684 Ga0307416_100193943
685 Ga0307415_100040950
686 Ga0307415_100285391
687 Ga0373934_0014734
688 Ga0373955_0385831
689 Ga0373924_0098321
690 Ga0373937_0022689
691 Ga0373925_0141893
692 Ga0395900_0224023
693 Ga0395905_0001155
694 Ga0451793_1575503
695 Ga0451804_0355368
696 Ga0451807_1320780
697 Ga0451843_1590095
698 Ga0439431_0031024
699 Ga0439433_0022744
700 Ga0439442_010378
701 Ga0439449_0001248
702 Ga0439457_008707
703 Ga0439457_038117
704 Ga0450897_002394
705 Ga0439434_0012704
706 Ga0451577_0402853
707 Ga0466967_0098181
708 Ga0466967_0674437
709 Ga0495650_0025158
710 Ga0495664_0339650
711 Ga0495630_0008032
712 Ga0495586_0029881
713 Ga0495587_0229056
714 Ga0495634_0022692
715 Ga0495611_0111064
716 Ga0495604_0090521
717 Ga0495686_0016444
718 Ga0495686_0038700
719 Ga0496109_0627820
720 Ga0496112_0485517
721 Ga0501037_0017667
722 Ga0501038_0009357
723 Ga0501039_0019190
724 Ga0501047_0137632
725 Ga0501073_0058652
726 Ga0501233_069634
727 Ga0501243_013283
728 Ga0501221_031059
729 Ga0501080_0332023
730 Ga0501272_007628
731 Ga0501044_0005426
732 nmdc:mga0k408_35040_c1
733 nmdc:mga05p37_41037_c1
734 nmdc:mga08y16_13437_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6esv-assembly1.cif.gz_A structure of the phosphate-bound form of aiox from rhizobium sp. str. nt-26 0.5489 16 63
7pol-assembly1.cif.gz_B crystal structure of profragilysin-3 (probft-3) from bacteroides fragilis in complex with flumequine 0.5482 5 192
4hx3-assembly1.cif.gz_A crystal structure of streptomyces caespitosus sermetstatin in complex with s. caespitosus snapalysin 0.5357 16 192
4r81-assembly1.cif.gz_A nad(p)h:quinone oxidoreductase from methanothermobacter marburgensis 0.5256 17 62
4hx3-assembly1.cif.gz_A crystal structure of streptomyces caespitosus sermetstatin in complex with s. caespitosus snapalysin 0.5185 16 192
ID Description Score Start End Superfamily
3lncB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6161 16 92 3.40.50.300
af_Q22710_37_266_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.5856 2 133 3.40.390.10
4x9tA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.5841 16 85 3.40.190.150
af_K7K641_72_302_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.5457 16 190 3.40.390.10
3p24B02 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.5445 5 192 3.40.390.10
ID Description Score Start End GO Terms
AF-A0A4V2A8C5-F1-model_v4 deleted 0.9815 1 214
AF-A0A7X9Q4S3-F1-model_v4 Peptidase M10 0.9792 1 87
AF-A0A7K3XN29-F1-model_v4 Uncharacterized protein 0.9769 2 211
AF-A0A6N4QQW1-F1-model_v4 deleted 0.9765 20 213
AF-A0A4S8HYZ9-F1-model_v4 Peptidase M10 0.975 1 214

Map