F424289

General Info

Members Datasets Scaffolds Average Seq Length
367 195 734 209

Family's Representative Sequence

Representative Sequence 3300005616|Ga0068852_100049537|Ga0068852_1000495374
Length 231
Sequence MPLRAGCGASPSAQNWCNADMNLADYLEPLPLVAVLRGITPEETPAIADALCAEGFRILEVPLNSPRPFESIRLLARLYADRCLVGAGTVLDPADVVRVRDAGGTLIVMPHADVAVVREAKRLGMVCLPGVATPTEAFAALAAGADGLKLFPAEAMVPAVLRAWRAVLPKSALVFAVGGIRADNMGPWWAEGAAGFGTGSNLYKPRAAPDAVRAAAAAYADAFRALPKRDR

Samples

Sample ID Description Type Environment
1 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
152 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
155 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
156 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
157 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
161 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
162 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
163 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
183 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
184 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
185 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
189 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
190 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
193 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
194 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
195 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0
Isolates 0.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0
Rhizoplane 2.72
Rhizosphere 96.19
Stem 0
Stem Tuber 0
Unclassified 2.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068852_100049537 3300005616 Bacteria 3594
2 JGI24743J22301_10001364 3300001991 Bacteria 3355
3 JGI24749J21850_1000944 3300002076 Bacteria 4134
4 JGI24751J29686_10050276 3300002459 Bacteria 860
5 Ga0065712_10215916 3300005290 Bacteria 1057
6 Ga0065715_10259290 3300005293 Bacteria 1143
7 Ga0065707_10129222 3300005295 Bacteria 1951
8 Ga0070658_10250359 3300005327 Bacteria 1503
9 Ga0070676_10005167 3300005328 Bacteria 6931
10 Ga0070676_10343281 3300005328 Unclassified 1025
11 Ga0070683_100003301 3300005329 Bacteria 13044
12 Ga0070683_100011460 3300005329 Bacteria 7666
13 Ga0070690_100084854 3300005330 Bacteria 2076
14 Ga0070690_100130078 3300005330 Bacteria 1699
15 Ga0070670_100006785 3300005331 Bacteria 9693
16 Ga0070670_100267393 3300005331 Bacteria 1491
17 Ga0070670_100445387 3300005331 Bacteria 1147
18 Ga0070677_10039102 3300005333 Unclassified 1860
19 Ga0068869_100004727 3300005334 Bacteria 8497
20 Ga0068869_100279794 3300005334 Bacteria 1341
21 Ga0070666_10013463 3300005335 Bacteria 5192
22 Ga0070680_100032497 3300005336 Bacteria 4201
23 Ga0070680_100066882 3300005336 Bacteria 2947
24 Ga0070680_100518635 3300005336 Bacteria 1020
25 Ga0070682_100002517 3300005337 Bacteria 10113
26 Ga0070682_100008626 3300005337 Bacteria 5756
27 Ga0068868_100054969 3300005338 Bacteria 3140
28 Ga0068868_100284563 3300005338 Bacteria 1400
29 Ga0070660_100129128 3300005339 Bacteria 2021
30 Ga0070660_100292706 3300005339 Bacteria 1334
31 Ga0070689_100004379 3300005340 Bacteria 9532
32 Ga0070689_100093778 3300005340 Bacteria 2370
33 Ga0070687_100024298 3300005343 Bacteria 2891
34 Ga0070661_100004151 3300005344 Bacteria 9992
35 Ga0070661_100485909 3300005344 Bacteria 987
36 Ga0070692_10036455 3300005345 Bacteria 2496
37 Ga0070668_100318290 3300005347 Bacteria 1309
38 Ga0070668_100847014 3300005347 Unclassified 815
39 Ga0070669_100046741 3300005353 Bacteria 3156
40 Ga0070669_100239294 3300005353 Bacteria 1441
41 Ga0070675_100023346 3300005354 Bacteria 4945
42 Ga0070675_100059890 3300005354 Bacteria 3142
43 Ga0070671_100011020 3300005355 Bacteria 7256
44 Ga0070674_100016390 3300005356 Bacteria 4644
45 Ga0070674_100160495 3300005356 Bacteria 1705
46 Ga0070674_101029727 3300005356 Bacteria 724
47 Ga0070673_100013032 3300005364 Bacteria 5734
48 Ga0070673_100065401 3300005364 Bacteria 2900
49 Ga0070673_100611924 3300005364 Bacteria 994
50 Ga0070688_100040376 3300005365 Bacteria 2859
51 Ga0070659_100011829 3300005366 Bacteria 6458
52 Ga0070659_100072438 3300005366 Bacteria 2741
53 Ga0070659_100300066 3300005366 Bacteria 1339
54 Ga0070667_100003844 3300005367 Bacteria 12748
55 Ga0070667_100121022 3300005367 Bacteria 2277
56 Ga0070667_100215837 3300005367 Unclassified 1706
57 Ga0070667_100290690 3300005367 Bacteria 1469
58 Ga0070667_100668210 3300005367 Bacteria 960
59 Ga0070709_10063419 3300005434 Bacteria 2360
60 Ga0070714_100053767 3300005435 Bacteria 3439
61 Ga0070714_100066058 3300005435 Bacteria 3117
62 Ga0070701_10017464 3300005438 Bacteria 3353
63 Ga0070700_100040173 3300005441 Bacteria 2863
64 Ga0070700_100043942 3300005441 Bacteria 2749
65 Ga0070663_100030010 3300005455 Bacteria 3721
66 Ga0070663_100121746 3300005455 Bacteria 1972
67 Ga0070663_100282332 3300005455 Bacteria 1323
68 Ga0070678_100001875 3300005456 Bacteria 11349
69 Ga0070678_100024886 3300005456 Bacteria 4016
70 Ga0070662_100037321 3300005457 Bacteria 3445
71 Ga0070681_10011691 3300005458 Bacteria 8695
72 Ga0070681_10033701 3300005458 Bacteria 5141
73 Ga0070681_10110039 3300005458 Bacteria 2695
74 Ga0070681_10321508 3300005458 Bacteria 1457
75 Ga0068867_100029053 3300005459 Bacteria 3983
76 Ga0068867_100061763 3300005459 Bacteria 2783
77 Ga0068867_100080475 3300005459 Bacteria 2453
78 Ga0070685_10006353 3300005466 Bacteria 6022
79 Ga0070679_100026522 3300005530 Bacteria 5694
80 Ga0070679_100043843 3300005530 Bacteria 4454
81 Ga0070679_100168943 3300005530 Bacteria 2160
82 Ga0070684_100027614 3300005535 Bacteria 4792
83 Ga0068853_100003342 3300005539 Bacteria 12280
84 Ga0068853_100003976 3300005539 Bacteria 11360
85 Ga0068853_100043682 3300005539 Bacteria 3834
86 Ga0068853_100341890 3300005539 Bacteria 1391
87 Ga0068853_100624120 3300005539 Bacteria 1025
88 Ga0070686_100002971 3300005544 Bacteria 9295
89 Ga0070686_100104114 3300005544 Bacteria 1922
90 Ga0070686_100526849 3300005544 Bacteria 921
91 Ga0070696_100140564 3300005546 Bacteria 1764
92 Ga0070665_100002077 3300005548 Bacteria 22476
93 Ga0070665_100006015 3300005548 Bacteria 12406
94 Ga0068855_100015021 3300005563 Bacteria 9326
95 Ga0068855_100094553 3300005563 Bacteria 3446
96 Ga0068855_100334221 3300005563 Bacteria 1672
97 Ga0070664_100039756 3300005564 Bacteria 3964
98 Ga0070664_100041451 3300005564 Bacteria 3885
99 Ga0070664_100061757 3300005564 Bacteria 3194
100 Ga0068857_100016776 3300005577 Bacteria 6416
101 Ga0068854_100003014 3300005578 Bacteria 10460
102 Ga0068854_100009963 3300005578 Bacteria 6152
103 Ga0068856_100000157 3300005614 Bacteria 70380
104 Ga0068856_100000712 3300005614 Bacteria 36113
105 Ga0068856_100144794 3300005614 Bacteria 2384
106 Ga0068856_100591230 3300005614 Bacteria 1131
107 Ga0070702_100230926 3300005615 Bacteria 1243
108 Ga0068852_100015524 3300005616 Bacteria 5911
109 Ga0068852_100061933 3300005616 Bacteria 3252
110 Ga0068859_100016802 3300005617 Bacteria 7348
111 Ga0068859_100504371 3300005617 Bacteria 1305
112 Ga0068859_100671695 3300005617 Bacteria 1127
113 Ga0068864_100050760 3300005618 Bacteria 3571
114 Ga0068864_100060819 3300005618 Bacteria 3270
115 Ga0068864_100281331 3300005618 Bacteria 1553
116 Ga0068866_10001434 3300005718 Bacteria 10183
117 Ga0068866_10144993 3300005718 Unclassified 1368
118 Ga0068861_100036833 3300005719 Bacteria 3633
119 Ga0068861_100067813 3300005719 Bacteria 2755
120 Ga0068851_10000983 3300005834 Bacteria 12365
121 Ga0068870_10013745 3300005840 Bacteria 3811
122 Ga0068863_100162431 3300005841 Bacteria 2140
123 Ga0068863_100179632 3300005841 Bacteria 2032
124 Ga0068863_100781660 3300005841 Bacteria 951
125 Ga0068858_100011593 3300005842 Bacteria 8313
126 Ga0068858_100041895 3300005842 Bacteria 4244
127 Ga0068858_100089557 3300005842 Bacteria 2863
128 Ga0068858_100265849 3300005842 Bacteria 1631
129 Ga0068858_100991936 3300005842 Bacteria 823
130 Ga0068860_100052108 3300005843 Bacteria 3892
131 Ga0068860_100321813 3300005843 Bacteria 1518
132 Ga0068860_100376057 3300005843 Unclassified 1402
133 Ga0068862_100048579 3300005844 Bacteria 3623
134 Ga0068862_100048850 3300005844 Bacteria 3613
135 Ga0068862_100070895 3300005844 Bacteria 3009
136 Ga0097621_100034054 3300006237 Bacteria 4060
137 Ga0097621_100045412 3300006237 Bacteria 3549
138 Ga0097621_100206767 3300006237 Bacteria 1706
139 Ga0097621_100248401 3300006237 Bacteria 1557
140 Ga0068871_100024728 3300006358 Bacteria 4661
141 Ga0068871_100251407 3300006358 Unclassified 1540
142 Ga0068871_100864683 3300006358 Bacteria 836
143 Ga0075434_100265430 3300006871 Bacteria 1736
144 Ga0068865_100046050 3300006881 Bacteria 2992
145 Ga0068865_100164742 3300006881 Bacteria 1694
146 Ga0097620_100016802 3300006931 Bacteria 7348
147 Ga0097620_100504371 3300006931 Bacteria 1305
148 Ga0097620_100671756 3300006931 Bacteria 1127
149 Ga0075435_100068469 3300007076 Bacteria 2892
150 Ga0105240_10004369 3300009093 Bacteria 21580
151 Ga0105240_10633294 3300009093 Bacteria 1174
152 Ga0105240_10740289 3300009093 Bacteria 1070
153 Ga0105240_11226192 3300009093 Bacteria 794
154 Ga0111539_10001369 3300009094 Bacteria 32444
155 Ga0111539_10013037 3300009094 Bacteria 10404
156 Ga0105243_10157280 3300009148 Unclassified 1956
157 Ga0105243_11451700 3300009148 Bacteria 708
158 Ga0105241_10282080 3300009174 Bacteria 1419
159 Ga0105248_10308358 3300009177 Bacteria 1782
160 Ga0105248_10663941 3300009177 Bacteria 1176
161 Ga0105248_11701413 3300009177 Bacteria 715
162 Ga0105249_10156924 3300009553 Bacteria 2195
163 Ga0105239_10044694 3300010375 Bacteria 4855
164 Ga0157373_10095902 3300013100 Bacteria 2088
165 Ga0157373_10379352 3300013100 Bacteria 1011
166 Ga0157371_10008173 3300013102 Bacteria 8367
167 Ga0157371_10309688 3300013102 Bacteria 1144
168 Ga0157370_10010853 3300013104 Bacteria 9567
169 Ga0157370_10036653 3300013104 Bacteria 4758
170 Ga0157370_10094361 3300013104 Bacteria 2807
171 Ga0157370_10122196 3300013104 Bacteria 2431
172 Ga0157370_10153252 3300013104 Bacteria 2144
173 Ga0157370_10290447 3300013104 Bacteria 1510
174 Ga0157370_10426743 3300013104 Bacteria 1219
175 Ga0157369_10003683 3300013105 Bacteria 18212
176 Ga0157369_10179584 3300013105 Bacteria 2227
177 Ga0157369_10346739 3300013105 Bacteria 1542
178 Ga0157369_10443397 3300013105 Bacteria 1345
179 Ga0157374_10009110 3300013296 Bacteria 8505
180 Ga0157374_10622975 3300013296 Bacteria 1090
181 Ga0157378_10016142 3300013297 Bacteria 6540
182 Ga0157378_10047962 3300013297 Bacteria 3798
183 Ga0163162_10016223 3300013306 Bacteria 7285
184 Ga0163162_10062164 3300013306 Bacteria 3774
185 Ga0157372_10008403 3300013307 Bacteria 10966
186 Ga0157372_10010614 3300013307 Bacteria 9799
187 Ga0157372_10082431 3300013307 Bacteria 3641
188 Ga0157372_10601831 3300013307 Bacteria 1281
189 Ga0157375_10208625 3300013308 Bacteria 2110
190 Ga0157375_11069169 3300013308 Bacteria 944
191 Ga0163163_10023873 3300014325 Bacteria 5812
192 Ga0163163_10286630 3300014325 Bacteria 1699
193 Ga0163163_10879672 3300014325 Bacteria 959
194 Ga0157380_10003905 3300014326 Bacteria 10278
195 Ga0157377_10022927 3300014745 Bacteria 3302
196 Ga0157379_10001083 3300014968 Bacteria 22234
197 Ga0157379_10020309 3300014968 Bacteria 5872
198 Ga0157379_10243949 3300014968 Bacteria 1630
199 Ga0157376_10005768 3300014969 Bacteria 8675
200 Ga0183369_1011 3300015685 Bacteria 252490
201 Ga0163161_10010368 3300017792 Bacteria 6452
202 Ga0163161_10057092 3300017792 Bacteria 2836
203 Ga0163161_10570700 3300017792 Bacteria 929
204 Ga0207697_10001101 3300025315 Bacteria 14905
205 Ga0207656_10008256 3300025321 Bacteria 3823
206 Ga0207682_10000163 3300025893 Bacteria 30371
207 Ga0207682_10014696 3300025893 Bacteria 3051
208 Ga0207682_10116345 3300025893 Bacteria 1182
209 Ga0207642_10028142 3300025899 Bacteria 2310
210 Ga0207688_10000238 3300025901 Bacteria 24983
211 Ga0207680_10016193 3300025903 Bacteria 3908
212 Ga0207680_10053083 3300025903 Bacteria 2432
213 Ga0207680_10216388 3300025903 Bacteria 1311
214 Ga0207699_10132937 3300025906 Bacteria 1625
215 Ga0207645_10001001 3300025907 Bacteria 23330
216 Ga0207645_10273652 3300025907 Unclassified 1120
217 Ga0207643_10000208 3300025908 Bacteria 40933
218 Ga0207643_10018119 3300025908 Bacteria 3858
219 Ga0207705_10263078 3300025909 Bacteria 1317
220 Ga0207705_10462231 3300025909 Bacteria 984
221 Ga0207707_10011222 3300025912 Bacteria 7796
222 Ga0207660_10274125 3300025917 Bacteria 1337
223 Ga0207662_10002209 3300025918 Bacteria 9706
224 Ga0207657_10008209 3300025919 Bacteria 10632
225 Ga0207649_10145103 3300025920 Bacteria 1628
226 Ga0207649_10407325 3300025920 Bacteria 1019
227 Ga0207652_10196203 3300025921 Bacteria 1816
228 Ga0207694_10448130 3300025924 Bacteria 1077
229 Ga0207650_10026661 3300025925 Bacteria 4125
230 Ga0207650_10029749 3300025925 Bacteria 3928
231 Ga0207650_10066349 3300025925 Bacteria 2706
232 Ga0207650_10343306 3300025925 Bacteria 1227
233 Ga0207650_10487914 3300025925 Bacteria 1029
234 Ga0207659_10000891 3300025926 Bacteria 17759
235 Ga0207687_11044806 3300025927 Bacteria 701
236 Ga0207664_10068196 3300025929 Bacteria 2857
237 Ga0207644_10006559 3300025931 Bacteria 7583
238 Ga0207690_10105761 3300025932 Bacteria 2018
239 Ga0207706_10001419 3300025933 Bacteria 23975
240 Ga0207709_10052555 3300025935 Bacteria 2503
241 Ga0207669_10023685 3300025937 Bacteria 3284
242 Ga0207691_10006877 3300025940 Bacteria 10974
243 Ga0207711_10272037 3300025941 Bacteria 1559
244 Ga0207689_10003747 3300025942 Bacteria 13859
245 Ga0207689_10027229 3300025942 Bacteria 4786
246 Ga0207679_10057548 3300025945 Bacteria 2876
247 Ga0207679_10110582 3300025945 Bacteria 2168
248 Ga0207667_10013807 3300025949 Bacteria 9228
249 Ga0207667_10076205 3300025949 Bacteria 3481
250 Ga0207667_10277739 3300025949 Bacteria 1712
251 Ga0207667_10323208 3300025949 Bacteria 1576
252 Ga0207651_10084172 3300025960 Bacteria 2303
253 Ga0207712_10035653 3300025961 Bacteria 3382
254 Ga0207640_10013074 3300025981 Bacteria 4747
255 Ga0207640_10067036 3300025981 Bacteria 2400
256 Ga0207658_10024256 3300025986 Bacteria 4242
257 Ga0207658_10044411 3300025986 Bacteria 3235
258 Ga0207658_10228314 3300025986 Bacteria 1570
259 Ga0207658_10298512 3300025986 Unclassified 1387
260 Ga0207658_10661420 3300025986 Bacteria 942
261 Ga0207677_10007796 3300026023 Bacteria 5944
262 Ga0207677_10017098 3300026023 Bacteria 4315
263 Ga0207703_10027055 3300026035 Bacteria 4517
264 Ga0207703_10072482 3300026035 Bacteria 2847
265 Ga0207639_10029784 3300026041 Bacteria 4000
266 Ga0207639_10150905 3300026041 Bacteria 1946
267 Ga0207639_10450544 3300026041 Bacteria 1168
268 Ga0207678_10000623 3300026067 Bacteria 32400
269 Ga0207678_10156929 3300026067 Bacteria 1943
270 Ga0207678_10390757 3300026067 Bacteria 1203
271 Ga0207708_10001195 3300026075 Bacteria 19572
272 Ga0207708_10009988 3300026075 Bacteria 7048
273 Ga0207708_10163482 3300026075 Bacteria 1759
274 Ga0207702_10000624 3300026078 Bacteria 38966
275 Ga0207641_10052311 3300026088 Bacteria 3458
276 Ga0207648_10004140 3300026089 Bacteria 15006
277 Ga0207648_10007266 3300026089 Bacteria 10920
278 Ga0207648_10018478 3300026089 Bacteria 6311
279 Ga0207648_10089771 3300026089 Bacteria 2685
280 Ga0207676_10014991 3300026095 Bacteria 5585
281 Ga0207674_10003608 3300026116 Bacteria 18867
282 Ga0207675_100007352 3300026118 Bacteria 10406
283 Ga0207675_100018101 3300026118 Bacteria 6567
284 Ga0207683_10001208 3300026121 Bacteria 23398
285 Ga0207683_10001411 3300026121 Bacteria 21704
286 Ga0207683_10045786 3300026121 Bacteria 3826
287 Ga0207683_10081886 3300026121 Bacteria 2866
288 Ga0207698_10142026 3300026142 Bacteria 2070
289 Ga0207698_10587642 3300026142 Bacteria 1096
290 Ga0207698_11082992 3300026142 Bacteria 814
291 Ga0207428_10000086 3300027907 Bacteria 131832
292 Ga0268266_10041218 3300028379 Bacteria 3938
293 Ga0268266_10130444 3300028379 Bacteria 2247
294 Ga0268266_10389526 3300028379 Bacteria 1316
295 Ga0268266_10825614 3300028379 Bacteria 896
296 Ga0268265_10680453 3300028380 Bacteria 992
297 Ga0268264_10047927 3300028381 Bacteria 3553
298 Ga0268264_10231415 3300028381 Bacteria 1707
299 Ga0268264_10812574 3300028381 Bacteria 935
300 Ga0307408_100188682 3300031548 Bacteria 1659
301 Ga0307413_10031949 3300031824 Bacteria 2977
302 Ga0307412_10137811 3300031911 Bacteria 1783
303 Ga0307416_100057705 3300032002 Bacteria 3143
304 Ga0307411_10077422 3300032005 Bacteria 2276
305 Ga0373957_0261320 3300035120 Bacteria 730
306 Ga0373947_0143730 3300035725 Bacteria 1532
307 Ga0373937_0014152 3300036401 Bacteria 7036
308 Ga0242420_038938 3300038996 Bacteria 904
309 Ga0453684_1089833 3300044712 Bacteria 844
310 Ga0451576_0291880 3300045051 Bacteria 1705
311 Ga0466958_0664022 3300045836 Bacteria 679
312 Ga0466967_0087714 3300045976 Bacteria 2822
313 Ga0495580_0162210 3300046472 Bacteria 1547
314 Ga0495621_0021265 3300046539 Bacteria 2138
315 Ga0495647_0138570 3300046681 Bacteria 1036
316 Ga0496100_0000968 3300048903 Bacteria 13777
317 Ga0496101_0090112 3300048904 Bacteria 2280
318 Ga0496102_0008802 3300048905 Bacteria 8659
319 Ga0496104_0020420 3300048907 Bacteria 6071
320 Ga0496106_0041987 3300048909 Bacteria 3429
321 Ga0496106_0776911 3300048909 Bacteria 760
322 Ga0496107_0161613 3300048910 Bacteria 1660
323 Ga0496110_0004336 3300048913 Bacteria 10979
324 Ga0496111_0134956 3300048914 Bacteria 1828
325 Ga0496114_0417990 3300048917 Bacteria 1187
326 Ga0501031_0027046 3300049568 Bacteria 3739
327 Ga0501031_0113643 3300049568 Bacteria 1768
328 Ga0501032_0089654 3300049569 Bacteria 2041
329 Ga0501033_0006555 3300049570 Bacteria 9105
330 Ga0501036_0016078 3300049572 Bacteria 6252
331 Ga0501037_0014455 3300049573 Bacteria 5809
332 Ga0501040_0149183 3300049576 Bacteria 1649
333 Ga0501042_0031461 3300049578 Bacteria 3753
334 Ga0501043_0080617 3300049579 Bacteria 2557
335 Ga0501043_0096562 3300049579 Bacteria 2323
336 Ga0501046_0031255 3300049580 Bacteria 4318
337 Ga0501046_0139460 3300049580 Bacteria 1836
338 Ga0501046_0309173 3300049580 Bacteria 1153
339 Ga0501047_0276755 3300049581 Bacteria 1524
340 Ga0501047_0414137 3300049581 Bacteria 1179
341 Ga0501047_0546650 3300049581 Bacteria 983
342 Ga0501048_0021957 3300049582 Bacteria 4672
343 Ga0501048_0043025 3300049582 Bacteria 3233
344 Ga0501067_0262597 3300049583 Bacteria 961
345 Ga0501070_0160902 3300049586 Bacteria 1851
346 Ga0501070_0222821 3300049586 Bacteria 1546
347 Ga0501072_0860355 3300049588 Bacteria 709
348 Ga0501073_0049221 3300049589 Bacteria 2956
349 Ga0501073_0171344 3300049589 Bacteria 1502
350 Ga0501080_0040525 3300049742 Bacteria 4344
351 Ga0501035_0060008 3300049822 Bacteria 3387
352 Ga0501035_0095233 3300049822 Bacteria 2617
353 Ga0501035_0132032 3300049822 Bacteria 2176
354 Ga0501035_0168251 3300049822 Bacteria 1894
355 Ga0501044_0062946 3300049823 Bacteria 3791
356 Ga0501044_0140745 3300049823 Bacteria 2401
357 Ga0501044_0381543 3300049823 Bacteria 1324
358 Ga0501044_0381981 3300049823 Bacteria 1323
359 Ga0501044_0406438 3300049823 Bacteria 1273
360 nmdc:mga0qj67_364534_c1 3300050509 Bacteria 1167
361 nmdc:mga08y16_98_c1 3300050511 Bacteria 73684
362 nmdc:mga0rr50_625820_c1 3300050513 Bacteria 918
363 nmdc:mga0rr50_76520_c1 3300050513 Bacteria 2569
364 Ga0500619_000246 3300053154 Bacteria 11678
365 Ga0501082_0127842 3300060353 Bacteria 2204
366 2687584865 2687453130 Bacteria 4227172
367 8055910646 8055909800 Bacteria 7278581
368 Ga0068852_100049537
369 JGI24743J22301_10001364
370 JGI24749J21850_1000944
371 JGI24751J29686_10050276
372 Ga0065712_10215916
373 Ga0065715_10259290
374 Ga0065707_10129222
375 Ga0070658_10250359
376 Ga0070676_10005167
377 Ga0070676_10343281
378 Ga0070683_100003301
379 Ga0070683_100011460
380 Ga0070690_100084854
381 Ga0070690_100130078
382 Ga0070670_100006785
383 Ga0070670_100267393
384 Ga0070670_100445387
385 Ga0070677_10039102
386 Ga0068869_100004727
387 Ga0068869_100279794
388 Ga0070666_10013463
389 Ga0070680_100032497
390 Ga0070680_100066882
391 Ga0070680_100518635
392 Ga0070682_100002517
393 Ga0070682_100008626
394 Ga0068868_100054969
395 Ga0068868_100284563
396 Ga0070660_100129128
397 Ga0070660_100292706
398 Ga0070689_100004379
399 Ga0070689_100093778
400 Ga0070687_100024298
401 Ga0070661_100004151
402 Ga0070661_100485909
403 Ga0070692_10036455
404 Ga0070668_100318290
405 Ga0070668_100847014
406 Ga0070669_100046741
407 Ga0070669_100239294
408 Ga0070675_100023346
409 Ga0070675_100059890
410 Ga0070671_100011020
411 Ga0070674_100016390
412 Ga0070674_100160495
413 Ga0070674_101029727
414 Ga0070673_100013032
415 Ga0070673_100065401
416 Ga0070673_100611924
417 Ga0070688_100040376
418 Ga0070659_100011829
419 Ga0070659_100072438
420 Ga0070659_100300066
421 Ga0070667_100003844
422 Ga0070667_100121022
423 Ga0070667_100215837
424 Ga0070667_100290690
425 Ga0070667_100668210
426 Ga0070709_10063419
427 Ga0070714_100053767
428 Ga0070714_100066058
429 Ga0070701_10017464
430 Ga0070700_100040173
431 Ga0070700_100043942
432 Ga0070663_100030010
433 Ga0070663_100121746
434 Ga0070663_100282332
435 Ga0070678_100001875
436 Ga0070678_100024886
437 Ga0070662_100037321
438 Ga0070681_10011691
439 Ga0070681_10033701
440 Ga0070681_10110039
441 Ga0070681_10321508
442 Ga0068867_100029053
443 Ga0068867_100061763
444 Ga0068867_100080475
445 Ga0070685_10006353
446 Ga0070679_100026522
447 Ga0070679_100043843
448 Ga0070679_100168943
449 Ga0070684_100027614
450 Ga0068853_100003342
451 Ga0068853_100003976
452 Ga0068853_100043682
453 Ga0068853_100341890
454 Ga0068853_100624120
455 Ga0070686_100002971
456 Ga0070686_100104114
457 Ga0070686_100526849
458 Ga0070696_100140564
459 Ga0070665_100002077
460 Ga0070665_100006015
461 Ga0068855_100015021
462 Ga0068855_100094553
463 Ga0068855_100334221
464 Ga0070664_100039756
465 Ga0070664_100041451
466 Ga0070664_100061757
467 Ga0068857_100016776
468 Ga0068854_100003014
469 Ga0068854_100009963
470 Ga0068856_100000157
471 Ga0068856_100000712
472 Ga0068856_100144794
473 Ga0068856_100591230
474 Ga0070702_100230926
475 Ga0068852_100015524
476 Ga0068852_100061933
477 Ga0068859_100016802
478 Ga0068859_100504371
479 Ga0068859_100671695
480 Ga0068864_100050760
481 Ga0068864_100060819
482 Ga0068864_100281331
483 Ga0068866_10001434
484 Ga0068866_10144993
485 Ga0068861_100036833
486 Ga0068861_100067813
487 Ga0068851_10000983
488 Ga0068870_10013745
489 Ga0068863_100162431
490 Ga0068863_100179632
491 Ga0068863_100781660
492 Ga0068858_100011593
493 Ga0068858_100041895
494 Ga0068858_100089557
495 Ga0068858_100265849
496 Ga0068858_100991936
497 Ga0068860_100052108
498 Ga0068860_100321813
499 Ga0068860_100376057
500 Ga0068862_100048579
501 Ga0068862_100048850
502 Ga0068862_100070895
503 Ga0097621_100034054
504 Ga0097621_100045412
505 Ga0097621_100206767
506 Ga0097621_100248401
507 Ga0068871_100024728
508 Ga0068871_100251407
509 Ga0068871_100864683
510 Ga0075434_100265430
511 Ga0068865_100046050
512 Ga0068865_100164742
513 Ga0097620_100016802
514 Ga0097620_100504371
515 Ga0097620_100671756
516 Ga0075435_100068469
517 Ga0105240_10004369
518 Ga0105240_10633294
519 Ga0105240_10740289
520 Ga0105240_11226192
521 Ga0111539_10001369
522 Ga0111539_10013037
523 Ga0105243_10157280
524 Ga0105243_11451700
525 Ga0105241_10282080
526 Ga0105248_10308358
527 Ga0105248_10663941
528 Ga0105248_11701413
529 Ga0105249_10156924
530 Ga0105239_10044694
531 Ga0157373_10095902
532 Ga0157373_10379352
533 Ga0157371_10008173
534 Ga0157371_10309688
535 Ga0157370_10010853
536 Ga0157370_10036653
537 Ga0157370_10094361
538 Ga0157370_10122196
539 Ga0157370_10153252
540 Ga0157370_10290447
541 Ga0157370_10426743
542 Ga0157369_10003683
543 Ga0157369_10179584
544 Ga0157369_10346739
545 Ga0157369_10443397
546 Ga0157374_10009110
547 Ga0157374_10622975
548 Ga0157378_10016142
549 Ga0157378_10047962
550 Ga0163162_10016223
551 Ga0163162_10062164
552 Ga0157372_10008403
553 Ga0157372_10010614
554 Ga0157372_10082431
555 Ga0157372_10601831
556 Ga0157375_10208625
557 Ga0157375_11069169
558 Ga0163163_10023873
559 Ga0163163_10286630
560 Ga0163163_10879672
561 Ga0157380_10003905
562 Ga0157377_10022927
563 Ga0157379_10001083
564 Ga0157379_10020309
565 Ga0157379_10243949
566 Ga0157376_10005768
567 Ga0183369_1011
568 Ga0163161_10010368
569 Ga0163161_10057092
570 Ga0163161_10570700
571 Ga0207697_10001101
572 Ga0207656_10008256
573 Ga0207682_10000163
574 Ga0207682_10014696
575 Ga0207682_10116345
576 Ga0207642_10028142
577 Ga0207688_10000238
578 Ga0207680_10016193
579 Ga0207680_10053083
580 Ga0207680_10216388
581 Ga0207699_10132937
582 Ga0207645_10001001
583 Ga0207645_10273652
584 Ga0207643_10000208
585 Ga0207643_10018119
586 Ga0207705_10263078
587 Ga0207705_10462231
588 Ga0207707_10011222
589 Ga0207660_10274125
590 Ga0207662_10002209
591 Ga0207657_10008209
592 Ga0207649_10145103
593 Ga0207649_10407325
594 Ga0207652_10196203
595 Ga0207694_10448130
596 Ga0207650_10026661
597 Ga0207650_10029749
598 Ga0207650_10066349
599 Ga0207650_10343306
600 Ga0207650_10487914
601 Ga0207659_10000891
602 Ga0207687_11044806
603 Ga0207664_10068196
604 Ga0207644_10006559
605 Ga0207690_10105761
606 Ga0207706_10001419
607 Ga0207709_10052555
608 Ga0207669_10023685
609 Ga0207691_10006877
610 Ga0207711_10272037
611 Ga0207689_10003747
612 Ga0207689_10027229
613 Ga0207679_10057548
614 Ga0207679_10110582
615 Ga0207667_10013807
616 Ga0207667_10076205
617 Ga0207667_10277739
618 Ga0207667_10323208
619 Ga0207651_10084172
620 Ga0207712_10035653
621 Ga0207640_10013074
622 Ga0207640_10067036
623 Ga0207658_10024256
624 Ga0207658_10044411
625 Ga0207658_10228314
626 Ga0207658_10298512
627 Ga0207658_10661420
628 Ga0207677_10007796
629 Ga0207677_10017098
630 Ga0207703_10027055
631 Ga0207703_10072482
632 Ga0207639_10029784
633 Ga0207639_10150905
634 Ga0207639_10450544
635 Ga0207678_10000623
636 Ga0207678_10156929
637 Ga0207678_10390757
638 Ga0207708_10001195
639 Ga0207708_10009988
640 Ga0207708_10163482
641 Ga0207702_10000624
642 Ga0207641_10052311
643 Ga0207648_10004140
644 Ga0207648_10007266
645 Ga0207648_10018478
646 Ga0207648_10089771
647 Ga0207676_10014991
648 Ga0207674_10003608
649 Ga0207675_100007352
650 Ga0207675_100018101
651 Ga0207683_10001208
652 Ga0207683_10001411
653 Ga0207683_10045786
654 Ga0207683_10081886
655 Ga0207698_10142026
656 Ga0207698_10587642
657 Ga0207698_11082992
658 Ga0207428_10000086
659 Ga0268266_10041218
660 Ga0268266_10130444
661 Ga0268266_10389526
662 Ga0268266_10825614
663 Ga0268265_10680453
664 Ga0268264_10047927
665 Ga0268264_10231415
666 Ga0268264_10812574
667 Ga0307408_100188682
668 Ga0307413_10031949
669 Ga0307412_10137811
670 Ga0307416_100057705
671 Ga0307411_10077422
672 Ga0373957_0261320
673 Ga0373947_0143730
674 Ga0373937_0014152
675 Ga0242420_038938
676 Ga0453684_1089833
677 Ga0451576_0291880
678 Ga0466958_0664022
679 Ga0466967_0087714
680 Ga0495580_0162210
681 Ga0495621_0021265
682 Ga0495647_0138570
683 Ga0496100_0000968
684 Ga0496101_0090112
685 Ga0496102_0008802
686 Ga0496104_0020420
687 Ga0496106_0041987
688 Ga0496106_0776911
689 Ga0496107_0161613
690 Ga0496110_0004336
691 Ga0496111_0134956
692 Ga0496114_0417990
693 Ga0501031_0027046
694 Ga0501031_0113643
695 Ga0501032_0089654
696 Ga0501033_0006555
697 Ga0501036_0016078
698 Ga0501037_0014455
699 Ga0501040_0149183
700 Ga0501042_0031461
701 Ga0501043_0080617
702 Ga0501043_0096562
703 Ga0501046_0031255
704 Ga0501046_0139460
705 Ga0501046_0309173
706 Ga0501047_0276755
707 Ga0501047_0414137
708 Ga0501047_0546650
709 Ga0501048_0021957
710 Ga0501048_0043025
711 Ga0501067_0262597
712 Ga0501070_0160902
713 Ga0501070_0222821
714 Ga0501072_0860355
715 Ga0501073_0049221
716 Ga0501073_0171344
717 Ga0501080_0040525
718 Ga0501035_0060008
719 Ga0501035_0095233
720 Ga0501035_0132032
721 Ga0501035_0168251
722 Ga0501044_0062946
723 Ga0501044_0140745
724 Ga0501044_0381543
725 Ga0501044_0381981
726 Ga0501044_0406438
727 nmdc:mga0qj67_364534_c1
728 nmdc:mga08y16_98_c1
729 nmdc:mga0rr50_625820_c1
730 nmdc:mga0rr50_76520_c1
731 Ga0500619_000246
732 Ga0501082_0127842
733 2687584865
734 8055910646

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01081

Aldolase

KDPG and KHG aldolase

23

214

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qcc-assembly1.cif.gz_A structure of a cube-shaped, highly porous protein cage designed by fusing symmetric oligomeric domains 0.9823 8 204
2v81-assembly1.cif.gz_A native kdpgal structure 0.9722 1 204
2v81-assembly1.cif.gz_A native kdpgal structure 0.9444 1 204
6xh5-assembly1.cif.gz_A hierarchical design of multi-scale protein complexes by combinatorial assembly of oligomeric helical bundle and repeat protein building blocks 0.933 12 205
1wa3-assembly2.cif.gz_F mechanism of the class i kdpg aldolase 0.9314 12 204
ID Description Score Start End Superfamily
2v81A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9801 6 204 3.20.20.70
2v81A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9469 6 204 3.20.20.70
1vlwB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9308 12 204 3.20.20.70
af_A0A1D6HW21_144_318_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9198 40 202 3.20.20.70
1mxsA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9024 12 202 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A7W1AQ79-F1-model_v4 2-dehydro-3-deoxy-6-phosphogalactonate aldolase (EC 4.1.2.21) 0.997 4 208 GO:0008674
AF-A0A4Q5W3T2-F1-model_v4 deleted 0.9932 13 204
AF-A0A1I4LNP7-F1-model_v4 2-keto-3-deoxy-phosphogalactonate aldolase 0.9927 10 204 GO:0016829
AF-Q6SF71-F1-model_v4 KDPG and KHG aldolase family/SMP-30 family protein 0.9925 12 203 GO:0004341
GO:0005509
GO:0016829
GO:0019853
AF-A0A480AVR8-F1-model_v4 2-dehydro-3-deoxy-6-phosphogalactonate aldolase 0.9924 4 205 GO:0016829

Map