F424291

General Info

Members Datasets Scaffolds Average Seq Length
367 253 734 478

Family's Representative Sequence

Representative Sequence 3300005834|Ga0068851_10000053|Ga0068851_1000005369
Length 528
Sequence MLRAQSAARRYAWVPLGRHAHEFRPTHPGVRCVRPLAGALGRCVILGAMESVADAVERLNRLAATPELIVLARLFGEAGHELSLVGGPVRDAFLGRPVTDLDLTTDATPDQTLAIVNPAAEAVWEIGREFGTIGARFGAHTVEITTYRRDAYDGATRKPDVVFGDDLEADLTRRDFTINAMALRLPDAQHPEPRLVDPTGGVDDLLARTLRTPSGPEVSFGDDPLRMLRAARFAAQLGFVVDPATLDAARGMADRLAIVSAERIGAEIAKLMLAADPVAGIRVLVDSGAAEQVLPEIPALRLEIDEHAHHKDVYEHSLTALNRAIELEKSRGHEPTLILRLAVLLHDIGKPATRVIEPGGVVTFHHHDVLGAKLAAKRLRALRFDNETVKAVSELIRLHLRFFGYAGGAWSDSAVRRYVRDAGPLLEWLHILSRSDVTTRNRRKADELEFAYDDLEERIATLAAEEELAAIRPDLDGEHIMRILHLNPGREVGEAYRFLLEERLEDGPLGPDEAERRLLQWWSARSRG

Samples

Sample ID Description Type Environment
1 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
9 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
10 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
53 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
54 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
55 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
58 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
80 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
81 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
82 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
87 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
91 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
92 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
93 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
94 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
95 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
96 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
97 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
98 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
99 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
100 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
101 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
102 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
103 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
104 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
105 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
106 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
107 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
108 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
109 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
110 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
111 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
112 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
113 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
114 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
115 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
116 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
117 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
118 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
119 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
120 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
121 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
122 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
123 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
124 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
125 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
126 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
127 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
128 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
129 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
142 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
143 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
144 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
145 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
146 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
147 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
149 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
150 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
151 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
152 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
153 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
154 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
155 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
156 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
157 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
158 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
159 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
160 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
161 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
162 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
163 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
164 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
165 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
166 2643221546 Microbacterium sp. Root53 Isolate Unclassified
167 2643221549 Agromyces sp. Root1464 Isolate Unclassified
168 2643221553 Microbacterium sp. Root553 Isolate Unclassified
169 2643221566 Microbacterium sp. Root166 Isolate Unclassified
170 2643221572 Leifsonia sp. Root60 Isolate Unclassified
171 2643221575 Microbacterium sp. Root61 Isolate Unclassified
172 2643221597 Microbacterium sp. Root180 Isolate Unclassified
173 2643221616 Leifsonia sp. Root227 Isolate Unclassified
174 2643221619 Agromyces sp. Root81 Isolate Unclassified
175 2643221630 Microbacterium sp. Root322 Isolate Unclassified
176 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
177 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
178 2643221649 Leifsonia sp. Root4 Isolate Unclassified
179 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
180 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
181 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
182 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
183 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
184 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
185 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
186 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
187 2773857759 Microbacterium sp. 1294 Isolate Unclassified
188 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
189 2808606372 Agromyces sp. 23-23 Isolate Unclassified
190 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
191 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
192 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
193 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
194 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
195 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
196 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
197 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
198 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
199 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
200 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
201 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
202 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
203 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
204 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
205 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
206 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
207 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
208 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
209 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
210 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
211 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
212 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
213 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
214 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
215 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
216 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
217 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
218 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
219 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
220 2919069694 Microbacterium sp. 1154 Isolate Unclassified
221 2919395869 Microbacterium resistens 2980 Isolate Unclassified
222 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
223 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
224 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
225 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
226 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
227 2928153084 Leifsonia sp. 563 Isolate Unclassified
228 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
229 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
230 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
231 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
232 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
233 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
234 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
235 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
236 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
237 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
238 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
239 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
240 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
241 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
242 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
243 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
244 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
245 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
246 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
247 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
248 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
249 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
250 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
251 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
252 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
253 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 73.57
Metatranscriptomes 1.63
Isolates 24.8

Biome Distribution

Category Percentage (%)
Aerial Root 0.82
Bulb 0
Endosphere 13.62
Nodule 0
Rhizoplane 5.72
Rhizosphere 50.41
Stem 0
Stem Tuber 0.27
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068851_10000053 3300005834 Bacteria 71192
2 JGI24740J21852_10001387 3300001979 Bacteria 11056
3 JGI24737J22298_10028239 3300001990 Bacteria 1764
4 JGI24735J21928_10001396 3300002067 Bacteria 8545
5 JGI25154J39366_1000794 3300002738 Bacteria 13972
6 JGI25164J39214_1000945 3300002772 Bacteria 9390
7 JGI25165J46597_1000005 3300003214 Bacteria 623702
8 Ga0006562J51391_1017004 3300003578 Bacteria 9480
9 Ga0006562J51391_1017005 3300003578 Bacteria 6780
10 Ga0006562J51391_1086704 3300003578 Bacteria 18405
11 Ga0006562J51391_1086705 3300003578 Bacteria 16230
12 Ga0055539_1000014 3300003752 Bacteria 381086
13 Ga0055539_1002938 3300003752 Bacteria 2468
14 Ga0055533_1000002 3300003756 Bacteria 1196393
15 Ga0055525_1001024 3300003759 Bacteria 7325
16 Ga0055527_1000004 3300003760 Bacteria 570634
17 Ga0055542_1000019 3300003762 Bacteria 341174
18 Ga0055529_1000008 3300003763 Bacteria 394786
19 Ga0065714_10070685 3300005288 Bacteria 3790
20 Ga0070658_10001447 3300005327 Bacteria 20259
21 Ga0070658_10013152 3300005327 Bacteria 6640
22 Ga0070658_10029824 3300005327 Bacteria 4382
23 Ga0070682_100031558 3300005337 Bacteria 3205
24 Ga0068868_100016710 3300005338 Bacteria 5456
25 Ga0070659_100005815 3300005366 Bacteria 8882
26 Ga0070659_100071394 3300005366 Bacteria 2760
27 Ga0070663_100097994 3300005455 Bacteria 2183
28 Ga0070685_10002979 3300005466 Bacteria 8647
29 Ga0068853_100008802 3300005539 Bacteria 8118
30 Ga0070672_100009796 3300005543 Bacteria 6621
31 Ga0068855_100031779 3300005563 Bacteria 6302
32 Ga0068855_100042372 3300005563 Bacteria 5393
33 Ga0068855_100054710 3300005563 Bacteria 4690
34 Ga0068855_100240684 3300005563 Bacteria 2022
35 Ga0068857_100001906 3300005577 Bacteria 16804
36 Ga0068852_100021299 3300005616 Bacteria 5173
37 Ga0068852_100068254 3300005616 Bacteria 3111
38 Ga0068858_100000176 3300005842 Bacteria 68056
39 Ga0075364_10009663 3300006051 Bacteria 5795
40 Ga0075367_10004254 3300006178 Bacteria 6957
41 Ga0105240_10018586 3300009093 Bacteria 9324
42 Ga0105245_10025233 3300009098 Bacteria 5225
43 Ga0105245_10169600 3300009098 Bacteria 2078
44 Ga0105243_10010551 3300009148 Bacteria 7015
45 Ga0105243_10027461 3300009148 Bacteria 4361
46 Ga0105241_10000797 3300009174 Bacteria 23942
47 Ga0105248_10000897 3300009177 Bacteria 33319
48 Ga0105237_10006213 3300009545 Bacteria 13315
49 Ga0105237_10199113 3300009545 Bacteria 2002
50 Ga0105238_10000476 3300009551 Bacteria 42016
51 Ga0105239_10042186 3300010375 Bacteria 4999
52 Ga0157369_10000935 3300013105 Bacteria 37105
53 Ga0157369_10266364 3300013105 Bacteria 1786
54 Ga0171462_1005 3300013250 Bacteria 598379
55 Ga0157374_10089098 3300013296 Bacteria 2939
56 Ga0157372_10110691 3300013307 Bacteria 3146
57 Ga0157372_10148478 3300013307 Bacteria 2704
58 Ga0157375_10331832 3300013308 Bacteria 1686
59 Ga0163163_10077655 3300014325 Bacteria 3315
60 Ga0157379_10003042 3300014968 Bacteria 14170
61 Ga0206354_11255560 3300020081 Bacteria 10711
62 Ga0206353_11216220 3300020082 Bacteria 7581
63 Ga0209566_100056 3300025225 Bacteria 209595
64 Ga0209674_100001 3300025226 Bacteria 4013750
65 Ga0209672_100011 3300025228 Bacteria 856297
66 Ga0209147_100289 3300025229 Bacteria 42738
67 Ga0209563_100001 3300025230 Bacteria 4013775
68 Ga0207427_100024 3300025231 Bacteria 438403
69 Ga0209437_100243 3300025233 Bacteria 88712
70 Ga0209646_1000030 3300025246 Bacteria 384216
71 Ga0209677_100001 3300025253 Bacteria 4013787
72 Ga0209677_100271 3300025253 Bacteria 34642
73 Ga0209148_1000023 3300025254 Bacteria 680511
74 Ga0209148_1001423 3300025254 Bacteria 12233
75 Ga0209233_1000001 3300025261 Bacteria 2992747
76 Ga0209455_1000023 3300025272 Bacteria 680449
77 Ga0209455_1007847 3300025272 Bacteria 2965
78 Ga0207656_10000001 3300025321 Bacteria 1323684
79 Ga0207655_1002175 3300025728 Bacteria 16307
80 Ga0207655_1007030 3300025728 Bacteria 7369
81 Ga0207647_10020626 3300025904 Bacteria 4415
82 Ga0207705_10000001 3300025909 Bacteria 2061880
83 Ga0207705_10022973 3300025909 Bacteria 4448
84 Ga0207705_10057205 3300025909 Bacteria 2813
85 Ga0207705_10100740 3300025909 Bacteria 2125
86 Ga0207654_10000001 3300025911 Bacteria 1816198
87 Ga0207695_10002309 3300025913 Bacteria 28441
88 Ga0207695_10005789 3300025913 Bacteria 16270
89 Ga0207671_10000001 3300025914 Bacteria 1318881
90 Ga0207671_10100574 3300025914 Bacteria 2189
91 Ga0207657_10016025 3300025919 Bacteria 7234
92 Ga0207694_10000019 3300025924 Bacteria 312382
93 Ga0207694_10048320 3300025924 Bacteria 3292
94 Ga0207687_10011927 3300025927 Bacteria 5683
95 Ga0207687_10105294 3300025927 Bacteria 2084
96 Ga0207709_10005626 3300025935 Bacteria 7083
97 Ga0207691_10045499 3300025940 Bacteria 4033
98 Ga0207711_10000405 3300025941 Bacteria 45662
99 Ga0207667_10026261 3300025949 Bacteria 6364
100 Ga0207667_10036477 3300025949 Bacteria 5270
101 Ga0207667_10050376 3300025949 Bacteria 4394
102 Ga0207667_10187054 3300025949 Bacteria 2126
103 Ga0207668_10120482 3300025972 Bacteria 1986
104 Ga0207703_10000121 3300026035 Bacteria 94523
105 Ga0207641_10044550 3300026088 Bacteria 3732
106 Ga0207676_10212921 3300026095 Bacteria 1716
107 Ga0207674_10064552 3300026116 Bacteria 3693
108 Ga0207698_10000569 3300026142 Bacteria 21528
109 Ga0307509_10170595 3300031507 Bacteria 2055
110 Ga0307514_10010380 3300031649 Bacteria 7783
111 Ga0307405_10032957 3300031731 Bacteria 3068
112 Ga0307406_10000059 3300031901 Bacteria 61305
113 Ga0307406_10103873 3300031901 Bacteria 1941
114 Ga0307412_10017008 3300031911 Bacteria 4346
115 Ga0307409_100112756 3300031995 Bacteria 2284
116 Ga0307416_100129430 3300032002 Bacteria 2269
117 Ga0307415_100122656 3300032126 Bacteria 1952
118 Ga0395899_0013260 3300037312 Bacteria 6307
119 Ga0395900_0000888 3300037418 Bacteria 39271
120 Ga0395900_0247257 3300037418 Bacteria 1786
121 Ga0395898_0000355 3300037466 Bacteria 101003
122 Ga0466965_0070082 3300044683 Bacteria 1762
123 Ga0466965_0123103 3300044683 Bacteria 1340
124 Ga0466961_0034602 3300044693 Bacteria 3243
125 Ga0466963_0078378 3300044694 Bacteria 2233
126 Ga0466968_0031482 3300044735 Bacteria 2201
127 Ga0466970_0000391 3300044765 Bacteria 21287
128 Ga0466970_0033712 3300044765 Bacteria 2707
129 Ga0466957_0060243 3300044842 Bacteria 2327
130 Ga0466960_0011501 3300044901 Bacteria 3706
131 Ga0466960_0036886 3300044901 Bacteria 2291
132 Ga0466959_0028024 3300045049 Bacteria 4177
133 Ga0466958_0022124 3300045836 Bacteria 3721
134 Ga0466967_0208098 3300045976 Bacteria 1855
135 Ga0466967_0212851 3300045976 Bacteria 1834
136 Ga0495627_000289 3300046453 Bacteria 50404
137 Ga0495590_0000091 3300046457 Bacteria 55288
138 Ga0495650_0000211 3300046471 Bacteria 125248
139 Ga0495645_0045344 3300046543 Bacteria 3207
140 Ga0495672_0081867 3300047320 Bacteria 1796
141 Ga0495686_0101502 3300047472 Bacteria 1735
142 Ga0496100_0019448 3300048903 Bacteria 4052
143 Ga0496100_0038474 3300048903 Bacteria 3031
144 Ga0496102_0032354 3300048905 Bacteria 4698
145 Ga0496102_0044181 3300048905 Bacteria 4043
146 Ga0496102_0103406 3300048905 Bacteria 2649
147 Ga0496103_0078573 3300048906 Bacteria 2073
148 Ga0496104_0006124 3300048907 Bacteria 10560
149 Ga0496104_0268407 3300048907 Bacteria 1619
150 Ga0496105_0050237 3300048908 Bacteria 3444
151 Ga0496105_0065230 3300048908 Bacteria 3005
152 Ga0496107_0022638 3300048910 Bacteria 4441
153 Ga0496107_0052687 3300048910 Bacteria 2935
154 Ga0496109_0006387 3300048912 Bacteria 9923
155 Ga0496109_0053185 3300048912 Bacteria 3692
156 Ga0496110_0080044 3300048913 Bacteria 2910
157 Ga0496111_0032229 3300048914 Bacteria 3736
158 Ga0496112_0025608 3300048915 Bacteria 5666
159 Ga0496113_0181811 3300048916 Bacteria 1667
160 Ga0496114_0024405 3300048917 Bacteria 4935
161 Ga0496115_0032130 3300048918 Bacteria 4140
162 Ga0496115_0109008 3300048918 Bacteria 2273
163 Ga0496116_0008179 3300048919 Bacteria 9126
164 Ga0496117_0000014 3300048920 Bacteria 584427
165 Ga0496117_0000669 3300048920 Bacteria 54825
166 Ga0496117_0000927 3300048920 Bacteria 44868
167 Ga0496117_0001906 3300048920 Bacteria 27989
168 Ga0496117_0003947 3300048920 Bacteria 16778
169 Ga0496117_0017217 3300048920 Bacteria 6047
170 Ga0496117_0029650 3300048920 Bacteria 4214
171 Ga0496117_0035953 3300048920 Bacteria 3712
172 Ga0496118_0000985 3300048921 Bacteria 44347
173 Ga0496118_0012075 3300048921 Bacteria 8338
174 Ga0496118_0015250 3300048921 Bacteria 7128
175 Ga0496119_0002902 3300048922 Bacteria 18297
176 Ga0496119_0003472 3300048922 Bacteria 16351
177 Ga0496119_0003985 3300048922 Bacteria 14948
178 Ga0496119_0008900 3300048922 Bacteria 8730
179 Ga0496120_0000922 3300048923 Bacteria 40777
180 Ga0496120_0000935 3300048923 Bacteria 40142
181 Ga0496120_0001113 3300048923 Bacteria 34863
182 Ga0496120_0003581 3300048923 Bacteria 13969
183 Ga0496120_0005621 3300048923 Bacteria 9932
184 Ga0496120_0018211 3300048923 Bacteria 4534
185 Ga0496122_0000065 3300048925 Bacteria 235242
186 Ga0496122_0000270 3300048925 Bacteria 116104
187 Ga0496122_0006110 3300048925 Bacteria 14020
188 Ga0496122_0009396 3300048925 Bacteria 10314
189 Ga0496122_0011428 3300048925 Bacteria 8988
190 Ga0496122_0034681 3300048925 Bacteria 4124
191 Ga0496122_0040504 3300048925 Bacteria 3701
192 Ga0496123_0000006 3300048926 Bacteria 647258
193 Ga0496123_0000036 3300048926 Bacteria 265722
194 Ga0496123_0003351 3300048926 Bacteria 18128
195 Ga0496123_0024307 3300048926 Bacteria 4608
196 Ga0496123_0074616 3300048926 Bacteria 2098
197 Ga0496124_0000090 3300048927 Bacteria 192095
198 Ga0496124_0003698 3300048927 Bacteria 18485
199 Ga0496124_0005735 3300048927 Bacteria 13826
200 Ga0496124_0018997 3300048927 Bacteria 6415
201 Ga0496124_0024708 3300048927 Bacteria 5458
202 Ga0496124_0026030 3300048927 Bacteria 5283
203 Ga0496124_0055200 3300048927 Bacteria 3358
204 Ga0496124_0120593 3300048927 Bacteria 2096
205 Ga0496125_0004968 3300048928 Bacteria 15041
206 Ga0496125_0018220 3300048928 Bacteria 6673
207 Ga0496125_0020177 3300048928 Bacteria 6263
208 Ga0496125_0027128 3300048928 Bacteria 5199
209 Ga0496125_0095627 3300048928 Bacteria 2209
210 Ga0496125_0156584 3300048928 Bacteria 1555
211 Ga0496126_0005175 3300048929 Bacteria 15080
212 Ga0496126_0005314 3300048929 Bacteria 14780
213 Ga0496126_0023669 3300048929 Bacteria 5948
214 Ga0496126_0061326 3300048929 Bacteria 3379
215 Ga0496126_0068159 3300048929 Bacteria 3178
216 Ga0496126_0097407 3300048929 Bacteria 2578
217 Ga0501031_0001529 3300049568 Bacteria 14383
218 Ga0501032_0001402 3300049569 Bacteria 19166
219 Ga0501032_0069322 3300049569 Bacteria 2353
220 Ga0501033_0048961 3300049570 Bacteria 3138
221 Ga0501033_0053260 3300049570 Bacteria 2996
222 Ga0501033_0062978 3300049570 Bacteria 2730
223 Ga0501033_0071577 3300049570 Bacteria 2547
224 Ga0501034_0001298 3300049571 Bacteria 33803
225 Ga0501034_0004667 3300049571 Bacteria 15179
226 Ga0501034_0005840 3300049571 Bacteria 13384
227 Ga0501034_0022670 3300049571 Bacteria 6396
228 Ga0501034_0034896 3300049571 Bacteria 5100
229 Ga0501034_0087931 3300049571 Bacteria 3106
230 Ga0501034_0199589 3300049571 Bacteria 1959
231 Ga0501037_0002176 3300049573 Bacteria 14181
232 Ga0501037_0045118 3300049573 Bacteria 3236
233 Ga0501038_0001027 3300049574 Bacteria 25180
234 Ga0501038_0007618 3300049574 Bacteria 9983
235 Ga0501039_0027293 3300049575 Bacteria 4390
236 Ga0501042_0002934 3300049578 Bacteria 10590
237 Ga0501043_0140098 3300049579 Bacteria 1894
238 Ga0501046_0002885 3300049580 Bacteria 15938
239 Ga0501046_0007104 3300049580 Bacteria 9850
240 Ga0501047_0009274 3300049581 Bacteria 9294
241 Ga0501047_0037803 3300049581 Bacteria 4668
242 Ga0501047_0090828 3300049581 Bacteria 2931
243 Ga0501048_0002150 3300049582 Bacteria 15032
244 Ga0501067_0023632 3300049583 Bacteria 3407
245 Ga0501068_0035051 3300049584 Bacteria 2994
246 Ga0501070_0000269 3300049586 Bacteria 49060
247 Ga0501071_0008440 3300049587 Bacteria 6809
248 Ga0501073_0000063 3300049589 Bacteria 66508
249 Ga0501083_0000178 3300049744 Bacteria 41100
250 Ga0501035_0030218 3300049822 Bacteria 4939
251 Ga0501045_0057212 3300049824 Bacteria 2853
252 nmdc:mga00v17_6372_c1 3300050491 Bacteria 6260
253 nmdc:mga00v17_79236_c1 3300050491 Bacteria 2048
254 nmdc:mga00v17_93261_c1 3300050491 Bacteria 1893
255 nmdc:mga0sz30_6586_c1 3300050516 Bacteria 4322
256 Ga0500635_0000066 3300053080 Bacteria 69274
257 Ga0500643_000124 3300053087 Bacteria 79663
258 Ga0500651_0000601 3300053093 Bacteria 17970
259 Ga0500650_0042368 3300053098 Bacteria 2103
260 Ga0500556_0000008 3300053104 Bacteria 304943
261 Ga0500559_0001832 3300053136 Bacteria 11596
262 Ga0500559_0001986 3300053136 Bacteria 11005
263 Ga0500568_0000003 3300053139 Bacteria 863587
264 Ga0500568_0000099 3300053139 Bacteria 80197
265 Ga0500573_0000005 3300053140 Bacteria 315762
266 Ga0500573_0003599 3300053140 Bacteria 8038
267 Ga0500573_0026028 3300053140 Bacteria 3363
268 Ga0500573_0037797 3300053140 Bacteria 2790
269 Ga0500573_0053689 3300053140 Bacteria 2315
270 Ga0500573_0063901 3300053140 Bacteria 2106
271 Ga0500573_0106555 3300053140 Bacteria 1573
272 Ga0500577_0051307 3300053142 Bacteria 1551
273 Ga0500616_0000010 3300053153 Bacteria 761410
274 Ga0500616_0030359 3300053153 Bacteria 2968
275 Ga0500620_000266 3300053155 Bacteria 10153
276 Ga0500645_003186 3300053730 Bacteria 6817
277 2587861972 2585428094 Bacteria 3604039
278 2588107515 2585428157 Bacteria 3018951
279 2643735236 2643221542 Bacteria 3563959
280 2643752597 2643221546 Bacteria 2910897
281 2643767182 2643221549 Bacteria 4042819
282 2643784468 2643221553 Bacteria 3544260
283 2643847340 2643221566 Bacteria 3460379
284 2643877138 2643221572 Bacteria 3614809
285 2643887548 2643221575 Bacteria 4022601
286 2643997328 2643221597 Bacteria 3347721
287 2644097413 2643221616 Bacteria 4066575
288 2644112883 2643221619 Bacteria 4158469
289 2644172075 2643221630 Bacteria 3601215
290 2644181843 2643221632 Bacteria 3406696
291 2644197571 2643221635 Bacteria 2632343
292 2644280170 2643221649 Bacteria 3867359
293 2644384193 2643221669 Bacteria 3611286
294 2644678356 2643221724 Bacteria 3593515
295 2723644022 2721755702 Bacteria 4373124
296 2730231356 2728369380 Bacteria 3620317
297 2747955344 2747842429 Bacteria 3914386
298 2753303945 2751185788 Bacteria 4541048
299 2758225301 2757320536 Bacteria 3629334
300 2774379443 2773857758 Bacteria 3592392
301 2774382441 2773857759 Bacteria 2963774
302 2808629395 2808606306 Bacteria 3608896
303 2808899911 2808606372 Bacteria 4649509
304 2809225846 2808606447 Bacteria 3572005
305 2812325177 2811994872 Bacteria 4121241
306 2821271832 2821268502 Bacteria 3750023
307 2833712875 2833709550 Bacteria 4008291
308 2844844318 2844841374 Bacteria 3917147
309 2844853618 2844852863 Bacteria 3849151
310 2852635277 2852632344 Bacteria 3463163
311 2852644012 2852643534 Bacteria 3013378
312 2852649267 2852646457 Bacteria 3408613
313 2852666709 2852663356 Bacteria 4090475
314 2852677579 2852677369 Bacteria 3768884
315 2857723033 2857720070 Bacteria 3189373
316 2857726016 2857723135 Bacteria 4217853
317 2857730810 2857729791 Bacteria 4040535
318 2862994071 2862993130 Bacteria 3860849
319 2870625374 2870622029 Bacteria 3643329
320 2870628686 2870628048 Bacteria 3696012
321 2884767343 2884763398 Bacteria 4091164
322 2895662075 2895660088 Bacteria 3782833
323 2897563751 2897561785 Bacteria 3256946
324 2904432183 2904430863 Bacteria 3486923
325 2904502032 2904501621 Bacteria 3401437
326 2904512271 2904509784 Bacteria 3520416
327 2906802509 2906799679 Bacteria 4031749
328 2908677861 2908674828 Bacteria 3382763
329 2908679530 2908678064 Bacteria 3482747
330 2909076406 2909074476 Bacteria 3436050
331 2919040318 2919039151 Bacteria 3391018
332 2919044459 2919042368 Bacteria 3905917
333 2919056267 2919055335 Bacteria 3875751
334 2919070174 2919069694 Bacteria 3622919
335 2919398468 2919395869 Bacteria 3704152
336 2919444702 2919443155 Bacteria 4072969
337 2919526270 2919523602 Bacteria 3788128
338 2928093479 2928090899 Bacteria 3158267
339 2928105692 2928104781 Bacteria 3877447
340 2928122612 2928121344 Bacteria 3972376
341 2928154402 2928153084 Bacteria 4020257
342 2928502477 2928500415 Bacteria 3384541
343 2935412434 2935409751 Bacteria 4179611
344 2939660483 2939657138 Bacteria 3740283
345 2939661407 2939660829 Bacteria 3784848
346 2945969741 2945968032 Bacteria 4111363
347 2946035666 2946033335 Bacteria 3835514
348 2946042121 2946041624 Bacteria 4191385
349 2946083089 2946080515 Bacteria 4310960
350 2964327898 2964326757 Bacteria 3290868
351 2966924447 2966921586 Bacteria 3092803
352 2966926052 2966924647 Bacteria 3268643
353 2974295495 2974294766 Bacteria 3767688
354 2974324702 2974324384 Bacteria 3750535
355 2977229732 2977228692 Bacteria 3450105
356 2977238223 2977236895 Bacteria 3569373
357 2977252634 2977251589 Bacteria 2952848
358 2977264987 2977264416 Bacteria 3750737
359 2984543994 2984542743 Bacteria 3569378
360 2984552198 2984551494 Bacteria 3877562
361 2984582887 2984580707 Bacteria 3351387
362 8004182750 8004182704 Bacteria 3391155
363 8004215555 8004212874 Bacteria 2861420
364 8016255697 8016254467 Bacteria 3797036
365 8045833188 8045830549 Bacteria 4444727
366 8056040414 8056037122 Bacteria 3854319
367 8057346609 8057345674 Bacteria 4160394
368 Ga0068851_10000053
369 JGI24740J21852_10001387
370 JGI24737J22298_10028239
371 JGI24735J21928_10001396
372 JGI25154J39366_1000794
373 JGI25164J39214_1000945
374 JGI25165J46597_1000005
375 Ga0006562J51391_1017004
376 Ga0006562J51391_1017005
377 Ga0006562J51391_1086704
378 Ga0006562J51391_1086705
379 Ga0055539_1000014
380 Ga0055539_1002938
381 Ga0055533_1000002
382 Ga0055525_1001024
383 Ga0055527_1000004
384 Ga0055542_1000019
385 Ga0055529_1000008
386 Ga0065714_10070685
387 Ga0070658_10001447
388 Ga0070658_10013152
389 Ga0070658_10029824
390 Ga0070682_100031558
391 Ga0068868_100016710
392 Ga0070659_100005815
393 Ga0070659_100071394
394 Ga0070663_100097994
395 Ga0070685_10002979
396 Ga0068853_100008802
397 Ga0070672_100009796
398 Ga0068855_100031779
399 Ga0068855_100042372
400 Ga0068855_100054710
401 Ga0068855_100240684
402 Ga0068857_100001906
403 Ga0068852_100021299
404 Ga0068852_100068254
405 Ga0068858_100000176
406 Ga0075364_10009663
407 Ga0075367_10004254
408 Ga0105240_10018586
409 Ga0105245_10025233
410 Ga0105245_10169600
411 Ga0105243_10010551
412 Ga0105243_10027461
413 Ga0105241_10000797
414 Ga0105248_10000897
415 Ga0105237_10006213
416 Ga0105237_10199113
417 Ga0105238_10000476
418 Ga0105239_10042186
419 Ga0157369_10000935
420 Ga0157369_10266364
421 Ga0171462_1005
422 Ga0157374_10089098
423 Ga0157372_10110691
424 Ga0157372_10148478
425 Ga0157375_10331832
426 Ga0163163_10077655
427 Ga0157379_10003042
428 Ga0206354_11255560
429 Ga0206353_11216220
430 Ga0209566_100056
431 Ga0209674_100001
432 Ga0209672_100011
433 Ga0209147_100289
434 Ga0209563_100001
435 Ga0207427_100024
436 Ga0209437_100243
437 Ga0209646_1000030
438 Ga0209677_100001
439 Ga0209677_100271
440 Ga0209148_1000023
441 Ga0209148_1001423
442 Ga0209233_1000001
443 Ga0209455_1000023
444 Ga0209455_1007847
445 Ga0207656_10000001
446 Ga0207655_1002175
447 Ga0207655_1007030
448 Ga0207647_10020626
449 Ga0207705_10000001
450 Ga0207705_10022973
451 Ga0207705_10057205
452 Ga0207705_10100740
453 Ga0207654_10000001
454 Ga0207695_10002309
455 Ga0207695_10005789
456 Ga0207671_10000001
457 Ga0207671_10100574
458 Ga0207657_10016025
459 Ga0207694_10000019
460 Ga0207694_10048320
461 Ga0207687_10011927
462 Ga0207687_10105294
463 Ga0207709_10005626
464 Ga0207691_10045499
465 Ga0207711_10000405
466 Ga0207667_10026261
467 Ga0207667_10036477
468 Ga0207667_10050376
469 Ga0207667_10187054
470 Ga0207668_10120482
471 Ga0207703_10000121
472 Ga0207641_10044550
473 Ga0207676_10212921
474 Ga0207674_10064552
475 Ga0207698_10000569
476 Ga0307509_10170595
477 Ga0307514_10010380
478 Ga0307405_10032957
479 Ga0307406_10000059
480 Ga0307406_10103873
481 Ga0307412_10017008
482 Ga0307409_100112756
483 Ga0307416_100129430
484 Ga0307415_100122656
485 Ga0395899_0013260
486 Ga0395900_0000888
487 Ga0395900_0247257
488 Ga0395898_0000355
489 Ga0466965_0070082
490 Ga0466965_0123103
491 Ga0466961_0034602
492 Ga0466963_0078378
493 Ga0466968_0031482
494 Ga0466970_0000391
495 Ga0466970_0033712
496 Ga0466957_0060243
497 Ga0466960_0011501
498 Ga0466960_0036886
499 Ga0466959_0028024
500 Ga0466958_0022124
501 Ga0466967_0208098
502 Ga0466967_0212851
503 Ga0495627_000289
504 Ga0495590_0000091
505 Ga0495650_0000211
506 Ga0495645_0045344
507 Ga0495672_0081867
508 Ga0495686_0101502
509 Ga0496100_0019448
510 Ga0496100_0038474
511 Ga0496102_0032354
512 Ga0496102_0044181
513 Ga0496102_0103406
514 Ga0496103_0078573
515 Ga0496104_0006124
516 Ga0496104_0268407
517 Ga0496105_0050237
518 Ga0496105_0065230
519 Ga0496107_0022638
520 Ga0496107_0052687
521 Ga0496109_0006387
522 Ga0496109_0053185
523 Ga0496110_0080044
524 Ga0496111_0032229
525 Ga0496112_0025608
526 Ga0496113_0181811
527 Ga0496114_0024405
528 Ga0496115_0032130
529 Ga0496115_0109008
530 Ga0496116_0008179
531 Ga0496117_0000014
532 Ga0496117_0000669
533 Ga0496117_0000927
534 Ga0496117_0001906
535 Ga0496117_0003947
536 Ga0496117_0017217
537 Ga0496117_0029650
538 Ga0496117_0035953
539 Ga0496118_0000985
540 Ga0496118_0012075
541 Ga0496118_0015250
542 Ga0496119_0002902
543 Ga0496119_0003472
544 Ga0496119_0003985
545 Ga0496119_0008900
546 Ga0496120_0000922
547 Ga0496120_0000935
548 Ga0496120_0001113
549 Ga0496120_0003581
550 Ga0496120_0005621
551 Ga0496120_0018211
552 Ga0496122_0000065
553 Ga0496122_0000270
554 Ga0496122_0006110
555 Ga0496122_0009396
556 Ga0496122_0011428
557 Ga0496122_0034681
558 Ga0496122_0040504
559 Ga0496123_0000006
560 Ga0496123_0000036
561 Ga0496123_0003351
562 Ga0496123_0024307
563 Ga0496123_0074616
564 Ga0496124_0000090
565 Ga0496124_0003698
566 Ga0496124_0005735
567 Ga0496124_0018997
568 Ga0496124_0024708
569 Ga0496124_0026030
570 Ga0496124_0055200
571 Ga0496124_0120593
572 Ga0496125_0004968
573 Ga0496125_0018220
574 Ga0496125_0020177
575 Ga0496125_0027128
576 Ga0496125_0095627
577 Ga0496125_0156584
578 Ga0496126_0005175
579 Ga0496126_0005314
580 Ga0496126_0023669
581 Ga0496126_0061326
582 Ga0496126_0068159
583 Ga0496126_0097407
584 Ga0501031_0001529
585 Ga0501032_0001402
586 Ga0501032_0069322
587 Ga0501033_0048961
588 Ga0501033_0053260
589 Ga0501033_0062978
590 Ga0501033_0071577
591 Ga0501034_0001298
592 Ga0501034_0004667
593 Ga0501034_0005840
594 Ga0501034_0022670
595 Ga0501034_0034896
596 Ga0501034_0087931
597 Ga0501034_0199589
598 Ga0501037_0002176
599 Ga0501037_0045118
600 Ga0501038_0001027
601 Ga0501038_0007618
602 Ga0501039_0027293
603 Ga0501042_0002934
604 Ga0501043_0140098
605 Ga0501046_0002885
606 Ga0501046_0007104
607 Ga0501047_0009274
608 Ga0501047_0037803
609 Ga0501047_0090828
610 Ga0501048_0002150
611 Ga0501067_0023632
612 Ga0501068_0035051
613 Ga0501070_0000269
614 Ga0501071_0008440
615 Ga0501073_0000063
616 Ga0501083_0000178
617 Ga0501035_0030218
618 Ga0501045_0057212
619 nmdc:mga00v17_6372_c1
620 nmdc:mga00v17_79236_c1
621 nmdc:mga00v17_93261_c1
622 nmdc:mga0sz30_6586_c1
623 Ga0500635_0000066
624 Ga0500643_000124
625 Ga0500651_0000601
626 Ga0500650_0042368
627 Ga0500556_0000008
628 Ga0500559_0001832
629 Ga0500559_0001986
630 Ga0500568_0000003
631 Ga0500568_0000099
632 Ga0500573_0000005
633 Ga0500573_0003599
634 Ga0500573_0026028
635 Ga0500573_0037797
636 Ga0500573_0053689
637 Ga0500573_0063901
638 Ga0500573_0106555
639 Ga0500577_0051307
640 Ga0500616_0000010
641 Ga0500616_0030359
642 Ga0500620_000266
643 Ga0500645_003186
644 2587861972
645 2588107515
646 2643735236
647 2643752597
648 2643767182
649 2643784468
650 2643847340
651 2643877138
652 2643887548
653 2643997328
654 2644097413
655 2644112883
656 2644172075
657 2644181843
658 2644197571
659 2644280170
660 2644384193
661 2644678356
662 2723644022
663 2730231356
664 2747955344
665 2753303945
666 2758225301
667 2774379443
668 2774382441
669 2808629395
670 2808899911
671 2809225846
672 2812325177
673 2821271832
674 2833712875
675 2844844318
676 2844853618
677 2852635277
678 2852644012
679 2852649267
680 2852666709
681 2852677579
682 2857723033
683 2857726016
684 2857730810
685 2862994071
686 2870625374
687 2870628686
688 2884767343
689 2895662075
690 2897563751
691 2904432183
692 2904502032
693 2904512271
694 2906802509
695 2908677861
696 2908679530
697 2909076406
698 2919040318
699 2919044459
700 2919056267
701 2919070174
702 2919398468
703 2919444702
704 2919526270
705 2928093479
706 2928105692
707 2928122612
708 2928154402
709 2928502477
710 2935412434
711 2939660483
712 2939661407
713 2945969741
714 2946035666
715 2946042121
716 2946083089
717 2964327898
718 2966924447
719 2966926052
720 2974295495
721 2974324702
722 2977229732
723 2977238223
724 2977252634
725 2977264987
726 2984543994
727 2984552198
728 2984582887
729 8004182750
730 8004215555
731 8016255697
732 8045833188
733 8056040414
734 8057346609

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12627

PolyA_pol_RNAbd

Probable RNA and SrmB- binding site of polymerase A

238

300

0.97

PF01743

PolyA_pol

Poly A polymerase head domain

82

211

0.92

PF01966

HD

HD domain

313

441

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3aql-assembly1.cif.gz_B structure of bacterial protein (apo form ii) 0.8139 22 399
3wfr-assembly1.cif.gz_E trna processing enzyme complex 2 0.7907 20 408
3wfq-assembly2.cif.gz_F trna processing enzyme complex 1 0.7873 20 408
3wfs-assembly2.cif.gz_D trna processing enzyme complex 3 0.7865 20 408
3wfs-assembly1.cif.gz_C trna processing enzyme complex 3 0.7854 22 408
ID Description Score Start End Superfamily
af_L7N672_164_416_1.10.3090.10 Mainly Alpha;Orthogonal Bundle;cca-adding enzyme, domain 2;cca-adding enzyme, domain 2 0.9821 159 413 1.10.3090.10
1miyB02 Mainly Alpha;Orthogonal Bundle;Hydrophobic Seed Protein; 0.9687 163 238 1.10.110.30
af_L7N672_164_416_1.10.3090.10 Mainly Alpha;Orthogonal Bundle;cca-adding enzyme, domain 2;cca-adding enzyme, domain 2 0.9668 159 413 1.10.3090.10
1miwB01 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.9311 20 161 3.30.460.10
3h37A02 Mainly Alpha;Orthogonal Bundle;Hydrophobic Seed Protein; 0.9024 158 241 1.10.110.30
ID Description Score Start End GO Terms
AF-T0YJW9-F1-model_v4 tRNA nucleotidyltransferase 0.9712 98 244 GO:0000049
GO:0000166
GO:0008033
GO:0016779
AF-A0A6C9EIU9-F1-model_v4 CCA tRNA nucleotidyltransferase 0.9688 20 237 GO:0000049
GO:0000166
GO:0008033
GO:0016779
AF-A0A6I2X0Q7-F1-model_v4 deleted 0.9677 3 428
AF-A0A127SJK5-F1-model_v4 Putative RNA and SrmB-binding site of polymerase A 0.9622 80 275 GO:0000049
GO:0000166
GO:0008033
GO:0016779
AF-A0A127SJK5-F1-model_v4 Putative RNA and SrmB-binding site of polymerase A 0.9528 80 275 GO:0000049
GO:0000166
GO:0008033
GO:0016779

Map