F424328

General Info

Members Datasets Scaffolds Average Seq Length
367 239 732 77

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10219320|Ga0105242_102193202
Length 86
Sequence MCSNQDEAMPRSPTEETLDLRGLKCPMPALLAKKALARLSSGTVLTVLADDPMAVVDIPHMCHGEGHAVDSVASHDGYQEFVLRRT

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
13 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
14 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
61 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
84 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
85 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
86 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
87 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
91 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
92 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
93 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
94 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
97 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
98 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
137 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
138 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
139 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
146 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
147 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
148 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
149 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
150 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
151 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
152 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
153 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
154 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
155 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
156 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
157 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
158 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
159 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
160 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
161 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
162 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
163 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
164 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
165 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
166 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
167 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
175 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
176 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
177 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
178 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
179 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
180 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
181 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
182 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
183 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
184 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
185 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
193 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
194 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
195 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
196 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
197 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
198 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
199 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
200 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
201 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
202 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
203 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
204 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
205 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
206 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
207 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
208 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
209 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
210 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
211 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
212 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
214 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
215 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
216 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
217 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
218 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
219 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
220 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
221 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
222 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
223 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
224 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
225 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
226 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
227 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
228 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
229 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
230 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
231 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
232 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
233 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
234 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
235 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
236 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
237 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
238 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
239 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.64
Metatranscriptomes 0.27
Isolates 7.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.81
Nodule 3.54
Rhizoplane 2.45
Rhizosphere 72.48
Stem 0
Stem Tuber 0
Unclassified 13.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_10219320 3300009176 Bacteria 1699
2 JGI24740J21852_10000006 3300001979 Bacteria 86112
3 JGI25155J39150_1000010 3300002704 Bacteria 207717
4 JGI25156J39149_1000033 3300002705 Bacteria 114688
5 JGI25162J39368_1000411 3300002737 Bacteria 34993
6 JGI25162J39368_1001633 3300002737 Bacteria 11182
7 JGI25154J39366_1000058 3300002738 Bacteria 107363
8 JGI25157J39369_1000009 3300002741 Bacteria 207868
9 JGI25163J39215_1007464 3300002771 Bacteria 613
10 JGI25165J46597_1000035 3300003214 Bacteria 290723
11 JGI25165J46597_1000509 3300003214 Bacteria 37163
12 JGI25165J46597_1000514 3300003214 Bacteria 36799
13 JGI25165J46597_1002522 3300003214 Bacteria 5775
14 JGI25165J46597_1003607 3300003214 Bacteria 3742
15 rootL2_10004914 3300003322 Bacteria 9343
16 rootH1_10079337 3300003323 Bacteria 2128
17 rootH1_10094747 3300003323 Bacteria 3697
18 rootH1_10099403 3300003323 Bacteria 1409
19 Ga0055539_1003221 3300003752 Bacteria 2314
20 Ga0055527_1018384 3300003760 Bacteria 744
21 Ga0058692_1007086 3300003856 Bacteria 3007
22 Ga0070658_10070253 3300005327 Bacteria 2866
23 Ga0070658_10965365 3300005327 Unclassified 741
24 Ga0070676_10853721 3300005328 Bacteria 675
25 Ga0070676_11087049 3300005328 Unclassified 604
26 Ga0070683_100080205 3300005329 Bacteria 3055
27 Ga0070683_100234667 3300005329 Bacteria 1744
28 Ga0070690_100840163 3300005330 Bacteria 715
29 Ga0070670_100529563 3300005331 Bacteria 1050
30 Ga0070677_10093395 3300005333 Unclassified 1313
31 Ga0068869_100696655 3300005334 Bacteria 866
32 Ga0068869_101072255 3300005334 Unclassified 704
33 Ga0070666_10064276 3300005335 Bacteria 2489
34 Ga0070680_101434358 3300005336 Bacteria 598
35 Ga0070682_100946147 3300005337 Unclassified 711
36 Ga0068868_100140251 3300005338 Unclassified 1984
37 Ga0068868_101006558 3300005338 Unclassified 763
38 Ga0068868_101830412 3300005338 Bacteria 574
39 Ga0070660_100019337 3300005339 Bacteria 4988
40 Ga0070660_100293808 3300005339 Bacteria 1331
41 Ga0070691_10142113 3300005341 Bacteria 1224
42 Ga0070691_10221601 3300005341 Unclassified 1003
43 Ga0070661_100648957 3300005344 Bacteria 857
44 Ga0070661_101733794 3300005344 Bacteria 529
45 Ga0070675_100111602 3300005354 Bacteria 2314
46 Ga0070671_101712325 3300005355 Unclassified 558
47 Ga0070673_100491513 3300005364 Bacteria 1109
48 Ga0070673_100939759 3300005364 Bacteria 803
49 Ga0070688_100149746 3300005365 Bacteria 1594
50 Ga0070667_100070432 3300005367 Bacteria 2976
51 Ga0070667_100131551 3300005367 Bacteria 2184
52 Ga0070667_100867644 3300005367 Bacteria 839
53 Ga0070678_101464086 3300005456 Bacteria 639
54 Ga0070662_100049527 3300005457 Bacteria 3029
55 Ga0070662_100630774 3300005457 Bacteria 903
56 Ga0070681_10534283 3300005458 Bacteria 1086
57 Ga0070681_10675971 3300005458 Bacteria 948
58 Ga0070706_101234998 3300005467 Bacteria 686
59 Ga0070679_100020703 3300005530 Bacteria 6417
60 Ga0070679_100248311 3300005530 Bacteria 1736
61 Ga0068853_100030694 3300005539 Bacteria 4541
62 Ga0068853_100173698 3300005539 Bacteria 1951
63 Ga0068853_100310772 3300005539 Bacteria 1459
64 Ga0068853_100709190 3300005539 Unclassified 960
65 Ga0070672_100527825 3300005543 Bacteria 1023
66 Ga0070693_100278770 3300005547 Bacteria 1119
67 Ga0070693_101524747 3300005547 Bacteria 523
68 Ga0070665_100013877 3300005548 Bacteria 8105
69 Ga0070665_100018229 3300005548 Bacteria 7042
70 Ga0070665_100339950 3300005548 Bacteria 1506
71 Ga0070665_100771202 3300005548 Bacteria 974
72 Ga0068855_100118137 3300005563 Unclassified 3037
73 Ga0068855_100260991 3300005563 Bacteria 1930
74 Ga0068855_100265233 3300005563 Bacteria 1912
75 Ga0068855_100353775 3300005563 Bacteria 1617
76 Ga0068857_100068791 3300005577 Bacteria 3152
77 Ga0068857_100126019 3300005577 Bacteria 2308
78 Ga0068857_101956086 3300005577 Bacteria 575
79 Ga0068854_102284425 3300005578 Bacteria 501
80 Ga0068856_100035253 3300005614 Bacteria 4903
81 Ga0068852_100266207 3300005616 Bacteria 1648
82 Ga0068852_100517946 3300005616 Bacteria 1190
83 Ga0068852_102335836 3300005616 Bacteria 556
84 Ga0068859_102720666 3300005617 Bacteria 543
85 Ga0068864_100221243 3300005618 Bacteria 1747
86 Ga0068864_100386941 3300005618 Unclassified 1327
87 Ga0068866_11429825 3300005718 Unclassified 506
88 Ga0068851_10141935 3300005834 Bacteria 1307
89 Ga0068863_100229372 3300005841 Bacteria 1791
90 Ga0068858_100010986 3300005842 Bacteria 8557
91 Ga0068858_101057843 3300005842 Bacteria 796
92 Ga0068860_100113274 3300005843 Bacteria 2593
93 Ga0068860_100218917 3300005843 Bacteria 1848
94 Ga0068862_100806329 3300005844 Bacteria 917
95 Ga0081455_10446901 3300005937 Bacteria 884
96 Ga0097621_100000270 3300006237 Bacteria 35158
97 Ga0097621_100017137 3300006237 Bacteria 5497
98 Ga0068871_100000525 3300006358 Bacteria 26274
99 Ga0068871_100028241 3300006358 Bacteria 4397
100 Ga0068871_100078450 3300006358 Bacteria 2731
101 Ga0068871_100422073 3300006358 Bacteria 1191
102 Ga0068871_100444207 3300006358 Bacteria 1161
103 Ga0068871_100786141 3300006358 Bacteria 876
104 Ga0068871_101895439 3300006358 Unclassified 567
105 Ga0097620_102720686 3300006931 Bacteria 543
106 Ga0105251_10430081 3300009011 Bacteria 610
107 Ga0105244_10264222 3300009036 Bacteria 800
108 Ga0105240_10000013 3300009093 Bacteria 483458
109 Ga0105240_10088048 3300009093 Unclassified 3801
110 Ga0105240_10349767 3300009093 Bacteria 1677
111 Ga0105245_10153263 3300009098 Bacteria 2181
112 Ga0105247_10261614 3300009101 Bacteria 1186
113 Ga0105241_10069805 3300009174 Bacteria 2725
114 Ga0105248_10259114 3300009177 Bacteria 1958
115 Ga0105248_10439377 3300009177 Bacteria 1470
116 Ga0105248_12531075 3300009177 Unclassified 585
117 Ga0105237_10000714 3300009545 Bacteria 45945
118 Ga0105237_10057857 3300009545 Bacteria 3879
119 Ga0105237_10062324 3300009545 Bacteria 3729
120 Ga0105237_10856957 3300009545 Bacteria 915
121 Ga0105237_10931015 3300009545 Bacteria 876
122 Ga0105237_11341466 3300009545 Bacteria 722
123 Ga0105238_10132403 3300009551 Bacteria 2472
124 Ga0105238_10455547 3300009551 Bacteria 1276
125 Ga0105238_10458391 3300009551 Bacteria 1272
126 Ga0105238_10948952 3300009551 Bacteria 880
127 Ga0105238_11864444 3300009551 Unclassified 634
128 Ga0105239_10012153 3300010375 Bacteria 9600
129 Ga0105239_10126889 3300010375 Bacteria 2836
130 Ga0105239_10304139 3300010375 Bacteria 1796
131 Ga0105239_10517742 3300010375 Bacteria 1357
132 Ga0105239_12079074 3300010375 Bacteria 660
133 Ga0105239_13507928 3300010375 Bacteria 510
134 Ga0105246_10042593 3300011119 Bacteria 3075
135 Ga0157373_10366381 3300013100 Bacteria 1029
136 Ga0157370_10000209 3300013104 Bacteria 74351
137 Ga0157370_10032289 3300013104 Bacteria 5113
138 Ga0157370_10418296 3300013104 Bacteria 1233
139 Ga0157370_11089719 3300013104 Unclassified 722
140 Ga0157369_10040399 3300013105 Bacteria 5093
141 Ga0157369_10049746 3300013105 Bacteria 4543
142 Ga0157369_10394058 3300013105 Bacteria 1437
143 Ga0157369_11841101 3300013105 Unclassified 614
144 Ga0157374_10042394 3300013296 Bacteria 4198
145 Ga0157374_11129270 3300013296 Bacteria 804
146 Ga0157374_12050117 3300013296 Bacteria 599
147 Ga0163162_10067691 3300013306 Bacteria 3621
148 Ga0157372_10029605 3300013307 Bacteria 5981
149 Ga0157372_10716458 3300013307 Bacteria 1164
150 Ga0157372_11883735 3300013307 Unclassified 687
151 Ga0157375_10236626 3300013308 Unclassified 1985
152 Ga0157375_10973209 3300013308 Bacteria 989
153 Ga0157375_13638111 3300013308 Unclassified 513
154 Ga0163163_10138136 3300014325 Bacteria 2479
155 Ga0163163_11042188 3300014325 Unclassified 881
156 Ga0182008_10037397 3300014497 Bacteria 2428
157 Ga0157377_11104997 3300014745 Bacteria 608
158 Ga0157379_10001857 3300014968 Bacteria 17483
159 Ga0157379_10337387 3300014968 Bacteria 1378
160 Ga0157376_11154072 3300014969 Unclassified 802
161 Ga0157376_11811663 3300014969 Unclassified 647
162 Ga0182007_10001254 3300015262 Bacteria 13794
163 Ga0182005_1012952 3300015265 Bacteria 2349
164 Ga0213871_10145967 3300021441 Bacteria 718
165 Ga0209435_100009 3300025206 Bacteria 476614
166 Ga0209760_101903 3300025207 Bacteria 2056
167 Ga0209672_104581 3300025228 Bacteria 2540
168 Ga0209563_109716 3300025230 Bacteria 1440
169 Ga0207427_105572 3300025231 Bacteria 1750
170 Ga0209437_100057 3300025233 Bacteria 362922
171 Ga0209437_100107 3300025233 Bacteria 218656
172 Ga0209646_1000018 3300025246 Bacteria 476716
173 Ga0209646_1003439 3300025246 Bacteria 3132
174 Ga0209646_1018123 3300025246 Bacteria 1033
175 Ga0209026_1000068 3300025250 Bacteria 207601
176 Ga0209677_100297 3300025253 Bacteria 32532
177 Ga0209148_1020169 3300025254 Bacteria 1099
178 Ga0209759_1000007 3300025256 Bacteria 476614
179 Ga0209233_1000006 3300025261 Bacteria 1473685
180 Ga0209233_1000072 3300025261 Bacteria 363074
181 Ga0209233_1000134 3300025261 Bacteria 202535
182 Ga0209233_1000353 3300025261 Bacteria 42997
183 Ga0209455_1005902 3300025272 Bacteria 3698
184 Ga0207656_10007310 3300025321 Bacteria 4015
185 Ga0207682_10208771 3300025893 Unclassified 900
186 Ga0207642_10552218 3300025899 Bacteria 711
187 Ga0207680_10019978 3300025903 Bacteria 3594
188 Ga0207645_10785558 3300025907 Unclassified 647
189 Ga0207705_10172398 3300025909 Unclassified 1629
190 Ga0207684_10342768 3300025910 Bacteria 1287
191 Ga0207654_10507054 3300025911 Bacteria 853
192 Ga0207707_10131910 3300025912 Bacteria 2185
193 Ga0207707_11427419 3300025912 Bacteria 551
194 Ga0207695_10000044 3300025913 Bacteria 440819
195 Ga0207695_10173388 3300025913 Unclassified 2081
196 Ga0207695_10392151 3300025913 Bacteria 1273
197 Ga0207695_11437386 3300025913 Unclassified 570
198 Ga0207671_10000364 3300025914 Bacteria 64550
199 Ga0207671_10046142 3300025914 Unclassified 3223
200 Ga0207671_10718626 3300025914 Bacteria 794
201 Ga0207657_10066218 3300025919 Bacteria 3076
202 Ga0207657_10194638 3300025919 Unclassified 1634
203 Ga0207649_10319175 3300025920 Bacteria 1141
204 Ga0207649_10608800 3300025920 Bacteria 841
205 Ga0207652_10020407 3300025921 Bacteria 5455
206 Ga0207694_10657249 3300025924 Bacteria 883
207 Ga0207694_11615262 3300025924 Bacteria 546
208 Ga0207687_10105353 3300025927 Bacteria 2083
209 Ga0207644_10293670 3300025931 Bacteria 1308
210 Ga0207704_10932700 3300025938 Bacteria 731
211 Ga0207711_10179656 3300025941 Bacteria 1924
212 Ga0207689_10830342 3300025942 Bacteria 780
213 Ga0207661_10054306 3300025944 Bacteria 3209
214 Ga0207661_10481882 3300025944 Bacteria 1132
215 Ga0207667_10116380 3300025949 Unclassified 2754
216 Ga0207667_10141160 3300025949 Unclassified 2480
217 Ga0207667_10315475 3300025949 Bacteria 1597
218 Ga0207640_10497079 3300025981 Bacteria 1015
219 Ga0207658_10062854 3300025986 Bacteria 2780
220 Ga0207658_11021446 3300025986 Bacteria 754
221 Ga0207677_10035638 3300026023 Bacteria 3234
222 Ga0207677_10528181 3300026023 Bacteria 1025
223 Ga0207677_10896803 3300026023 Bacteria 799
224 Ga0207703_10066358 3300026035 Bacteria 2968
225 Ga0207639_10067697 3300026041 Bacteria 2779
226 Ga0207678_10266660 3300026067 Bacteria 1468
227 Ga0207678_10506864 3300026067 Bacteria 1052
228 Ga0207702_11818624 3300026078 Bacteria 601
229 Ga0207641_10967310 3300026088 Bacteria 847
230 Ga0207641_11259034 3300026088 Bacteria 740
231 Ga0207676_10309599 3300026095 Bacteria 1445
232 Ga0207676_10576298 3300026095 Bacteria 1078
233 Ga0207674_10161827 3300026116 Bacteria 2192
234 Ga0207674_11217276 3300026116 Bacteria 723
235 Ga0207674_11349936 3300026116 Bacteria 682
236 Ga0207698_10596606 3300026142 Bacteria 1088
237 Ga0209371_1001242 3300027312 Bacteria 18244
238 Ga0268266_10022347 3300028379 Bacteria 5392
239 Ga0268266_10060298 3300028379 Bacteria 3270
240 Ga0268266_10478337 3300028379 Bacteria 1187
241 Ga0268266_11398255 3300028379 Bacteria 675
242 Ga0268265_10305223 3300028380 Bacteria 1435
243 Ga0268264_10360432 3300028381 Bacteria 1386
244 Ga0268264_10980118 3300028381 Bacteria 851
245 Ga0268256_1000890 3300030500 Bacteria 20629
246 Ga0265332_10365530 3300031238 Unclassified 595
247 Ga0265316_10827097 3300031344 Bacteria 649
248 Ga0307516_10157536 3300031730 Unclassified 2024
249 Ga0373935_1147807 3300035692 Bacteria 579
250 Ga0395900_0022104 3300037418 Bacteria 6507
251 Ga0395898_0016064 3300037466 Bacteria 7669
252 Ga0395901_0914559 3300038443 Bacteria 858
253 Ga0436365_0620536 3300039437 Bacteria 801
254 Ga0436365_0862126 3300039437 Unclassified 512
255 Ga0436360_0744735 3300039438 Bacteria 526
256 Ga0436360_1190189 3300039438 Bacteria 1019
257 Ga0436362_1134520 3300039453 Bacteria 519
258 Ga0451787_031495 3300041441 Bacteria 937
259 Ga0451793_0635232 3300041452 Bacteria 560
260 Ga0466966_0540975 3300044684 Bacteria 701
261 Ga0466963_0104003 3300044694 Bacteria 1945
262 Ga0466971_0159290 3300044719 Bacteria 1056
263 Ga0466970_0059542 3300044765 Bacteria 2045
264 Ga0466957_0423573 3300044842 Bacteria 914
265 Ga0466959_0624616 3300045049 Bacteria 724
266 Ga0466958_0092589 3300045836 Bacteria 1871
267 Ga0495617_084351 3300046452 Bacteria 1040
268 Ga0495650_0328172 3300046471 Bacteria 509
269 Ga0495606_0189637 3300046507 Bacteria 1179
270 Ga0495628_0301373 3300046516 Bacteria 1186
271 Ga0495621_0527572 3300046539 Unclassified 511
272 Ga0495622_0025443 3300046557 Unclassified 2764
273 Ga0495611_0130978 3300046648 Bacteria 1170
274 Ga0495599_0485590 3300046678 Bacteria 728
275 Ga0495624_0380488 3300046690 Bacteria 848
276 Ga0495649_0098669 3300046694 Bacteria 1554
277 Ga0495649_0565880 3300046694 Unclassified 562
278 Ga0495593_0447363 3300047673 Bacteria 646
279 Ga0495615_0236638 3300048090 Unclassified 575
280 Ga0496100_0501086 3300048903 Bacteria 935
281 Ga0496101_0695819 3300048904 Bacteria 803
282 Ga0496102_0047339 3300048905 Bacteria 3907
283 Ga0496103_0037854 3300048906 Bacteria 2958
284 Ga0496106_0572939 3300048909 Bacteria 905
285 Ga0496113_0158514 3300048916 Bacteria 1788
286 Ga0496116_0273899 3300048919 Bacteria 822
287 Ga0496117_0161760 3300048920 Bacteria 1310
288 Ga0496117_0176688 3300048920 Bacteria 1232
289 Ga0496117_0184317 3300048920 Bacteria 1196
290 Ga0496118_0057118 3300048921 Bacteria 2928
291 Ga0496119_0080526 3300048922 Bacteria 1878
292 Ga0496119_0340147 3300048922 Bacteria 729
293 Ga0496119_0344302 3300048922 Bacteria 723
294 Ga0496120_0094108 3300048923 Bacteria 1595
295 Ga0496121_0023105 3300048924 Bacteria 6002
296 Ga0496122_0014551 3300048925 Bacteria 7596
297 Ga0496122_0101592 3300048925 Bacteria 1920
298 Ga0496123_0028557 3300048926 Bacteria 4125
299 Ga0496123_0066284 3300048926 Bacteria 2288
300 Ga0496124_0165712 3300048927 Bacteria 1718
301 Ga0496124_0365752 3300048927 Bacteria 1014
302 Ga0496124_0698326 3300048927 Bacteria 643
303 Ga0496125_0049396 3300048928 Bacteria 3496
304 Ga0496126_0320449 3300048929 Unclassified 1274
305 Ga0496126_0560241 3300048929 Bacteria 905
306 Ga0496126_0837538 3300048929 Bacteria 702
307 Ga0496126_1153098 3300048929 Bacteria 572
308 Ga0501034_0075687 3300049571 Bacteria 3373
309 Ga0501034_0268881 3300049571 Bacteria 1646
310 Ga0501036_0285044 3300049572 Bacteria 1382
311 Ga0501036_0301724 3300049572 Unclassified 1340
312 Ga0501037_0101348 3300049573 Bacteria 2078
313 Ga0501038_0171118 3300049574 Bacteria 1758
314 Ga0501043_0160668 3300049579 Bacteria 1756
315 Ga0501046_0176620 3300049580 Bacteria 1599
316 Ga0501047_0427120 3300049581 Bacteria 1156
317 Ga0501047_1240810 3300049581 Bacteria 559
318 Ga0501067_0780887 3300049583 Unclassified 538
319 Ga0501068_0115831 3300049584 Bacteria 1669
320 Ga0501073_0045136 3300049589 Bacteria 3105
321 Ga0501076_1651616 3300049592 Unclassified 526
322 Ga0501083_0069835 3300049744 Unclassified 2337
323 Ga0501083_0079377 3300049744 Bacteria 2176
324 Ga0501035_0054833 3300049822 Bacteria 3560
325 Ga0495601_0496103 3300053077 Bacteria 788
326 Ga0500635_0058863 3300053080 Bacteria 1335
327 Ga0500646_0237073 3300053090 Unclassified 638
328 Ga0500641_0027301 3300053096 Bacteria 2222
329 Ga0500562_113586 3300053108 Bacteria 738
330 Ga0500594_0060773 3300053118 Unclassified 1089
331 Ga0500595_000989 3300053119 Bacteria 15954
332 Ga0500618_046918 3300053125 Bacteria 983
333 Ga0500559_0563546 3300053136 Unclassified 519
334 Ga0500568_0339184 3300053139 Unclassified 545
335 Ga0500573_0311261 3300053140 Bacteria 782
336 Ga0500577_0119494 3300053142 Unclassified 1096
337 Ga0500604_0082073 3300053151 Bacteria 1043
338 Ga0501084_0941299 3300054114 Bacteria 726
339 Ga0587066_153997 3300059490 Bacteria 572
340 Ga0466962_0086955 3300061719 Bacteria 1497
341 2524462306 2524023209 Bacteria 6679728
342 2585280592 2582581308 Bacteria 7413247
343 2585327957 2582581315 Bacteria 7318924
344 2585334290 2582581316 Bacteria 7774528
345 2585531530 2585427527 Bacteria 7273426
346 2585551556 2585427530 Bacteria 7383882
347 2616306862 2615840626 Bacteria 7921970
348 2616557717 2615840698 Bacteria 7319877
349 2617384968 2617270742 Bacteria 6808054
350 2671113606 2667528174 Bacteria 6435400
351 2778173598 2775507266 Bacteria 7392367
352 2819611117 2818991448 Bacteria 6772224
353 2819638955 2818991453 Bacteria 7181617
354 2838030804 2838029111 Bacteria 6603031
355 2842300413 2842298080 Bacteria 6123127
356 2842362288 2842357229 Bacteria 6485165
357 2842477536 2842475841 Bacteria 6603183
358 2842488103 2842482326 Bacteria 7212537
359 2842504591 2842502639 Bacteria 6604161
360 2842511843 2842509118 Bacteria 6850950
361 2919410935 2919408235 Bacteria 6149349
362 3005421762 3005416602 Bacteria 7064308
363 8005319538 8005314921 Bacteria 7072929
364 8005490168 8005484373 Bacteria 6297373
365 8005646826 8005645114 Bacteria 6950293
366 8005687592 8005682033 Bacteria 6726518
367 Ga0105242_10219320
368 JGI24740J21852_10000006
369 JGI25155J39150_1000010
370 JGI25156J39149_1000033
371 JGI25162J39368_1000411
372 JGI25162J39368_1001633
373 JGI25154J39366_1000058
374 JGI25157J39369_1000009
375 JGI25163J39215_1007464
376 JGI25165J46597_1000035
377 JGI25165J46597_1000509
378 JGI25165J46597_1000514
379 JGI25165J46597_1002522
380 JGI25165J46597_1003607
381 rootL2_10004914
382 rootH1_10079337
383 rootH1_10094747
384 rootH1_10099403
385 Ga0055539_1003221
386 Ga0055527_1018384
387 Ga0058692_1007086
388 Ga0070658_10070253
389 Ga0070658_10965365
390 Ga0070676_10853721
391 Ga0070676_11087049
392 Ga0070683_100080205
393 Ga0070683_100234667
394 Ga0070690_100840163
395 Ga0070670_100529563
396 Ga0070677_10093395
397 Ga0068869_100696655
398 Ga0068869_101072255
399 Ga0070666_10064276
400 Ga0070680_101434358
401 Ga0070682_100946147
402 Ga0068868_100140251
403 Ga0068868_101006558
404 Ga0068868_101830412
405 Ga0070660_100019337
406 Ga0070660_100293808
407 Ga0070691_10142113
408 Ga0070691_10221601
409 Ga0070661_100648957
410 Ga0070661_101733794
411 Ga0070675_100111602
412 Ga0070671_101712325
413 Ga0070673_100491513
414 Ga0070673_100939759
415 Ga0070688_100149746
416 Ga0070667_100070432
417 Ga0070667_100131551
418 Ga0070667_100867644
419 Ga0070678_101464086
420 Ga0070662_100049527
421 Ga0070662_100630774
422 Ga0070681_10534283
423 Ga0070681_10675971
424 Ga0070706_101234998
425 Ga0070679_100020703
426 Ga0070679_100248311
427 Ga0068853_100030694
428 Ga0068853_100173698
429 Ga0068853_100310772
430 Ga0068853_100709190
431 Ga0070672_100527825
432 Ga0070693_100278770
433 Ga0070693_101524747
434 Ga0070665_100013877
435 Ga0070665_100018229
436 Ga0070665_100339950
437 Ga0070665_100771202
438 Ga0068855_100118137
439 Ga0068855_100260991
440 Ga0068855_100265233
441 Ga0068855_100353775
442 Ga0068857_100068791
443 Ga0068857_100126019
444 Ga0068857_101956086
445 Ga0068854_102284425
446 Ga0068856_100035253
447 Ga0068852_100266207
448 Ga0068852_100517946
449 Ga0068852_102335836
450 Ga0068859_102720666
451 Ga0068864_100221243
452 Ga0068864_100386941
453 Ga0068866_11429825
454 Ga0068851_10141935
455 Ga0068863_100229372
456 Ga0068858_100010986
457 Ga0068858_101057843
458 Ga0068860_100113274
459 Ga0068860_100218917
460 Ga0068862_100806329
461 Ga0081455_10446901
462 Ga0097621_100000270
463 Ga0097621_100017137
464 Ga0068871_100000525
465 Ga0068871_100028241
466 Ga0068871_100078450
467 Ga0068871_100422073
468 Ga0068871_100444207
469 Ga0068871_100786141
470 Ga0068871_101895439
471 Ga0097620_102720686
472 Ga0105251_10430081
473 Ga0105244_10264222
474 Ga0105240_10000013
475 Ga0105240_10088048
476 Ga0105240_10349767
477 Ga0105245_10153263
478 Ga0105247_10261614
479 Ga0105241_10069805
480 Ga0105248_10259114
481 Ga0105248_10439377
482 Ga0105248_12531075
483 Ga0105237_10000714
484 Ga0105237_10057857
485 Ga0105237_10062324
486 Ga0105237_10856957
487 Ga0105237_10931015
488 Ga0105237_11341466
489 Ga0105238_10132403
490 Ga0105238_10455547
491 Ga0105238_10458391
492 Ga0105238_10948952
493 Ga0105238_11864444
494 Ga0105239_10012153
495 Ga0105239_10126889
496 Ga0105239_10304139
497 Ga0105239_10517742
498 Ga0105239_12079074
499 Ga0105239_13507928
500 Ga0105246_10042593
501 Ga0157373_10366381
502 Ga0157370_10000209
503 Ga0157370_10032289
504 Ga0157370_10418296
505 Ga0157370_11089719
506 Ga0157369_10040399
507 Ga0157369_10049746
508 Ga0157369_10394058
509 Ga0157369_11841101
510 Ga0157374_10042394
511 Ga0157374_11129270
512 Ga0157374_12050117
513 Ga0163162_10067691
514 Ga0157372_10029605
515 Ga0157372_10716458
516 Ga0157372_11883735
517 Ga0157375_10236626
518 Ga0157375_10973209
519 Ga0157375_13638111
520 Ga0163163_10138136
521 Ga0163163_11042188
522 Ga0182008_10037397
523 Ga0157377_11104997
524 Ga0157379_10001857
525 Ga0157379_10337387
526 Ga0157376_11154072
527 Ga0157376_11811663
528 Ga0182007_10001254
529 Ga0182005_1012952
530 Ga0213871_10145967
531 Ga0209435_100009
532 Ga0209760_101903
533 Ga0209672_104581
534 Ga0209563_109716
535 Ga0207427_105572
536 Ga0209437_100057
537 Ga0209437_100107
538 Ga0209646_1000018
539 Ga0209646_1003439
540 Ga0209646_1018123
541 Ga0209026_1000068
542 Ga0209677_100297
543 Ga0209148_1020169
544 Ga0209759_1000007
545 Ga0209233_1000006
546 Ga0209233_1000072
547 Ga0209233_1000134
548 Ga0209233_1000353
549 Ga0209455_1005902
550 Ga0207656_10007310
551 Ga0207682_10208771
552 Ga0207642_10552218
553 Ga0207680_10019978
554 Ga0207645_10785558
555 Ga0207705_10172398
556 Ga0207684_10342768
557 Ga0207654_10507054
558 Ga0207707_10131910
559 Ga0207707_11427419
560 Ga0207695_10000044
561 Ga0207695_10173388
562 Ga0207695_10392151
563 Ga0207695_11437386
564 Ga0207671_10000364
565 Ga0207671_10046142
566 Ga0207671_10718626
567 Ga0207657_10066218
568 Ga0207657_10194638
569 Ga0207649_10319175
570 Ga0207649_10608800
571 Ga0207652_10020407
572 Ga0207694_10657249
573 Ga0207694_11615262
574 Ga0207687_10105353
575 Ga0207644_10293670
576 Ga0207704_10932700
577 Ga0207711_10179656
578 Ga0207689_10830342
579 Ga0207661_10054306
580 Ga0207661_10481882
581 Ga0207667_10116380
582 Ga0207667_10141160
583 Ga0207667_10315475
584 Ga0207640_10497079
585 Ga0207658_10062854
586 Ga0207658_11021446
587 Ga0207677_10035638
588 Ga0207677_10528181
589 Ga0207677_10896803
590 Ga0207703_10066358
591 Ga0207639_10067697
592 Ga0207678_10266660
593 Ga0207678_10506864
594 Ga0207702_11818624
595 Ga0207641_10967310
596 Ga0207641_11259034
597 Ga0207676_10309599
598 Ga0207676_10576298
599 Ga0207674_10161827
600 Ga0207674_11217276
601 Ga0207674_11349936
602 Ga0207698_10596606
603 Ga0209371_1001242
604 Ga0268266_10022347
605 Ga0268266_10060298
606 Ga0268266_10478337
607 Ga0268266_11398255
608 Ga0268265_10305223
609 Ga0268264_10360432
610 Ga0268264_10980118
611 Ga0268256_1000890
612 Ga0265332_10365530
613 Ga0265316_10827097
614 Ga0307516_10157536
615 Ga0373935_1147807
616 Ga0395900_0022104
617 Ga0395898_0016064
618 Ga0395901_0914559
619 Ga0436365_0620536
620 Ga0436365_0862126
621 Ga0436360_0744735
622 Ga0436360_1190189
623 Ga0436362_1134520
624 Ga0451787_031495
625 Ga0451793_0635232
626 Ga0466966_0540975
627 Ga0466963_0104003
628 Ga0466971_0159290
629 Ga0466970_0059542
630 Ga0466957_0423573
631 Ga0466959_0624616
632 Ga0466958_0092589
633 Ga0495617_084351
634 Ga0495650_0328172
635 Ga0495606_0189637
636 Ga0495628_0301373
637 Ga0495621_0527572
638 Ga0495622_0025443
639 Ga0495611_0130978
640 Ga0495599_0485590
641 Ga0495624_0380488
642 Ga0495649_0098669
643 Ga0495649_0565880
644 Ga0495593_0447363
645 Ga0495615_0236638
646 Ga0496100_0501086
647 Ga0496101_0695819
648 Ga0496102_0047339
649 Ga0496103_0037854
650 Ga0496106_0572939
651 Ga0496113_0158514
652 Ga0496116_0273899
653 Ga0496117_0161760
654 Ga0496117_0176688
655 Ga0496117_0184317
656 Ga0496118_0057118
657 Ga0496119_0080526
658 Ga0496119_0340147
659 Ga0496119_0344302
660 Ga0496120_0094108
661 Ga0496121_0023105
662 Ga0496122_0014551
663 Ga0496122_0101592
664 Ga0496123_0028557
665 Ga0496123_0066284
666 Ga0496124_0165712
667 Ga0496124_0365752
668 Ga0496124_0698326
669 Ga0496125_0049396
670 Ga0496126_0320449
671 Ga0496126_0560241
672 Ga0496126_0837538
673 Ga0496126_1153098
674 Ga0501034_0075687
675 Ga0501034_0268881
676 Ga0501036_0285044
677 Ga0501036_0301724
678 Ga0501037_0101348
679 Ga0501038_0171118
680 Ga0501043_0160668
681 Ga0501046_0176620
682 Ga0501047_0427120
683 Ga0501047_1240810
684 Ga0501067_0780887
685 Ga0501068_0115831
686 Ga0501073_0045136
687 Ga0501076_1651616
688 Ga0501083_0069835
689 Ga0501083_0079377
690 Ga0501035_0054833
691 Ga0495601_0496103
692 Ga0500635_0058863
693 Ga0500646_0237073
694 Ga0500641_0027301
695 Ga0500562_113586
696 Ga0500594_0060773
697 Ga0500595_000989
698 Ga0500618_046918
699 Ga0500559_0563546
700 Ga0500568_0339184
701 Ga0500573_0311261
702 Ga0500577_0119494
703 Ga0500604_0082073
704 Ga0501084_0941299
705 Ga0587066_153997
706 Ga0466962_0086955
707 2524462306
708 2585280592
709 2585327957
710 2585334290
711 2585531530
712 2585551556
713 2616306862
714 2616557717
715 2617384968
716 2671113606
717 2778173598
718 2819611117
719 2819638955
720 2838030804
721 2842300413
722 2842362288
723 2842477536
724 2842488103
725 2842504591
726 2842511843
727 2919410935
728 3005421762
729 8005319538
730 8005490168
731 8005646826
732 8005687592

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01206

TusA

Sulfurtransferase TusA

16

85

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lvk-assembly1.cif.gz_B-2 crystal structure of e.coli iscs-tusa complex (form 2) 0.9464 8 76
1dcj-assembly1.cif.gz_A solution structure of yhhp, a novel escherichia coli protein implicated in the cell division 0.8604 2 77
3lvk-assembly1.cif.gz_B-2 crystal structure of e.coli iscs-tusa complex (form 2) 0.8514 8 76
3hz7-assembly1.cif.gz_A crystal structure of the sira-like protein (dsy4693) from desulfitobacterium hafniense, northeast structural genomics consortium target dhr2a 0.8345 8 77
1dcj-assembly1.cif.gz_A solution structure of yhhp, a novel escherichia coli protein implicated in the cell division 0.8302 2 77
ID Description Score Start End Superfamily
af_Q2FWL8_3_73_3.30.110.40 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;TusA-like domain 0.9447 8 76 3.30.110.40
af_Q58397_3_75_3.30.110.40 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;TusA-like domain 0.9441 8 76 3.30.110.40
af_Q2G1R7_113_189_3.30.110.40 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;TusA-like domain 0.9092 1 77 3.30.110.40
af_Q2FWL8_3_73_3.30.110.40 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;TusA-like domain 0.9069 8 76 3.30.110.40
af_Q64237_60_176_2.60.40.1210 Mainly Beta;Sandwich;Immunoglobulin-like;Cellobiose dehydrogenase, cytochrome domain 0.9018 58 76 2.60.40.1210
ID Description Score Start End GO Terms
AF-A0A1H9WKZ4-F1-model_v4 tRNA 2-thiouridine synthesizing protein A 0.9977 8 77
AF-A0A549SZU5-F1-model_v4 Sulfurtransferase TusA family protein 0.9971 8 76 GO:0016740
AF-A0A5D0VGP9-F1-model_v4 Sulfurtransferase TusA family protein 0.9968 8 77 GO:0016740
AF-A0A545ZEL2-F1-model_v4 deleted 0.9965 8 77
AF-A0A854XK55-F1-model_v4 deleted 0.9964 8 77

Map