F424337

General Info

Members Datasets Scaffolds Average Seq Length
367 220 734 634

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10134260|Ga0105239_101342602
Length 682
Sequence MLPELGQFALILALLLACVQCALPIYGAWRGNAILISLARPAVAGQAVFVVLAFGLLSYAFVTQDFSVAYVAQNSNLALPWYYRFSAVWGAHEGSLLLWVLILNIWSVAVATFSRRLPDALIARVLGVLGFISFGFLLFTILTSNPFLRRLPALADGSDLNPILQDPGLIMHPPMLYTGYVGFSVAFAXXXXALLGGAESRADSRARQALGDNRAPDFIQWVRWARPWTNVAWAFLTLGISLGSWWAYYVLGWGXXXFWDPVENASFMPWLVGTALIHSQAVTEKRGSFRAWTLLLSIFAFSLSLLGTFLVRSGVLTSVHAFASDPKRGLFILAFLGVVVGGSLLIHAIRAPKVAGGKPFRMLSRETLLLVNNLLFTCAAAMVLLGTLYPLIGDALGVGRISVGPPYFGFMFVLLMAPVVLLLPFGPFFRWQSGDLKATLRRLAPAALPIPFALLGAGLLVGEHVPATAKTYWGIAASLWVGGGIVLYALMRWRSAPRGRRYTPEMLGMIFAHFGVALFLAGVLITEASSVESDLRLAPNESKNVGGIDFRFKGVERAQGPNFVADQGTIEVSRNGELLTTLYPQKRQYAGGGQVQTKSDIDPGVFRDLYVALGEPLQDGATSPGQGAWAVRIYVKPFVRWIWLGALFMMFGGFVAASDRRFRALPDRIGATNAPPLSEGTA

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
66 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
67 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
70 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
109 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
110 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
111 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
114 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
117 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
120 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
121 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
122 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
123 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
124 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
125 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
126 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
127 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
128 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
129 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
130 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
131 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
132 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
135 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
136 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
137 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
138 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
139 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
140 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
141 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
142 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
143 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
144 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
145 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
150 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
151 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
152 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
153 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
154 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
155 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
156 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
157 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
158 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
159 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
160 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
161 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
162 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
172 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
173 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
176 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
177 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
183 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
184 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
185 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
186 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
187 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
188 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
189 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
190 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
191 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
192 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
193 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
194 2734482264 Dyella sp. AD052 Isolate Unclassified
195 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
196 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
197 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
198 2818991457 Xanthomonas translucens 569 Isolate Unclassified
199 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
200 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
201 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
202 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
203 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
204 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
205 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
206 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
207 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
208 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
209 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
210 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
211 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
212 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
213 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
214 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
215 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
216 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
217 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
218 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
219 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere
220 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.55
Metatranscriptomes 0
Isolates 8.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.99
Nodule 0.27
Rhizoplane 2.45
Rhizosphere 72.48
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_10134260 3300010375 Bacteria 2754
2 JGI24740J21852_10001236 3300001979 Bacteria 11564
3 JGI24739J22299_10000042 3300001989 Bacteria 34840
4 JGI24739J22299_10000993 3300001989 Bacteria 10563
5 JGI25152J39213_1000035 3300002773 Bacteria 93806
6 JGI25150J39212_1000111 3300002774 Bacteria 47663
7 JGI25151J46595_10000057 3300003187 Bacteria 151052
8 JGI25153J46596_10000041 3300003215 Bacteria 162103
9 Ga0055536_1001874 3300003781 Bacteria 12248
10 Ga0055531_10017540 3300003794 Bacteria 3016
11 Ga0058692_1000006 3300003856 Bacteria 398109
12 Ga0058692_1000012 3300003856 Bacteria 318930
13 Ga0058692_1000029 3300003856 Bacteria 189475
14 Ga0065165_1003057 3300005262 Bacteria 12525
15 Ga0065714_10071120 3300005288 Bacteria 3662
16 Ga0065704_10082459 3300005289 Bacteria 3597
17 Ga0070658_10004472 3300005327 Bacteria 11385
18 Ga0070670_100000886 3300005331 Bacteria 23588
19 Ga0070670_100073389 3300005331 Bacteria 2939
20 Ga0070666_10000005 3300005335 Bacteria 343092
21 Ga0070666_10000139 3300005335 Bacteria 50346
22 Ga0070666_10014700 3300005335 Bacteria 4986
23 Ga0070666_10022430 3300005335 Bacteria 4098
24 Ga0070682_100029929 3300005337 Bacteria 3282
25 Ga0068868_100103233 3300005338 Bacteria 2309
26 Ga0070660_100027133 3300005339 Bacteria 4271
27 Ga0070661_100000185 3300005344 Bacteria 51364
28 Ga0070668_100061225 3300005347 Bacteria 2916
29 Ga0070667_100039096 3300005367 Bacteria 3976
30 Ga0070709_10004902 3300005434 Bacteria 7231
31 Ga0070663_100000500 3300005455 Bacteria 20724
32 Ga0070663_100076314 3300005455 Bacteria 2451
33 Ga0070685_10001279 3300005466 Bacteria 13293
34 Ga0068853_100000633 3300005539 Bacteria 24186
35 Ga0068853_100008035 3300005539 Bacteria 8462
36 Ga0068853_100011793 3300005539 Bacteria 7105
37 Ga0068853_100021361 3300005539 Bacteria 5396
38 Ga0070693_100012978 3300005547 Bacteria 4232
39 Ga0070665_100001911 3300005548 Bacteria 23550
40 Ga0068855_100003554 3300005563 Bacteria 19058
41 Ga0068855_100016828 3300005563 Bacteria 8794
42 Ga0068855_100030567 3300005563 Bacteria 6440
43 Ga0068855_100107326 3300005563 Bacteria 3208
44 Ga0068855_100116963 3300005563 Bacteria 3055
45 Ga0068857_100085047 3300005577 Bacteria 2827
46 Ga0068856_100013146 3300005614 Bacteria 8020
47 Ga0068856_100029897 3300005614 Bacteria 5324
48 Ga0068859_100008850 3300005617 Bacteria 10163
49 Ga0068863_100110194 3300005841 Bacteria 2621
50 Ga0068858_100007803 3300005842 Bacteria 10332
51 Ga0068862_100000354 3300005844 Bacteria 49717
52 Ga0081540_1002130 3300005983 Bacteria 16480
53 Ga0070712_100005016 3300006175 Bacteria 8196
54 Ga0075431_100034987 3300006847 Bacteria 5174
55 Ga0075429_100046913 3300006880 Bacteria 3759
56 Ga0068865_100050980 3300006881 Bacteria 2862
57 Ga0097620_100008850 3300006931 Bacteria 10163
58 Ga0105251_10000139 3300009011 Bacteria 74032
59 Ga0105251_10000261 3300009011 Bacteria 52880
60 Ga0105240_10003816 3300009093 Bacteria 23288
61 Ga0105240_10013498 3300009093 Bacteria 11219
62 Ga0105240_10022459 3300009093 Bacteria 8362
63 Ga0105240_10032191 3300009093 Bacteria 6791
64 Ga0105243_10005221 3300009148 Bacteria 10161
65 Ga0105241_10038144 3300009174 Bacteria 3622
66 Ga0105242_10014282 3300009176 Bacteria 6151
67 Ga0105248_10019325 3300009177 Bacteria 7537
68 Ga0105248_10041293 3300009177 Bacteria 5171
69 Ga0105237_10000023 3300009545 Bacteria 226144
70 Ga0105237_10012540 3300009545 Bacteria 8928
71 Ga0105237_10020972 3300009545 Bacteria 6726
72 Ga0105237_10058233 3300009545 Bacteria 3867
73 Ga0105237_10071689 3300009545 Bacteria 3459
74 Ga0105238_10000060 3300009551 Bacteria 129934
75 Ga0105238_10009819 3300009551 Bacteria 9584
76 Ga0105238_10010019 3300009551 Bacteria 9505
77 Ga0105238_10022955 3300009551 Bacteria 6359
78 Ga0105238_10026794 3300009551 Bacteria 5876
79 Ga0105249_10000498 3300009553 Bacteria 36320
80 Ga0105249_10051282 3300009553 Bacteria 3763
81 Ga0105239_10006662 3300010375 Bacteria 13354
82 Ga0105239_10034703 3300010375 Bacteria 5541
83 Ga0105239_10042865 3300010375 Bacteria 4959
84 Ga0105239_10085694 3300010375 Bacteria 3472
85 Ga0157314_1000333 3300012500 Bacteria 4914
86 Ga0157371_10007822 3300013102 Bacteria 8583
87 Ga0157371_10007889 3300013102 Bacteria 8545
88 Ga0157370_10007478 3300013104 Bacteria 11865
89 Ga0157370_10081598 3300013104 Bacteria 3042
90 Ga0157369_10000097 3300013105 Bacteria 121042
91 Ga0157369_10015187 3300013105 Bacteria 8692
92 Ga0157369_10088911 3300013105 Bacteria 3298
93 Ga0157369_10092952 3300013105 Bacteria 3220
94 Ga0157374_10011509 3300013296 Bacteria 7667
95 Ga0157378_10000006 3300013297 Bacteria 192683
96 Ga0157378_10075429 3300013297 Bacteria 3036
97 Ga0163162_10000016 3300013306 Bacteria 250836
98 Ga0163162_10020407 3300013306 Bacteria 6511
99 Ga0163162_10039613 3300013306 Bacteria 4710
100 Ga0157372_10000470 3300013307 Bacteria 44468
101 Ga0157375_10009950 3300013308 Bacteria 8363
102 Ga0157375_10055068 3300013308 Bacteria 3920
103 Ga0163163_10000970 3300014325 Bacteria 24383
104 Ga0157379_10018850 3300014968 Bacteria 6088
105 Ga0157376_10008311 3300014969 Bacteria 7482
106 Ga0157376_10012574 3300014969 Bacteria 6286
107 Ga0182005_1000004 3300015265 Bacteria 609645
108 Ga0182005_1000825 3300015265 Bacteria 13935
109 Ga0182005_1001305 3300015265 Bacteria 10217
110 Ga0182005_1001765 3300015265 Bacteria 8315
111 Ga0163161_10001879 3300017792 Bacteria 15327
112 Ga0207425_1000044 3300025245 Bacteria 195202
113 Ga0209129_1000044 3300025258 Bacteria 298971
114 Ga0209676_1000279 3300025292 Bacteria 106358
115 Ga0209025_1000012 3300025294 Bacteria 924362
116 Ga0209758_1000018 3300025297 Bacteria 753320
117 Ga0209758_1002406 3300025297 Bacteria 19172
118 Ga0209050_1013886 3300025298 Bacteria 3529
119 Ga0209257_1000122 3300025304 Bacteria 219678
120 Ga0209257_1000647 3300025304 Bacteria 55358
121 Ga0207656_10001499 3300025321 Bacteria 7733
122 Ga0207656_10007874 3300025321 Bacteria 3902
123 Ga0207713_1000630 3300025735 Bacteria 34309
124 Ga0207713_1001939 3300025735 Bacteria 15650
125 Ga0207692_10009940 3300025898 Bacteria 3989
126 Ga0207680_10000005 3300025903 Bacteria 660983
127 Ga0207680_10000215 3300025903 Bacteria 27897
128 Ga0207647_10000350 3300025904 Bacteria 37343
129 Ga0207647_10004964 3300025904 Bacteria 9808
130 Ga0207647_10013852 3300025904 Bacteria 5583
131 Ga0207643_10031743 3300025908 Bacteria 2946
132 Ga0207705_10005669 3300025909 Bacteria 9320
133 Ga0207707_10001182 3300025912 Bacteria 24582
134 Ga0207707_10005580 3300025912 Bacteria 11008
135 Ga0207695_10000007 3300025913 Bacteria 1092551
136 Ga0207695_10000182 3300025913 Bacteria 184125
137 Ga0207695_10001068 3300025913 Bacteria 47945
138 Ga0207695_10002599 3300025913 Bacteria 26471
139 Ga0207695_10010715 3300025913 Bacteria 11193
140 Ga0207695_10020373 3300025913 Bacteria 7598
141 Ga0207695_10022096 3300025913 Bacteria 7236
142 Ga0207671_10000020 3300025914 Bacteria 309636
143 Ga0207671_10000033 3300025914 Bacteria 245869
144 Ga0207671_10001379 3300025914 Bacteria 28266
145 Ga0207671_10004485 3300025914 Bacteria 13308
146 Ga0207671_10005611 3300025914 Bacteria 11513
147 Ga0207693_10000455 3300025915 Bacteria 37329
148 Ga0207657_10003945 3300025919 Bacteria 15757
149 Ga0207652_10030643 3300025921 Bacteria 4506
150 Ga0207694_10004524 3300025924 Bacteria 10847
151 Ga0207694_10006273 3300025924 Bacteria 9083
152 Ga0207694_10013830 3300025924 Bacteria 6083
153 Ga0207694_10023282 3300025924 Bacteria 4702
154 Ga0207694_10027999 3300025924 Bacteria 4296
155 Ga0207650_10005514 3300025925 Bacteria 8634
156 Ga0207650_10050716 3300025925 Bacteria 3070
157 Ga0207664_10002859 3300025929 Bacteria 11469
158 Ga0207709_10000898 3300025935 Bacteria 22480
159 Ga0207709_10008931 3300025935 Bacteria 5533
160 Ga0207691_10004047 3300025940 Bacteria 14216
161 Ga0207711_10001336 3300025941 Bacteria 23339
162 Ga0207711_10082855 3300025941 Bacteria 2804
163 Ga0207689_10036820 3300025942 Bacteria 4061
164 Ga0207667_10000130 3300025949 Bacteria 115321
165 Ga0207667_10001289 3300025949 Bacteria 31377
166 Ga0207667_10003176 3300025949 Bacteria 20327
167 Ga0207667_10005924 3300025949 Bacteria 14884
168 Ga0207712_10000339 3300025961 Bacteria 42473
169 Ga0207712_10000634 3300025961 Bacteria 27702
170 Ga0207712_10039697 3300025961 Bacteria 3226
171 Ga0207668_10026303 3300025972 Bacteria 3776
172 Ga0207640_10003468 3300025981 Bacteria 8492
173 Ga0207658_10000098 3300025986 Bacteria 96611
174 Ga0207658_10011828 3300025986 Bacteria 5945
175 Ga0207677_10084251 3300026023 Bacteria 2291
176 Ga0207639_10000454 3300026041 Bacteria 28220
177 Ga0207639_10000507 3300026041 Bacteria 26971
178 Ga0207639_10001111 3300026041 Bacteria 18285
179 Ga0207639_10003408 3300026041 Bacteria 10693
180 Ga0207639_10017380 3300026041 Bacteria 5098
181 Ga0207678_10000281 3300026067 Bacteria 46171
182 Ga0207702_10011012 3300026078 Bacteria 7545
183 Ga0207641_10069454 3300026088 Bacteria 3024
184 Ga0207674_10000218 3300026116 Bacteria 71563
185 Ga0207674_10014348 3300026116 Bacteria 8753
186 Ga0207683_10020782 3300026121 Bacteria 5617
187 Ga0207698_10055801 3300026142 Bacteria 3047
188 Ga0209371_1000007 3300027312 Bacteria 1050654
189 Ga0209371_1000016 3300027312 Bacteria 646301
190 Ga0209371_1000072 3300027312 Bacteria 199942
191 Ga0268266_10000004 3300028379 Bacteria 1495817
192 Ga0268266_10000006 3300028379 Bacteria 1410021
193 Ga0268265_10000775 3300028380 Bacteria 30819
194 Ga0268256_1000008 3300030500 Bacteria 1050654
195 Ga0268256_1000015 3300030500 Bacteria 646300
196 Ga0268256_1000065 3300030500 Bacteria 199943
197 Ga0265328_10006393 3300031239 Bacteria 4996
198 Ga0265328_10007489 3300031239 Bacteria 4547
199 Ga0265331_10000055 3300031250 Bacteria 177693
200 Ga0265327_10000045 3300031251 Bacteria 282880
201 Ga0265327_10000512 3300031251 Bacteria 67274
202 Ga0265327_10000556 3300031251 Bacteria 63939
203 Ga0265327_10003260 3300031251 Bacteria 15736
204 Ga0265316_10002801 3300031344 Bacteria 17850
205 Ga0307513_10175759 3300031456 Bacteria 2012
206 Ga0307508_10018162 3300031616 Bacteria 6391
207 Ga0307412_10000684 3300031911 Bacteria 19615
208 Ga0307414_10056869 3300032004 Bacteria 2746
209 Ga0307510_10020810 3300033180 Bacteria 7659
210 Ga0395905_0000914 3300037471 Bacteria 38163
211 Ga0395905_0003363 3300037471 Bacteria 17143
212 Ga0237819_00687 3300038705 Bacteria 10977
213 Ga0436361_0898793 3300039447 Bacteria 17943
214 Ga0436363_1526758 3300039450 Bacteria 6995
215 Ga0439465_0000369 3300041413 Bacteria 12906
216 Ga0439465_0005256 3300041413 Bacteria 4144
217 Ga0451793_0387481 3300041452 Bacteria 2321
218 Ga0451800_0044748 3300041459 Bacteria 4236
219 Ga0451806_169204 3300041462 Bacteria 2768
220 Ga0451807_2430884 3300041486 Bacteria 2566
221 Ga0439449_0000207 3300042007 Bacteria 20712
222 Ga0439449_0001465 3300042007 Bacteria 9251
223 Ga0466972_0004551 3300044658 Bacteria 6946
224 Ga0466972_0005062 3300044658 Bacteria 6606
225 Ga0466982_0000020 3300044672 Bacteria 99164
226 Ga0453684_0000437 3300044712 Bacteria 169900
227 Ga0466970_0017167 3300044765 Bacteria 3737
228 Ga0466959_0001336 3300045049 Bacteria 15010
229 Ga0451576_0000081 3300045051 Bacteria 239875
230 Ga0495650_0000590 3300046471 Bacteria 50202
231 Ga0495584_0000050 3300046491 Bacteria 87308
232 Ga0495606_0000356 3300046507 Bacteria 78185
233 Ga0495632_0000003 3300046519 Bacteria 396071
234 Ga0495643_0002439 3300046522 Bacteria 14756
235 Ga0495622_0000036 3300046557 Bacteria 122551
236 Ga0495633_0010993 3300046558 Bacteria 4913
237 Ga0495625_0050008 3300046660 Bacteria 3001
238 Ga0495671_0008987 3300046692 Bacteria 5607
239 Ga0495672_0000456 3300047320 Bacteria 48378
240 Ga0495687_001429 3300047443 Bacteria 21978
241 Ga0495686_0001504 3300047472 Bacteria 25161
242 Ga0495686_0025790 3300047472 Bacteria 3849
243 Ga0496104_0000011 3300048907 Bacteria 459358
244 Ga0496105_0000014 3300048908 Bacteria 220911
245 Ga0496106_0002969 3300048909 Bacteria 12622
246 Ga0496114_0009483 3300048917 Bacteria 7727
247 Ga0496115_0000293 3300048918 Bacteria 43225
248 Ga0496116_0002429 3300048919 Bacteria 19630
249 Ga0496117_0000330 3300048920 Bacteria 83673
250 Ga0496117_0004847 3300048920 Bacteria 14541
251 Ga0496118_0000166 3300048921 Bacteria 119204
252 Ga0496118_0001608 3300048921 Bacteria 33395
253 Ga0496118_0009467 3300048921 Bacteria 9835
254 Ga0496118_0019756 3300048921 Bacteria 6008
255 Ga0496118_0027049 3300048921 Bacteria 4864
256 Ga0496118_0029716 3300048921 Bacteria 4577
257 Ga0496118_0090352 3300048921 Bacteria 2110
258 Ga0496119_0000240 3300048922 Bacteria 77404
259 Ga0496119_0002357 3300048922 Bacteria 20805
260 Ga0496119_0002863 3300048922 Bacteria 18408
261 Ga0496120_0000011 3300048923 Bacteria 365549
262 Ga0496120_0000685 3300048923 Bacteria 49749
263 Ga0496120_0029685 3300048923 Bacteria 3334
264 Ga0496121_0004682 3300048924 Bacteria 18146
265 Ga0496121_0010608 3300048924 Bacteria 10353
266 Ga0496121_0091792 3300048924 Bacteria 2369
267 Ga0496122_0000189 3300048925 Bacteria 142792
268 Ga0496122_0000734 3300048925 Bacteria 64135
269 Ga0496122_0000965 3300048925 Bacteria 51557
270 Ga0496122_0002844 3300048925 Bacteria 23694
271 Ga0496122_0012524 3300048925 Bacteria 8431
272 Ga0496122_0012864 3300048925 Bacteria 8272
273 Ga0496122_0019208 3300048925 Bacteria 6255
274 Ga0496123_0000068 3300048926 Bacteria 208797
275 Ga0496123_0000436 3300048926 Bacteria 74963
276 Ga0496123_0000456 3300048926 Bacteria 71960
277 Ga0496123_0002732 3300048926 Bacteria 21150
278 Ga0496123_0003009 3300048926 Bacteria 19474
279 Ga0496123_0008751 3300048926 Bacteria 9241
280 Ga0496124_0000089 3300048927 Bacteria 192423
281 Ga0496124_0000411 3300048927 Bacteria 76929
282 Ga0496124_0000433 3300048927 Bacteria 74353
283 Ga0496124_0000443 3300048927 Bacteria 73242
284 Ga0496124_0000808 3300048927 Bacteria 50879
285 Ga0496124_0008226 3300048927 Bacteria 10940
286 Ga0496125_0004011 3300048928 Bacteria 17305
287 Ga0496125_0006971 3300048928 Bacteria 12103
288 Ga0496125_0009073 3300048928 Bacteria 10289
289 Ga0496125_0009826 3300048928 Bacteria 9750
290 Ga0496125_0018883 3300048928 Bacteria 6525
291 Ga0496126_0000057 3300048929 Bacteria 276781
292 Ga0496126_0019472 3300048929 Bacteria 6683
293 Ga0501032_0000994 3300049569 Bacteria 22837
294 Ga0501032_0039480 3300049569 Bacteria 3210
295 Ga0501033_0006764 3300049570 Bacteria 8956
296 Ga0501034_0000769 3300049571 Bacteria 48050
297 Ga0501034_0001262 3300049571 Bacteria 34347
298 Ga0501034_0002423 3300049571 Bacteria 22561
299 Ga0501037_0001763 3300049573 Bacteria 15712
300 Ga0501037_0010539 3300049573 Bacteria 6789
301 Ga0501038_0009035 3300049574 Bacteria 9146
302 Ga0501038_0033729 3300049574 Bacteria 4507
303 Ga0501039_0003438 3300049575 Bacteria 11824
304 Ga0501046_0008647 3300049580 Bacteria 8851
305 Ga0501046_0069336 3300049580 Bacteria 2743
306 Ga0501047_0000446 3300049581 Bacteria 45717
307 Ga0501047_0042055 3300049581 Bacteria 4416
308 Ga0501048_0003086 3300049582 Bacteria 12699
309 Ga0501067_0004497 3300049583 Bacteria 7693
310 Ga0501069_0002920 3300049585 Bacteria 8772
311 Ga0501070_0010811 3300049586 Bacteria 7710
312 Ga0501072_0001232 3300049588 Bacteria 19103
313 Ga0501073_0003183 3300049589 Bacteria 12318
314 Ga0501073_0003698 3300049589 Bacteria 11488
315 Ga0501073_0007264 3300049589 Bacteria 8247
316 Ga0501074_0004474 3300049590 Bacteria 10003
317 Ga0501225_0011626 3300049705 Bacteria 2476
318 Ga0501080_0006000 3300049742 Bacteria 10889
319 Ga0501080_0015657 3300049742 Bacteria 6992
320 Ga0501080_0026541 3300049742 Bacteria 5381
321 Ga0501080_0040510 3300049742 Bacteria 4344
322 Ga0501083_0000225 3300049744 Bacteria 36374
323 Ga0501035_0003994 3300049822 Bacteria 14069
324 Ga0501044_0001236 3300049823 Bacteria 30366
325 Ga0501044_0001646 3300049823 Bacteria 26227
326 Ga0501044_0012392 3300049823 Bacteria 9230
327 Ga0501044_0051122 3300049823 Bacteria 4262
328 nmdc:mga09592_67517_c1 3300050508 Bacteria 3033
329 nmdc:mga0qj67_10340_c1 3300050509 Bacteria 6971
330 nmdc:mga06r32_28633_c1 3300050510 Bacteria 5216
331 Ga0500610_0000098 3300053079 Bacteria 25847
332 Ga0500651_0001237 3300053093 Bacteria 12706
333 Ga0500651_0003341 3300053093 Bacteria 8760
334 Ga0500597_000155 3300053120 Bacteria 13729
335 Ga0500568_0000145 3300053139 Bacteria 62300
336 Ga0500634_0000195 3300053161 Bacteria 19694
337 2547499613 2547132130 Bacteria 4660562
338 2687578048 2687453129 Bacteria 4387428
339 2691331763 2690315857 Bacteria 4396207
340 2721027704 2718218334 Bacteria 4765486
341 2735836736 2734482264 Unclassified 5014763
342 2747949154 2747842428 Bacteria 4689383
343 2765579732 2765235840 Bacteria 4663337
344 2816517812 2816332141 Bacteria 4436036
345 2819659907 2818991457 Bacteria 5323295
346 2842391995 2842391507 Bacteria 4486072
347 2842760064 2842757796 Bacteria 3981385
348 2852685265 2852684882 Bacteria 5463342
349 2874222427 2874220319 Bacteria 4594709
350 2904616212 2904615490 Bacteria 10047340
351 2919090365 2919089067 Bacteria 4560942
352 2919131386 2919130084 Bacteria 5301837
353 2919138484 2919134579 Bacteria 4480386
354 2919537026 2919534386 Bacteria 4577686
355 2928497752 2928496128 Bacteria 4631123
356 2929198192 2929195423 Bacteria 5325372
357 2931384117 2931380184 Bacteria 4455911
358 2937614720 2937610967 Bacteria 4618818
359 2939630594 2939626828 Bacteria 4695272
360 2961049192 2961047084 Bacteria 4594415
361 2961066110 2961064222 Bacteria 4749990
362 2987606246 2987605356 Bacteria 4187822
363 8021624798 8021622325 Bacteria 4844743
364 8021630172 8021626552 Bacteria 4665214
365 8021650142 8021648035 Bacteria 4772378
366 8054359975 8054357960 Bacteria 2867777
367 8057160917 8057160832 Bacteria 3268302
368 Ga0105239_10134260
369 JGI24740J21852_10001236
370 JGI24739J22299_10000042
371 JGI24739J22299_10000993
372 JGI25152J39213_1000035
373 JGI25150J39212_1000111
374 JGI25151J46595_10000057
375 JGI25153J46596_10000041
376 Ga0055536_1001874
377 Ga0055531_10017540
378 Ga0058692_1000006
379 Ga0058692_1000012
380 Ga0058692_1000029
381 Ga0065165_1003057
382 Ga0065714_10071120
383 Ga0065704_10082459
384 Ga0070658_10004472
385 Ga0070670_100000886
386 Ga0070670_100073389
387 Ga0070666_10000005
388 Ga0070666_10000139
389 Ga0070666_10014700
390 Ga0070666_10022430
391 Ga0070682_100029929
392 Ga0068868_100103233
393 Ga0070660_100027133
394 Ga0070661_100000185
395 Ga0070668_100061225
396 Ga0070667_100039096
397 Ga0070709_10004902
398 Ga0070663_100000500
399 Ga0070663_100076314
400 Ga0070685_10001279
401 Ga0068853_100000633
402 Ga0068853_100008035
403 Ga0068853_100011793
404 Ga0068853_100021361
405 Ga0070693_100012978
406 Ga0070665_100001911
407 Ga0068855_100003554
408 Ga0068855_100016828
409 Ga0068855_100030567
410 Ga0068855_100107326
411 Ga0068855_100116963
412 Ga0068857_100085047
413 Ga0068856_100013146
414 Ga0068856_100029897
415 Ga0068859_100008850
416 Ga0068863_100110194
417 Ga0068858_100007803
418 Ga0068862_100000354
419 Ga0081540_1002130
420 Ga0070712_100005016
421 Ga0075431_100034987
422 Ga0075429_100046913
423 Ga0068865_100050980
424 Ga0097620_100008850
425 Ga0105251_10000139
426 Ga0105251_10000261
427 Ga0105240_10003816
428 Ga0105240_10013498
429 Ga0105240_10022459
430 Ga0105240_10032191
431 Ga0105243_10005221
432 Ga0105241_10038144
433 Ga0105242_10014282
434 Ga0105248_10019325
435 Ga0105248_10041293
436 Ga0105237_10000023
437 Ga0105237_10012540
438 Ga0105237_10020972
439 Ga0105237_10058233
440 Ga0105237_10071689
441 Ga0105238_10000060
442 Ga0105238_10009819
443 Ga0105238_10010019
444 Ga0105238_10022955
445 Ga0105238_10026794
446 Ga0105249_10000498
447 Ga0105249_10051282
448 Ga0105239_10006662
449 Ga0105239_10034703
450 Ga0105239_10042865
451 Ga0105239_10085694
452 Ga0157314_1000333
453 Ga0157371_10007822
454 Ga0157371_10007889
455 Ga0157370_10007478
456 Ga0157370_10081598
457 Ga0157369_10000097
458 Ga0157369_10015187
459 Ga0157369_10088911
460 Ga0157369_10092952
461 Ga0157374_10011509
462 Ga0157378_10000006
463 Ga0157378_10075429
464 Ga0163162_10000016
465 Ga0163162_10020407
466 Ga0163162_10039613
467 Ga0157372_10000470
468 Ga0157375_10009950
469 Ga0157375_10055068
470 Ga0163163_10000970
471 Ga0157379_10018850
472 Ga0157376_10008311
473 Ga0157376_10012574
474 Ga0182005_1000004
475 Ga0182005_1000825
476 Ga0182005_1001305
477 Ga0182005_1001765
478 Ga0163161_10001879
479 Ga0207425_1000044
480 Ga0209129_1000044
481 Ga0209676_1000279
482 Ga0209025_1000012
483 Ga0209758_1000018
484 Ga0209758_1002406
485 Ga0209050_1013886
486 Ga0209257_1000122
487 Ga0209257_1000647
488 Ga0207656_10001499
489 Ga0207656_10007874
490 Ga0207713_1000630
491 Ga0207713_1001939
492 Ga0207692_10009940
493 Ga0207680_10000005
494 Ga0207680_10000215
495 Ga0207647_10000350
496 Ga0207647_10004964
497 Ga0207647_10013852
498 Ga0207643_10031743
499 Ga0207705_10005669
500 Ga0207707_10001182
501 Ga0207707_10005580
502 Ga0207695_10000007
503 Ga0207695_10000182
504 Ga0207695_10001068
505 Ga0207695_10002599
506 Ga0207695_10010715
507 Ga0207695_10020373
508 Ga0207695_10022096
509 Ga0207671_10000020
510 Ga0207671_10000033
511 Ga0207671_10001379
512 Ga0207671_10004485
513 Ga0207671_10005611
514 Ga0207693_10000455
515 Ga0207657_10003945
516 Ga0207652_10030643
517 Ga0207694_10004524
518 Ga0207694_10006273
519 Ga0207694_10013830
520 Ga0207694_10023282
521 Ga0207694_10027999
522 Ga0207650_10005514
523 Ga0207650_10050716
524 Ga0207664_10002859
525 Ga0207709_10000898
526 Ga0207709_10008931
527 Ga0207691_10004047
528 Ga0207711_10001336
529 Ga0207711_10082855
530 Ga0207689_10036820
531 Ga0207667_10000130
532 Ga0207667_10001289
533 Ga0207667_10003176
534 Ga0207667_10005924
535 Ga0207712_10000339
536 Ga0207712_10000634
537 Ga0207712_10039697
538 Ga0207668_10026303
539 Ga0207640_10003468
540 Ga0207658_10000098
541 Ga0207658_10011828
542 Ga0207677_10084251
543 Ga0207639_10000454
544 Ga0207639_10000507
545 Ga0207639_10001111
546 Ga0207639_10003408
547 Ga0207639_10017380
548 Ga0207678_10000281
549 Ga0207702_10011012
550 Ga0207641_10069454
551 Ga0207674_10000218
552 Ga0207674_10014348
553 Ga0207683_10020782
554 Ga0207698_10055801
555 Ga0209371_1000007
556 Ga0209371_1000016
557 Ga0209371_1000072
558 Ga0268266_10000004
559 Ga0268266_10000006
560 Ga0268265_10000775
561 Ga0268256_1000008
562 Ga0268256_1000015
563 Ga0268256_1000065
564 Ga0265328_10006393
565 Ga0265328_10007489
566 Ga0265331_10000055
567 Ga0265327_10000045
568 Ga0265327_10000512
569 Ga0265327_10000556
570 Ga0265327_10003260
571 Ga0265316_10002801
572 Ga0307513_10175759
573 Ga0307508_10018162
574 Ga0307412_10000684
575 Ga0307414_10056869
576 Ga0307510_10020810
577 Ga0395905_0000914
578 Ga0395905_0003363
579 Ga0237819_00687
580 Ga0436361_0898793
581 Ga0436363_1526758
582 Ga0439465_0000369
583 Ga0439465_0005256
584 Ga0451793_0387481
585 Ga0451800_0044748
586 Ga0451806_169204
587 Ga0451807_2430884
588 Ga0439449_0000207
589 Ga0439449_0001465
590 Ga0466972_0004551
591 Ga0466972_0005062
592 Ga0466982_0000020
593 Ga0453684_0000437
594 Ga0466970_0017167
595 Ga0466959_0001336
596 Ga0451576_0000081
597 Ga0495650_0000590
598 Ga0495584_0000050
599 Ga0495606_0000356
600 Ga0495632_0000003
601 Ga0495643_0002439
602 Ga0495622_0000036
603 Ga0495633_0010993
604 Ga0495625_0050008
605 Ga0495671_0008987
606 Ga0495672_0000456
607 Ga0495687_001429
608 Ga0495686_0001504
609 Ga0495686_0025790
610 Ga0496104_0000011
611 Ga0496105_0000014
612 Ga0496106_0002969
613 Ga0496114_0009483
614 Ga0496115_0000293
615 Ga0496116_0002429
616 Ga0496117_0000330
617 Ga0496117_0004847
618 Ga0496118_0000166
619 Ga0496118_0001608
620 Ga0496118_0009467
621 Ga0496118_0019756
622 Ga0496118_0027049
623 Ga0496118_0029716
624 Ga0496118_0090352
625 Ga0496119_0000240
626 Ga0496119_0002357
627 Ga0496119_0002863
628 Ga0496120_0000011
629 Ga0496120_0000685
630 Ga0496120_0029685
631 Ga0496121_0004682
632 Ga0496121_0010608
633 Ga0496121_0091792
634 Ga0496122_0000189
635 Ga0496122_0000734
636 Ga0496122_0000965
637 Ga0496122_0002844
638 Ga0496122_0012524
639 Ga0496122_0012864
640 Ga0496122_0019208
641 Ga0496123_0000068
642 Ga0496123_0000436
643 Ga0496123_0000456
644 Ga0496123_0002732
645 Ga0496123_0003009
646 Ga0496123_0008751
647 Ga0496124_0000089
648 Ga0496124_0000411
649 Ga0496124_0000433
650 Ga0496124_0000443
651 Ga0496124_0000808
652 Ga0496124_0008226
653 Ga0496125_0004011
654 Ga0496125_0006971
655 Ga0496125_0009073
656 Ga0496125_0009826
657 Ga0496125_0018883
658 Ga0496126_0000057
659 Ga0496126_0019472
660 Ga0501032_0000994
661 Ga0501032_0039480
662 Ga0501033_0006764
663 Ga0501034_0000769
664 Ga0501034_0001262
665 Ga0501034_0002423
666 Ga0501037_0001763
667 Ga0501037_0010539
668 Ga0501038_0009035
669 Ga0501038_0033729
670 Ga0501039_0003438
671 Ga0501046_0008647
672 Ga0501046_0069336
673 Ga0501047_0000446
674 Ga0501047_0042055
675 Ga0501048_0003086
676 Ga0501067_0004497
677 Ga0501069_0002920
678 Ga0501070_0010811
679 Ga0501072_0001232
680 Ga0501073_0003183
681 Ga0501073_0003698
682 Ga0501073_0007264
683 Ga0501074_0004474
684 Ga0501225_0011626
685 Ga0501080_0006000
686 Ga0501080_0015657
687 Ga0501080_0026541
688 Ga0501080_0040510
689 Ga0501083_0000225
690 Ga0501035_0003994
691 Ga0501044_0001236
692 Ga0501044_0001646
693 Ga0501044_0012392
694 Ga0501044_0051122
695 nmdc:mga09592_67517_c1
696 nmdc:mga0qj67_10340_c1
697 nmdc:mga06r32_28633_c1
698 Ga0500610_0000098
699 Ga0500651_0001237
700 Ga0500651_0003341
701 Ga0500597_000155
702 Ga0500568_0000145
703 Ga0500634_0000195
704 2547499613
705 2687578048
706 2691331763
707 2721027704
708 2735836736
709 2747949154
710 2765579732
711 2816517812
712 2819659907
713 2842391995
714 2842760064
715 2852685265
716 2874222427
717 2904616212
718 2919090365
719 2919131386
720 2919138484
721 2919537026
722 2928497752
723 2929198192
724 2931384117
725 2937614720
726 2939630594
727 2961049192
728 2961066110
729 2987606246
730 8021624798
731 8021630172
732 8021650142
733 8054359975
734 8057160917

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01578

Cytochrom_C_asm

Cytochrome C assembly protein

89

316

0.96

PF16327

CcmF_C

Cytochrome c-type biogenesis protein CcmF C-terminal

333

660

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zmq-assembly1.cif.gz_A cytochrome c heme lyase ccmf 0.8698 1 603
6zmq-assembly1.cif.gz_A cytochrome c heme lyase ccmf 0.8346 1 603
7brs-assembly4.cif.gz_D e.coli beta-galactosidase (e537q) in complex with fluorescent probe ksa02 0.5817 509 573
7brs-assembly2.cif.gz_B e.coli beta-galactosidase (e537q) in complex with fluorescent probe ksa02 0.5795 509 573
3vd7-assembly1.cif.gz_B e. coli (lacz) beta-galactosidase (n460s) in complex with galactotetrazole 0.4819 507 594
ID Description Score Start End Superfamily
af_O01913_702_992_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.5583 498 546 3.90.190.10
af_Q95XJ2_996_1266_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.5579 500 550 3.90.190.10
af_Q9U1Q9_1006_1244_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.5547 500 550 3.90.190.10
af_K7TUB1_192_388_3.30.760.10 Alpha Beta;2-Layer Sandwich;RNA Cap, Translation Initiation Factor Eif4e;RNA Cap, Translation Initiation Factor Eif4e 0.52 160 317 3.30.760.10
af_I1JJR6_181_383_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5048 160 312 1.20.120.1770
ID Description Score Start End GO Terms
AF-A0A7X5N413-F1-model_v4 C-type cytochrome biogenesis protein CcmF 0.9798 506 595
AF-A0A7X5N413-F1-model_v4 C-type cytochrome biogenesis protein CcmF 0.9692 506 595
AF-A0A455U1B5-F1-model_v4 Cytochrome c assembly protein domain-containing protein 0.962 2 129 GO:0015232
GO:0016020
GO:0017004
AF-A0A753L125-F1-model_v4 Cytochrome c-type biogenesis protein CcmF C-terminal domain-containing protein 0.9564 434 603 GO:0016020
GO:0017004
AF-A0A636LNF1-F1-model_v4 Cytochrome c-type biogenesis protein CcmF C-terminal domain-containing protein 0.9548 431 603 GO:0016020
GO:0017004

Map