F424353
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 367 | 192 | 734 | 165 |
Family's Representative Sequence
| Representative Sequence | 3300014969|Ga0157376_10030620|Ga0157376_100306201 |
| Length | 194 |
| Sequence | MPVALPSSTDEASVMRVAEIGFEAPAKLLARYGLALERVAPGAAIPGSFWGDEEAGIIGTTVYARDDTPVHSLLHEAGHLIVLPPERRSQVHTDATDSIAEEDATCYLQIVLADELPGVGRARLMADMDAWGYTFRLGSAQAWFGEDAANARQWLVEHGLLDPQGRPVSANRRRFGASKTLLLSHVDTTPAGAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 8 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 9 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 11 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 12 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 13 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 21 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 52 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 58 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 59 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 66 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 67 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 68 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 69 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 70 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 71 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 72 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 73 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 74 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 84 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 85 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 87 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 88 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 114 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 115 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 116 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 117 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 118 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 119 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 120 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 121 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 122 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 123 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 124 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 125 | 3300044536 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E | Metagenome | Unclassified |
| 126 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 127 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 128 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 129 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 130 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 131 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 132 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 133 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 134 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 135 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 136 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 137 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 138 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 139 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 140 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 141 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 142 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 153 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 154 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 155 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 156 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 157 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 158 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 159 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 160 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 161 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 162 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 163 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 164 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 180 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 181 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 182 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 183 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 184 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 185 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 186 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 187 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 188 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 189 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 190 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 191 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 192 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.46 |
| Metatranscriptomes | 0.82 |
| Isolates | 2.72 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 20.16 |
| Nodule | 0 |
| Rhizoplane | 2.72 |
| Rhizosphere | 64.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157376_10030620 | 3300014969 | Bacteria | 4299 |
| 2 | JGI24740J21852_10022400 | 3300001979 | Bacteria | 2175 |
| 3 | JGI24739J22299_10000089 | 3300001989 | Bacteria | 26418 |
| 4 | JGI24735J21928_10002530 | 3300002067 | Bacteria | 6323 |
| 5 | JGI25156J39149_1001534 | 3300002705 | Bacteria | 9572 |
| 6 | JGI25156J39149_1001864 | 3300002705 | Bacteria | 8246 |
| 7 | JGI25156J39149_1002490 | 3300002705 | Bacteria | 6564 |
| 8 | JGI25162J39368_1000057 | 3300002737 | Bacteria | 145686 |
| 9 | JGI25162J39368_1000338 | 3300002737 | Bacteria | 40747 |
| 10 | JGI25154J39366_1006259 | 3300002738 | Bacteria | 1768 |
| 11 | JGI25157J39369_1000182 | 3300002741 | Bacteria | 53311 |
| 12 | JGI25157J39369_1001918 | 3300002741 | Bacteria | 6287 |
| 13 | JGI25157J39369_1007373 | 3300002741 | Bacteria | 1591 |
| 14 | JGI25164J39214_1000032 | 3300002772 | Bacteria | 144465 |
| 15 | JGI25164J39214_1000043 | 3300002772 | Bacteria | 126257 |
| 16 | JGI25164J39214_1001119 | 3300002772 | Bacteria | 7640 |
| 17 | JGI25164J39214_1013601 | 3300002772 | Bacteria | 761 |
| 18 | JGI25165J46597_1000113 | 3300003214 | Bacteria | 145686 |
| 19 | JGI25165J46597_1000136 | 3300003214 | Bacteria | 122521 |
| 20 | JGI25165J46597_1002037 | 3300003214 | Bacteria | 7651 |
| 21 | rootH1_10132142 | 3300003316 | Bacteria | 1178 |
| 22 | rootH1_10166365 | 3300003316 | Bacteria | 1159 |
| 23 | Ga0006562J51391_1011821 | 3300003578 | Bacteria | 850 |
| 24 | Ga0055538_1001003 | 3300003751 | Bacteria | 6516 |
| 25 | Ga0055533_1000782 | 3300003756 | Bacteria | 9978 |
| 26 | Ga0055525_1000164 | 3300003759 | Bacteria | 85555 |
| 27 | Ga0055527_1000065 | 3300003760 | Bacteria | 88416 |
| 28 | Ga0055527_1000317 | 3300003760 | Bacteria | 25995 |
| 29 | Ga0055527_1002917 | 3300003760 | Bacteria | 2703 |
| 30 | Ga0055527_1003327 | 3300003760 | Bacteria | 2421 |
| 31 | Ga0055535_1000043 | 3300003761 | Bacteria | 145953 |
| 32 | Ga0055535_1000690 | 3300003761 | Bacteria | 25995 |
| 33 | Ga0055535_1000754 | 3300003761 | Bacteria | 24119 |
| 34 | Ga0055535_1001562 | 3300003761 | Bacteria | 11138 |
| 35 | Ga0055542_1000067 | 3300003762 | Bacteria | 154585 |
| 36 | Ga0055542_1000072 | 3300003762 | Bacteria | 145686 |
| 37 | Ga0055542_1000140 | 3300003762 | Bacteria | 90195 |
| 38 | Ga0055542_1000224 | 3300003762 | Bacteria | 67911 |
| 39 | Ga0055542_1001528 | 3300003762 | Bacteria | 11142 |
| 40 | Ga0055529_1000339 | 3300003763 | Bacteria | 52374 |
| 41 | Ga0055529_1000451 | 3300003763 | Bacteria | 40551 |
| 42 | Ga0055529_1000822 | 3300003763 | Bacteria | 18554 |
| 43 | Ga0055529_1002055 | 3300003763 | Bacteria | 4354 |
| 44 | Ga0065165_1013513 | 3300005262 | Bacteria | 3240 |
| 45 | Ga0065715_10137965 | 3300005293 | Bacteria | 1899 |
| 46 | Ga0070683_100597717 | 3300005329 | Bacteria | 1056 |
| 47 | Ga0070680_100381121 | 3300005336 | Bacteria | 1201 |
| 48 | Ga0070682_100178658 | 3300005337 | Bacteria | 1481 |
| 49 | Ga0070660_100015685 | 3300005339 | Bacteria | 5478 |
| 50 | Ga0070660_100228905 | 3300005339 | Bacteria | 1512 |
| 51 | Ga0070689_100001462 | 3300005340 | Bacteria | 15069 |
| 52 | Ga0070661_100007538 | 3300005344 | Bacteria | 7508 |
| 53 | Ga0070661_100062948 | 3300005344 | Bacteria | 2724 |
| 54 | Ga0070688_100028808 | 3300005365 | Bacteria | 3320 |
| 55 | Ga0070659_100006933 | 3300005366 | Bacteria | 8203 |
| 56 | Ga0070659_100133111 | 3300005366 | Bacteria | 2020 |
| 57 | Ga0070659_100211253 | 3300005366 | Bacteria | 1599 |
| 58 | Ga0070659_100213328 | 3300005366 | Bacteria | 1591 |
| 59 | Ga0070659_100753843 | 3300005366 | Bacteria | 844 |
| 60 | Ga0070714_100000088 | 3300005435 | Bacteria | 77301 |
| 61 | Ga0070714_100002264 | 3300005435 | Bacteria | 14154 |
| 62 | Ga0070713_100006101 | 3300005436 | Bacteria | 8312 |
| 63 | Ga0070694_100163371 | 3300005444 | Bacteria | 1636 |
| 64 | Ga0070663_100003752 | 3300005455 | Bacteria | 8816 |
| 65 | Ga0070663_100818827 | 3300005455 | Bacteria | 799 |
| 66 | Ga0070662_100151164 | 3300005457 | Bacteria | 1808 |
| 67 | Ga0070662_100588615 | 3300005457 | Bacteria | 935 |
| 68 | Ga0070681_10117473 | 3300005458 | Bacteria | 2596 |
| 69 | Ga0070681_10191046 | 3300005458 | Bacteria | 1967 |
| 70 | Ga0070685_10015608 | 3300005466 | Bacteria | 4037 |
| 71 | Ga0070679_100017411 | 3300005530 | Bacteria | 6955 |
| 72 | Ga0068853_100082525 | 3300005539 | Bacteria | 2815 |
| 73 | Ga0068853_100253872 | 3300005539 | Bacteria | 1614 |
| 74 | Ga0068853_100943368 | 3300005539 | Bacteria | 829 |
| 75 | Ga0070696_100026950 | 3300005546 | Bacteria | 3912 |
| 76 | Ga0070696_100313841 | 3300005546 | Bacteria | 1204 |
| 77 | Ga0070693_100001999 | 3300005547 | Bacteria | 9336 |
| 78 | Ga0070693_100291276 | 3300005547 | Bacteria | 1097 |
| 79 | Ga0068855_100037446 | 3300005563 | Bacteria | 5767 |
| 80 | Ga0068855_100160142 | 3300005563 | Bacteria | 2555 |
| 81 | Ga0068855_100214682 | 3300005563 | Bacteria | 2160 |
| 82 | Ga0068857_100004412 | 3300005577 | Bacteria | 11893 |
| 83 | Ga0068857_100112428 | 3300005577 | Bacteria | 2448 |
| 84 | Ga0068857_100414105 | 3300005577 | Bacteria | 1256 |
| 85 | Ga0068854_100007475 | 3300005578 | Bacteria | 6982 |
| 86 | Ga0068854_100147198 | 3300005578 | Bacteria | 1813 |
| 87 | Ga0068854_100155724 | 3300005578 | Bacteria | 1765 |
| 88 | Ga0068854_100746509 | 3300005578 | Bacteria | 849 |
| 89 | Ga0068856_100000447 | 3300005614 | Bacteria | 45620 |
| 90 | Ga0068856_100116668 | 3300005614 | Bacteria | 2670 |
| 91 | Ga0068852_100121517 | 3300005616 | Bacteria | 2392 |
| 92 | Ga0068859_100497687 | 3300005617 | Bacteria | 1314 |
| 93 | Ga0068851_10056948 | 3300005834 | Bacteria | 1995 |
| 94 | Ga0068858_100480092 | 3300005842 | Bacteria | 1200 |
| 95 | Ga0068860_100430450 | 3300005843 | Bacteria | 1309 |
| 96 | Ga0068862_100035072 | 3300005844 | Bacteria | 4247 |
| 97 | Ga0075364_10067670 | 3300006051 | Bacteria | 2348 |
| 98 | Ga0097620_100497741 | 3300006931 | Bacteria | 1314 |
| 99 | Ga0105240_10019235 | 3300009093 | Bacteria | 9128 |
| 100 | Ga0105240_10065905 | 3300009093 | Bacteria | 4494 |
| 101 | Ga0105240_10128740 | 3300009093 | Bacteria | 3039 |
| 102 | Ga0105240_10185474 | 3300009093 | Bacteria | 2451 |
| 103 | Ga0105240_10429365 | 3300009093 | Bacteria | 1483 |
| 104 | Ga0105241_10245941 | 3300009174 | Bacteria | 1514 |
| 105 | Ga0105237_10000007 | 3300009545 | Bacteria | 367690 |
| 106 | Ga0105237_10000063 | 3300009545 | Bacteria | 141759 |
| 107 | Ga0105237_10421291 | 3300009545 | Bacteria | 1340 |
| 108 | Ga0105238_10140924 | 3300009551 | Bacteria | 2388 |
| 109 | Ga0105238_10317843 | 3300009551 | Bacteria | 1543 |
| 110 | Ga0105238_10982216 | 3300009551 | Bacteria | 865 |
| 111 | Ga0105238_11126064 | 3300009551 | Bacteria | 808 |
| 112 | Ga0157314_1000730 | 3300012500 | Bacteria | 2882 |
| 113 | Ga0157347_1024315 | 3300012502 | Bacteria | 727 |
| 114 | Ga0157373_10014081 | 3300013100 | Bacteria | 5862 |
| 115 | Ga0157373_10103514 | 3300013100 | Bacteria | 2002 |
| 116 | Ga0157373_10191560 | 3300013100 | Bacteria | 1441 |
| 117 | Ga0157373_10505280 | 3300013100 | Bacteria | 874 |
| 118 | Ga0157371_10010685 | 3300013102 | Bacteria | 7129 |
| 119 | Ga0157371_10236462 | 3300013102 | Bacteria | 1313 |
| 120 | Ga0157371_10394269 | 3300013102 | Bacteria | 1012 |
| 121 | Ga0157370_10002036 | 3300013104 | Bacteria | 24836 |
| 122 | Ga0157370_10004621 | 3300013104 | Bacteria | 15745 |
| 123 | Ga0157370_10026436 | 3300013104 | Bacteria | 5731 |
| 124 | Ga0157370_11792214 | 3300013104 | Bacteria | 551 |
| 125 | Ga0157369_10070852 | 3300013105 | Bacteria | 3744 |
| 126 | Ga0157369_10518763 | 3300013105 | Bacteria | 1233 |
| 127 | Ga0163162_10043913 | 3300013306 | Bacteria | 4475 |
| 128 | Ga0157372_10126650 | 3300013307 | Bacteria | 2937 |
| 129 | Ga0157372_10266920 | 3300013307 | Bacteria | 1988 |
| 130 | Ga0157372_10311548 | 3300013307 | Bacteria | 1832 |
| 131 | Ga0157372_10600585 | 3300013307 | Bacteria | 1283 |
| 132 | Ga0157372_10674915 | 3300013307 | Bacteria | 1203 |
| 133 | Ga0182008_10048730 | 3300014497 | Bacteria | 2104 |
| 134 | Ga0182006_1145095 | 3300015261 | Bacteria | 808 |
| 135 | Ga0182007_10012840 | 3300015262 | Bacteria | 3212 |
| 136 | Ga0183369_1007 | 3300015685 | Bacteria | 414878 |
| 137 | Ga0183368_1002 | 3300015687 | Bacteria | 1865598 |
| 138 | Ga0183361_15013 | 3300016635 | Bacteria | 719 |
| 139 | Ga0206356_10569860 | 3300020070 | Bacteria | 3765 |
| 140 | Ga0206353_10004922 | 3300020082 | Bacteria | 4078 |
| 141 | Ga0209435_103523 | 3300025206 | Bacteria | 1787 |
| 142 | Ga0209760_103980 | 3300025207 | Bacteria | 1288 |
| 143 | Ga0209784_100073 | 3300025224 | Bacteria | 146019 |
| 144 | Ga0209566_101719 | 3300025225 | Bacteria | 5324 |
| 145 | Ga0209674_100043 | 3300025226 | Bacteria | 369728 |
| 146 | Ga0209674_100678 | 3300025226 | Bacteria | 12135 |
| 147 | Ga0209672_100049 | 3300025228 | Bacteria | 238787 |
| 148 | Ga0209672_100058 | 3300025228 | Bacteria | 211992 |
| 149 | Ga0209672_101032 | 3300025228 | Bacteria | 12045 |
| 150 | Ga0209672_101104 | 3300025228 | Bacteria | 11422 |
| 151 | Ga0209563_100051 | 3300025230 | Bacteria | 340545 |
| 152 | Ga0207427_100013 | 3300025231 | Bacteria | 581419 |
| 153 | Ga0207427_100069 | 3300025231 | Bacteria | 161547 |
| 154 | Ga0207427_100081 | 3300025231 | Bacteria | 144588 |
| 155 | Ga0207427_100224 | 3300025231 | Bacteria | 48341 |
| 156 | Ga0207427_102570 | 3300025231 | Bacteria | 4702 |
| 157 | Ga0209437_100015 | 3300025233 | Bacteria | 713457 |
| 158 | Ga0209437_100168 | 3300025233 | Bacteria | 144520 |
| 159 | Ga0209437_100273 | 3300025233 | Bacteria | 76643 |
| 160 | Ga0209437_100287 | 3300025233 | Bacteria | 74024 |
| 161 | Ga0209437_102587 | 3300025233 | Bacteria | 3475 |
| 162 | Ga0209258_100049 | 3300025242 | Bacteria | 358328 |
| 163 | Ga0209258_100087 | 3300025242 | Bacteria | 238787 |
| 164 | Ga0209258_100149 | 3300025242 | Bacteria | 162184 |
| 165 | Ga0209258_100164 | 3300025242 | Bacteria | 148838 |
| 166 | Ga0209258_100551 | 3300025242 | Bacteria | 33759 |
| 167 | Ga0209646_1000393 | 3300025246 | Bacteria | 26898 |
| 168 | Ga0209646_1001743 | 3300025246 | Bacteria | 5487 |
| 169 | Ga0209646_1004069 | 3300025246 | Bacteria | 2733 |
| 170 | Ga0209646_1006511 | 3300025246 | Bacteria | 1958 |
| 171 | Ga0209026_1000060 | 3300025250 | Bacteria | 220052 |
| 172 | Ga0209026_1000094 | 3300025250 | Bacteria | 169671 |
| 173 | Ga0209026_1000145 | 3300025250 | Bacteria | 111490 |
| 174 | Ga0209026_1000866 | 3300025250 | Bacteria | 15820 |
| 175 | Ga0209026_1001725 | 3300025250 | Bacteria | 9108 |
| 176 | Ga0209026_1001959 | 3300025250 | Bacteria | 8284 |
| 177 | Ga0209148_1000002 | 3300025254 | Bacteria | 2399500 |
| 178 | Ga0209148_1000010 | 3300025254 | Bacteria | 1265567 |
| 179 | Ga0209148_1000039 | 3300025254 | Bacteria | 482479 |
| 180 | Ga0209148_1000096 | 3300025254 | Bacteria | 238787 |
| 181 | Ga0209148_1000143 | 3300025254 | Bacteria | 162184 |
| 182 | Ga0209759_1000249 | 3300025256 | Bacteria | 80341 |
| 183 | Ga0209759_1000295 | 3300025256 | Bacteria | 69093 |
| 184 | Ga0209759_1000761 | 3300025256 | Bacteria | 27563 |
| 185 | Ga0209759_1003734 | 3300025256 | Bacteria | 5954 |
| 186 | Ga0209759_1009407 | 3300025256 | Bacteria | 2957 |
| 187 | Ga0209129_1010470 | 3300025258 | Bacteria | 2308 |
| 188 | Ga0209233_1000009 | 3300025261 | Bacteria | 1265567 |
| 189 | Ga0209233_1000083 | 3300025261 | Bacteria | 336016 |
| 190 | Ga0209233_1000092 | 3300025261 | Bacteria | 308668 |
| 191 | Ga0209233_1000151 | 3300025261 | Bacteria | 176515 |
| 192 | Ga0209455_1000034 | 3300025272 | Bacteria | 483129 |
| 193 | Ga0209455_1000082 | 3300025272 | Bacteria | 257909 |
| 194 | Ga0209455_1000088 | 3300025272 | Bacteria | 238787 |
| 195 | Ga0209455_1010397 | 3300025272 | Bacteria | 2368 |
| 196 | Ga0209758_1005240 | 3300025297 | Bacteria | 10158 |
| 197 | Ga0207647_10006001 | 3300025904 | Bacteria | 8850 |
| 198 | Ga0207647_10006719 | 3300025904 | Bacteria | 8351 |
| 199 | Ga0207705_10008157 | 3300025909 | Bacteria | 7669 |
| 200 | Ga0207654_10093148 | 3300025911 | Bacteria | 1841 |
| 201 | Ga0207707_10164449 | 3300025912 | Bacteria | 1939 |
| 202 | Ga0207695_10005651 | 3300025913 | Bacteria | 16501 |
| 203 | Ga0207695_10015963 | 3300025913 | Bacteria | 8815 |
| 204 | Ga0207695_10017386 | 3300025913 | Bacteria | 8367 |
| 205 | Ga0207695_10042408 | 3300025913 | Bacteria | 4860 |
| 206 | Ga0207695_10402970 | 3300025913 | Bacteria | 1252 |
| 207 | Ga0207671_10000021 | 3300025914 | Bacteria | 300409 |
| 208 | Ga0207671_10000074 | 3300025914 | Bacteria | 156482 |
| 209 | Ga0207671_10271724 | 3300025914 | Bacteria | 1335 |
| 210 | Ga0207660_10082373 | 3300025917 | Bacteria | 2367 |
| 211 | Ga0207657_10107836 | 3300025919 | Bacteria | 2303 |
| 212 | Ga0207657_10130005 | 3300025919 | Bacteria | 2064 |
| 213 | Ga0207657_10162614 | 3300025919 | Bacteria | 1813 |
| 214 | Ga0207657_10368396 | 3300025919 | Bacteria | 1132 |
| 215 | Ga0207649_10016099 | 3300025920 | Bacteria | 4211 |
| 216 | Ga0207694_10213209 | 3300025924 | Bacteria | 1573 |
| 217 | Ga0207694_10377509 | 3300025924 | Bacteria | 1176 |
| 218 | Ga0207694_10416113 | 3300025924 | Bacteria | 1119 |
| 219 | Ga0207700_10006249 | 3300025928 | Bacteria | 7184 |
| 220 | Ga0207664_10000066 | 3300025929 | Bacteria | 109573 |
| 221 | Ga0207664_10000315 | 3300025929 | Bacteria | 36069 |
| 222 | Ga0207664_10744324 | 3300025929 | Bacteria | 881 |
| 223 | Ga0207690_10004293 | 3300025932 | Bacteria | 8411 |
| 224 | Ga0207690_10012344 | 3300025932 | Bacteria | 5110 |
| 225 | Ga0207690_10114807 | 3300025932 | Bacteria | 1945 |
| 226 | Ga0207706_10017342 | 3300025933 | Bacteria | 6486 |
| 227 | Ga0207706_10195663 | 3300025933 | Bacteria | 1774 |
| 228 | Ga0207706_10355319 | 3300025933 | Bacteria | 1274 |
| 229 | Ga0207670_10001715 | 3300025936 | Bacteria | 11438 |
| 230 | Ga0207667_10000141 | 3300025949 | Bacteria | 109666 |
| 231 | Ga0207667_10001686 | 3300025949 | Bacteria | 27833 |
| 232 | Ga0207667_10022326 | 3300025949 | Bacteria | 6992 |
| 233 | Ga0207640_10005354 | 3300025981 | Bacteria | 6996 |
| 234 | Ga0207640_10012031 | 3300025981 | Bacteria | 4918 |
| 235 | Ga0207640_10255295 | 3300025981 | Bacteria | 1363 |
| 236 | Ga0207639_10063648 | 3300026041 | Bacteria | 2857 |
| 237 | Ga0207639_10305497 | 3300026041 | Bacteria | 1408 |
| 238 | Ga0207678_10001930 | 3300026067 | Bacteria | 18917 |
| 239 | Ga0207678_10098268 | 3300026067 | Bacteria | 2501 |
| 240 | Ga0207702_10000644 | 3300026078 | Bacteria | 38190 |
| 241 | Ga0207674_10000168 | 3300026116 | Bacteria | 78785 |
| 242 | Ga0207674_10182013 | 3300026116 | Bacteria | 2053 |
| 243 | Ga0268264_10287619 | 3300028381 | Bacteria | 1542 |
| 244 | Ga0265340_10142311 | 3300031247 | Unclassified | 1096 |
| 245 | Ga0307516_10269343 | 3300031730 | Bacteria | 1390 |
| 246 | Ga0307414_10134537 | 3300032004 | Bacteria | 1925 |
| 247 | Ga0395899_0000068 | 3300037312 | Bacteria | 202264 |
| 248 | Ga0395899_0003472 | 3300037312 | Bacteria | 12490 |
| 249 | Ga0395900_0000012 | 3300037418 | Bacteria | 401198 |
| 250 | Ga0395900_0084262 | 3300037418 | Bacteria | 3266 |
| 251 | Ga0395898_0000144 | 3300037466 | Bacteria | 187889 |
| 252 | Ga0395898_0000278 | 3300037466 | Bacteria | 124490 |
| 253 | Ga0395898_1327594 | 3300037466 | Bacteria | 648 |
| 254 | Ga0395901_0001173 | 3300038443 | Bacteria | 27860 |
| 255 | Ga0395901_0323462 | 3300038443 | Bacteria | 1595 |
| 256 | Ga0436361_0755138 | 3300039447 | Bacteria | 1043 |
| 257 | Ga0451793_1877366 | 3300041452 | Bacteria | 1509 |
| 258 | Ga0451853_1577216 | 3300041512 | Bacteria | 596 |
| 259 | Ga0439437_012721 | 3300042000 | Bacteria | 974 |
| 260 | Ga0439448_0138534 | 3300042005 | Bacteria | 841 |
| 261 | Ga0466988_0131779 | 3300044536 | Bacteria | 1466 |
| 262 | Ga0466969_0000538 | 3300044656 | Bacteria | 20767 |
| 263 | Ga0466969_0017506 | 3300044656 | Bacteria | 3739 |
| 264 | Ga0466969_0055681 | 3300044656 | Bacteria | 1933 |
| 265 | Ga0466972_0181250 | 3300044658 | Bacteria | 987 |
| 266 | Ga0466982_0000004 | 3300044672 | Bacteria | 386724 |
| 267 | Ga0466965_0010378 | 3300044683 | Bacteria | 4344 |
| 268 | Ga0466965_0344206 | 3300044683 | Bacteria | 815 |
| 269 | Ga0466966_0003574 | 3300044684 | Bacteria | 10260 |
| 270 | Ga0466966_0005847 | 3300044684 | Bacteria | 8109 |
| 271 | Ga0466961_0015318 | 3300044693 | Bacteria | 4924 |
| 272 | Ga0466961_0034067 | 3300044693 | Bacteria | 3270 |
| 273 | Ga0466963_0736767 | 3300044694 | Bacteria | 695 |
| 274 | Ga0466964_0058382 | 3300044706 | Bacteria | 1599 |
| 275 | Ga0466964_0073804 | 3300044706 | Bacteria | 1449 |
| 276 | Ga0466971_0003256 | 3300044719 | Bacteria | 6927 |
| 277 | Ga0466971_0019109 | 3300044719 | Bacteria | 3041 |
| 278 | Ga0466971_0027097 | 3300044719 | Bacteria | 2565 |
| 279 | Ga0466968_0243922 | 3300044735 | Bacteria | 851 |
| 280 | Ga0466970_0013242 | 3300044765 | Bacteria | 4227 |
| 281 | Ga0466970_0037021 | 3300044765 | Bacteria | 2585 |
| 282 | Ga0466970_0092781 | 3300044765 | Bacteria | 1640 |
| 283 | Ga0466957_0002918 | 3300044842 | Bacteria | 9264 |
| 284 | Ga0466957_0008967 | 3300044842 | Bacteria | 5702 |
| 285 | Ga0466960_0007681 | 3300044901 | Bacteria | 4391 |
| 286 | Ga0466959_0000204 | 3300045049 | Bacteria | 38407 |
| 287 | Ga0466959_0009505 | 3300045049 | Bacteria | 6918 |
| 288 | Ga0466959_0033034 | 3300045049 | Bacteria | 3828 |
| 289 | Ga0466958_0013023 | 3300045836 | Bacteria | 4725 |
| 290 | Ga0466958_0038045 | 3300045836 | Bacteria | 2885 |
| 291 | Ga0466958_0319713 | 3300045836 | Bacteria | 997 |
| 292 | Ga0466967_0145910 | 3300045976 | Bacteria | 2208 |
| 293 | Ga0495638_0000007 | 3300046460 | Bacteria | 602783 |
| 294 | Ga0495638_0000343 | 3300046460 | Bacteria | 58771 |
| 295 | Ga0495638_0005670 | 3300046460 | Bacteria | 9198 |
| 296 | Ga0495650_0000078 | 3300046471 | Bacteria | 245487 |
| 297 | Ga0495606_0000242 | 3300046507 | Bacteria | 96491 |
| 298 | Ga0495606_0015919 | 3300046507 | Bacteria | 5767 |
| 299 | Ga0495631_0217566 | 3300046518 | Bacteria | 816 |
| 300 | Ga0495597_0157985 | 3300046542 | Bacteria | 927 |
| 301 | Ga0495622_0116978 | 3300046557 | Bacteria | 1218 |
| 302 | Ga0495625_0355160 | 3300046660 | Bacteria | 925 |
| 303 | Ga0495588_0170905 | 3300046674 | Bacteria | 1149 |
| 304 | Ga0495649_0005342 | 3300046694 | Bacteria | 8196 |
| 305 | Ga0495681_0079292 | 3300047470 | Bacteria | 1469 |
| 306 | Ga0496104_1603930 | 3300048907 | Bacteria | 553 |
| 307 | Ga0496108_0502612 | 3300048911 | Bacteria | 1059 |
| 308 | Ga0496112_1738323 | 3300048915 | Bacteria | 536 |
| 309 | Ga0496113_0005362 | 3300048916 | Bacteria | 7993 |
| 310 | Ga0496114_0031218 | 3300048917 | Bacteria | 4383 |
| 311 | Ga0496115_0000158 | 3300048918 | Bacteria | 63464 |
| 312 | Ga0496115_0000177 | 3300048918 | Bacteria | 59539 |
| 313 | Ga0496115_0070527 | 3300048918 | Bacteria | 2833 |
| 314 | Ga0496115_0470912 | 3300048918 | Bacteria | 1012 |
| 315 | Ga0496121_0074694 | 3300048924 | Bacteria | 2710 |
| 316 | Ga0496121_0153138 | 3300048924 | Bacteria | 1694 |
| 317 | Ga0496122_0158717 | 3300048925 | Bacteria | 1383 |
| 318 | Ga0496123_0034574 | 3300048926 | Bacteria | 3617 |
| 319 | Ga0496124_0000018 | 3300048927 | Bacteria | 442940 |
| 320 | Ga0496125_0000517 | 3300048928 | Bacteria | 67165 |
| 321 | Ga0496126_0012227 | 3300048929 | Bacteria | 8805 |
| 322 | Ga0496126_0121963 | 3300048929 | Bacteria | 2259 |
| 323 | Ga0496126_0159912 | 3300048929 | Bacteria | 1925 |
| 324 | Ga0496126_0658420 | 3300048929 | Bacteria | 818 |
| 325 | Ga0495682_0156794 | 3300049460 | Bacteria | 811 |
| 326 | Ga0501032_0324943 | 3300049569 | Bacteria | 992 |
| 327 | Ga0501033_0001185 | 3300049570 | Bacteria | 23529 |
| 328 | Ga0501033_0434278 | 3300049570 | Bacteria | 913 |
| 329 | Ga0501034_0004493 | 3300049571 | Bacteria | 15500 |
| 330 | Ga0501036_0008195 | 3300049572 | Bacteria | 8565 |
| 331 | Ga0501036_0309413 | 3300049572 | Bacteria | 1321 |
| 332 | Ga0501037_0212686 | 3300049573 | Bacteria | 1363 |
| 333 | Ga0501039_0774798 | 3300049575 | Bacteria | 749 |
| 334 | Ga0501043_0167609 | 3300049579 | Bacteria | 1714 |
| 335 | Ga0501043_0200613 | 3300049579 | Bacteria | 1548 |
| 336 | Ga0501046_0119683 | 3300049580 | Bacteria | 2004 |
| 337 | Ga0501046_0408153 | 3300049580 | Bacteria | 980 |
| 338 | Ga0501047_0116423 | 3300049581 | Bacteria | 2554 |
| 339 | Ga0501047_0660177 | 3300049581 | Bacteria | 865 |
| 340 | Ga0501047_0835071 | 3300049581 | Bacteria | 735 |
| 341 | Ga0501070_0001983 | 3300049586 | Bacteria | 18007 |
| 342 | Ga0501077_0769662 | 3300049593 | Bacteria | 619 |
| 343 | Ga0501080_0239872 | 3300049742 | Bacteria | 1655 |
| 344 | Ga0501035_0043677 | 3300049822 | Bacteria | 4038 |
| 345 | Ga0501035_0058432 | 3300049822 | Bacteria | 3436 |
| 346 | Ga0501035_0107098 | 3300049822 | Bacteria | 2450 |
| 347 | Ga0501035_0121014 | 3300049822 | Bacteria | 2288 |
| 348 | Ga0501044_0039228 | 3300049823 | Bacteria | 4941 |
| 349 | Ga0501044_0120077 | 3300049823 | Bacteria | 2630 |
| 350 | Ga0501044_0148412 | 3300049823 | Bacteria | 2328 |
| 351 | Ga0501044_0728146 | 3300049823 | Bacteria | 875 |
| 352 | nmdc:mga00v17_38711_c1 | 3300050491 | Bacteria | 2853 |
| 353 | Ga0500658_0116105 | 3300053134 | Bacteria | 1183 |
| 354 | Ga0500627_0008393 | 3300053158 | Bacteria | 3667 |
| 355 | Ga0466962_0001511 | 3300061719 | Bacteria | 10859 |
| 356 | Ga0466962_0006237 | 3300061719 | Bacteria | 5725 |
| 357 | Ga0466962_0226149 | 3300061719 | Bacteria | 917 |
| 358 | 2538833171 | 2537561836 | Bacteria | 3910579 |
| 359 | 2643908934 | 2643221579 | Bacteria | 4443405 |
| 360 | 2643915492 | 2643221581 | Bacteria | 3893603 |
| 361 | 2739730383 | 2739367700 | Bacteria | 4747630 |
| 362 | 2842781327 | 2842780639 | Bacteria | 4337790 |
| 363 | 2895397060 | 2895395659 | Bacteria | 3983269 |
| 364 | 2939614143 | 2939611941 | Bacteria | 3892017 |
| 365 | 8002872690 | 8002869464 | Bacteria | 3588529 |
| 366 | 8021626008 | 8021622325 | Bacteria | 4844743 |
| 367 | 8021651747 | 8021648035 | Bacteria | 4772378 |
| 368 | Ga0157376_10030620 | |||
| 369 | JGI24740J21852_10022400 | |||
| 370 | JGI24739J22299_10000089 | |||
| 371 | JGI24735J21928_10002530 | |||
| 372 | JGI25156J39149_1001534 | |||
| 373 | JGI25156J39149_1001864 | |||
| 374 | JGI25156J39149_1002490 | |||
| 375 | JGI25162J39368_1000057 | |||
| 376 | JGI25162J39368_1000338 | |||
| 377 | JGI25154J39366_1006259 | |||
| 378 | JGI25157J39369_1000182 | |||
| 379 | JGI25157J39369_1001918 | |||
| 380 | JGI25157J39369_1007373 | |||
| 381 | JGI25164J39214_1000032 | |||
| 382 | JGI25164J39214_1000043 | |||
| 383 | JGI25164J39214_1001119 | |||
| 384 | JGI25164J39214_1013601 | |||
| 385 | JGI25165J46597_1000113 | |||
| 386 | JGI25165J46597_1000136 | |||
| 387 | JGI25165J46597_1002037 | |||
| 388 | rootH1_10132142 | |||
| 389 | rootH1_10166365 | |||
| 390 | Ga0006562J51391_1011821 | |||
| 391 | Ga0055538_1001003 | |||
| 392 | Ga0055533_1000782 | |||
| 393 | Ga0055525_1000164 | |||
| 394 | Ga0055527_1000065 | |||
| 395 | Ga0055527_1000317 | |||
| 396 | Ga0055527_1002917 | |||
| 397 | Ga0055527_1003327 | |||
| 398 | Ga0055535_1000043 | |||
| 399 | Ga0055535_1000690 | |||
| 400 | Ga0055535_1000754 | |||
| 401 | Ga0055535_1001562 | |||
| 402 | Ga0055542_1000067 | |||
| 403 | Ga0055542_1000072 | |||
| 404 | Ga0055542_1000140 | |||
| 405 | Ga0055542_1000224 | |||
| 406 | Ga0055542_1001528 | |||
| 407 | Ga0055529_1000339 | |||
| 408 | Ga0055529_1000451 | |||
| 409 | Ga0055529_1000822 | |||
| 410 | Ga0055529_1002055 | |||
| 411 | Ga0065165_1013513 | |||
| 412 | Ga0065715_10137965 | |||
| 413 | Ga0070683_100597717 | |||
| 414 | Ga0070680_100381121 | |||
| 415 | Ga0070682_100178658 | |||
| 416 | Ga0070660_100015685 | |||
| 417 | Ga0070660_100228905 | |||
| 418 | Ga0070689_100001462 | |||
| 419 | Ga0070661_100007538 | |||
| 420 | Ga0070661_100062948 | |||
| 421 | Ga0070688_100028808 | |||
| 422 | Ga0070659_100006933 | |||
| 423 | Ga0070659_100133111 | |||
| 424 | Ga0070659_100211253 | |||
| 425 | Ga0070659_100213328 | |||
| 426 | Ga0070659_100753843 | |||
| 427 | Ga0070714_100000088 | |||
| 428 | Ga0070714_100002264 | |||
| 429 | Ga0070713_100006101 | |||
| 430 | Ga0070694_100163371 | |||
| 431 | Ga0070663_100003752 | |||
| 432 | Ga0070663_100818827 | |||
| 433 | Ga0070662_100151164 | |||
| 434 | Ga0070662_100588615 | |||
| 435 | Ga0070681_10117473 | |||
| 436 | Ga0070681_10191046 | |||
| 437 | Ga0070685_10015608 | |||
| 438 | Ga0070679_100017411 | |||
| 439 | Ga0068853_100082525 | |||
| 440 | Ga0068853_100253872 | |||
| 441 | Ga0068853_100943368 | |||
| 442 | Ga0070696_100026950 | |||
| 443 | Ga0070696_100313841 | |||
| 444 | Ga0070693_100001999 | |||
| 445 | Ga0070693_100291276 | |||
| 446 | Ga0068855_100037446 | |||
| 447 | Ga0068855_100160142 | |||
| 448 | Ga0068855_100214682 | |||
| 449 | Ga0068857_100004412 | |||
| 450 | Ga0068857_100112428 | |||
| 451 | Ga0068857_100414105 | |||
| 452 | Ga0068854_100007475 | |||
| 453 | Ga0068854_100147198 | |||
| 454 | Ga0068854_100155724 | |||
| 455 | Ga0068854_100746509 | |||
| 456 | Ga0068856_100000447 | |||
| 457 | Ga0068856_100116668 | |||
| 458 | Ga0068852_100121517 | |||
| 459 | Ga0068859_100497687 | |||
| 460 | Ga0068851_10056948 | |||
| 461 | Ga0068858_100480092 | |||
| 462 | Ga0068860_100430450 | |||
| 463 | Ga0068862_100035072 | |||
| 464 | Ga0075364_10067670 | |||
| 465 | Ga0097620_100497741 | |||
| 466 | Ga0105240_10019235 | |||
| 467 | Ga0105240_10065905 | |||
| 468 | Ga0105240_10128740 | |||
| 469 | Ga0105240_10185474 | |||
| 470 | Ga0105240_10429365 | |||
| 471 | Ga0105241_10245941 | |||
| 472 | Ga0105237_10000007 | |||
| 473 | Ga0105237_10000063 | |||
| 474 | Ga0105237_10421291 | |||
| 475 | Ga0105238_10140924 | |||
| 476 | Ga0105238_10317843 | |||
| 477 | Ga0105238_10982216 | |||
| 478 | Ga0105238_11126064 | |||
| 479 | Ga0157314_1000730 | |||
| 480 | Ga0157347_1024315 | |||
| 481 | Ga0157373_10014081 | |||
| 482 | Ga0157373_10103514 | |||
| 483 | Ga0157373_10191560 | |||
| 484 | Ga0157373_10505280 | |||
| 485 | Ga0157371_10010685 | |||
| 486 | Ga0157371_10236462 | |||
| 487 | Ga0157371_10394269 | |||
| 488 | Ga0157370_10002036 | |||
| 489 | Ga0157370_10004621 | |||
| 490 | Ga0157370_10026436 | |||
| 491 | Ga0157370_11792214 | |||
| 492 | Ga0157369_10070852 | |||
| 493 | Ga0157369_10518763 | |||
| 494 | Ga0163162_10043913 | |||
| 495 | Ga0157372_10126650 | |||
| 496 | Ga0157372_10266920 | |||
| 497 | Ga0157372_10311548 | |||
| 498 | Ga0157372_10600585 | |||
| 499 | Ga0157372_10674915 | |||
| 500 | Ga0182008_10048730 | |||
| 501 | Ga0182006_1145095 | |||
| 502 | Ga0182007_10012840 | |||
| 503 | Ga0183369_1007 | |||
| 504 | Ga0183368_1002 | |||
| 505 | Ga0183361_15013 | |||
| 506 | Ga0206356_10569860 | |||
| 507 | Ga0206353_10004922 | |||
| 508 | Ga0209435_103523 | |||
| 509 | Ga0209760_103980 | |||
| 510 | Ga0209784_100073 | |||
| 511 | Ga0209566_101719 | |||
| 512 | Ga0209674_100043 | |||
| 513 | Ga0209674_100678 | |||
| 514 | Ga0209672_100049 | |||
| 515 | Ga0209672_100058 | |||
| 516 | Ga0209672_101032 | |||
| 517 | Ga0209672_101104 | |||
| 518 | Ga0209563_100051 | |||
| 519 | Ga0207427_100013 | |||
| 520 | Ga0207427_100069 | |||
| 521 | Ga0207427_100081 | |||
| 522 | Ga0207427_100224 | |||
| 523 | Ga0207427_102570 | |||
| 524 | Ga0209437_100015 | |||
| 525 | Ga0209437_100168 | |||
| 526 | Ga0209437_100273 | |||
| 527 | Ga0209437_100287 | |||
| 528 | Ga0209437_102587 | |||
| 529 | Ga0209258_100049 | |||
| 530 | Ga0209258_100087 | |||
| 531 | Ga0209258_100149 | |||
| 532 | Ga0209258_100164 | |||
| 533 | Ga0209258_100551 | |||
| 534 | Ga0209646_1000393 | |||
| 535 | Ga0209646_1001743 | |||
| 536 | Ga0209646_1004069 | |||
| 537 | Ga0209646_1006511 | |||
| 538 | Ga0209026_1000060 | |||
| 539 | Ga0209026_1000094 | |||
| 540 | Ga0209026_1000145 | |||
| 541 | Ga0209026_1000866 | |||
| 542 | Ga0209026_1001725 | |||
| 543 | Ga0209026_1001959 | |||
| 544 | Ga0209148_1000002 | |||
| 545 | Ga0209148_1000010 | |||
| 546 | Ga0209148_1000039 | |||
| 547 | Ga0209148_1000096 | |||
| 548 | Ga0209148_1000143 | |||
| 549 | Ga0209759_1000249 | |||
| 550 | Ga0209759_1000295 | |||
| 551 | Ga0209759_1000761 | |||
| 552 | Ga0209759_1003734 | |||
| 553 | Ga0209759_1009407 | |||
| 554 | Ga0209129_1010470 | |||
| 555 | Ga0209233_1000009 | |||
| 556 | Ga0209233_1000083 | |||
| 557 | Ga0209233_1000092 | |||
| 558 | Ga0209233_1000151 | |||
| 559 | Ga0209455_1000034 | |||
| 560 | Ga0209455_1000082 | |||
| 561 | Ga0209455_1000088 | |||
| 562 | Ga0209455_1010397 | |||
| 563 | Ga0209758_1005240 | |||
| 564 | Ga0207647_10006001 | |||
| 565 | Ga0207647_10006719 | |||
| 566 | Ga0207705_10008157 | |||
| 567 | Ga0207654_10093148 | |||
| 568 | Ga0207707_10164449 | |||
| 569 | Ga0207695_10005651 | |||
| 570 | Ga0207695_10015963 | |||
| 571 | Ga0207695_10017386 | |||
| 572 | Ga0207695_10042408 | |||
| 573 | Ga0207695_10402970 | |||
| 574 | Ga0207671_10000021 | |||
| 575 | Ga0207671_10000074 | |||
| 576 | Ga0207671_10271724 | |||
| 577 | Ga0207660_10082373 | |||
| 578 | Ga0207657_10107836 | |||
| 579 | Ga0207657_10130005 | |||
| 580 | Ga0207657_10162614 | |||
| 581 | Ga0207657_10368396 | |||
| 582 | Ga0207649_10016099 | |||
| 583 | Ga0207694_10213209 | |||
| 584 | Ga0207694_10377509 | |||
| 585 | Ga0207694_10416113 | |||
| 586 | Ga0207700_10006249 | |||
| 587 | Ga0207664_10000066 | |||
| 588 | Ga0207664_10000315 | |||
| 589 | Ga0207664_10744324 | |||
| 590 | Ga0207690_10004293 | |||
| 591 | Ga0207690_10012344 | |||
| 592 | Ga0207690_10114807 | |||
| 593 | Ga0207706_10017342 | |||
| 594 | Ga0207706_10195663 | |||
| 595 | Ga0207706_10355319 | |||
| 596 | Ga0207670_10001715 | |||
| 597 | Ga0207667_10000141 | |||
| 598 | Ga0207667_10001686 | |||
| 599 | Ga0207667_10022326 | |||
| 600 | Ga0207640_10005354 | |||
| 601 | Ga0207640_10012031 | |||
| 602 | Ga0207640_10255295 | |||
| 603 | Ga0207639_10063648 | |||
| 604 | Ga0207639_10305497 | |||
| 605 | Ga0207678_10001930 | |||
| 606 | Ga0207678_10098268 | |||
| 607 | Ga0207702_10000644 | |||
| 608 | Ga0207674_10000168 | |||
| 609 | Ga0207674_10182013 | |||
| 610 | Ga0268264_10287619 | |||
| 611 | Ga0265340_10142311 | |||
| 612 | Ga0307516_10269343 | |||
| 613 | Ga0307414_10134537 | |||
| 614 | Ga0395899_0000068 | |||
| 615 | Ga0395899_0003472 | |||
| 616 | Ga0395900_0000012 | |||
| 617 | Ga0395900_0084262 | |||
| 618 | Ga0395898_0000144 | |||
| 619 | Ga0395898_0000278 | |||
| 620 | Ga0395898_1327594 | |||
| 621 | Ga0395901_0001173 | |||
| 622 | Ga0395901_0323462 | |||
| 623 | Ga0436361_0755138 | |||
| 624 | Ga0451793_1877366 | |||
| 625 | Ga0451853_1577216 | |||
| 626 | Ga0439437_012721 | |||
| 627 | Ga0439448_0138534 | |||
| 628 | Ga0466988_0131779 | |||
| 629 | Ga0466969_0000538 | |||
| 630 | Ga0466969_0017506 | |||
| 631 | Ga0466969_0055681 | |||
| 632 | Ga0466972_0181250 | |||
| 633 | Ga0466982_0000004 | |||
| 634 | Ga0466965_0010378 | |||
| 635 | Ga0466965_0344206 | |||
| 636 | Ga0466966_0003574 | |||
| 637 | Ga0466966_0005847 | |||
| 638 | Ga0466961_0015318 | |||
| 639 | Ga0466961_0034067 | |||
| 640 | Ga0466963_0736767 | |||
| 641 | Ga0466964_0058382 | |||
| 642 | Ga0466964_0073804 | |||
| 643 | Ga0466971_0003256 | |||
| 644 | Ga0466971_0019109 | |||
| 645 | Ga0466971_0027097 | |||
| 646 | Ga0466968_0243922 | |||
| 647 | Ga0466970_0013242 | |||
| 648 | Ga0466970_0037021 | |||
| 649 | Ga0466970_0092781 | |||
| 650 | Ga0466957_0002918 | |||
| 651 | Ga0466957_0008967 | |||
| 652 | Ga0466960_0007681 | |||
| 653 | Ga0466959_0000204 | |||
| 654 | Ga0466959_0009505 | |||
| 655 | Ga0466959_0033034 | |||
| 656 | Ga0466958_0013023 | |||
| 657 | Ga0466958_0038045 | |||
| 658 | Ga0466958_0319713 | |||
| 659 | Ga0466967_0145910 | |||
| 660 | Ga0495638_0000007 | |||
| 661 | Ga0495638_0000343 | |||
| 662 | Ga0495638_0005670 | |||
| 663 | Ga0495650_0000078 | |||
| 664 | Ga0495606_0000242 | |||
| 665 | Ga0495606_0015919 | |||
| 666 | Ga0495631_0217566 | |||
| 667 | Ga0495597_0157985 | |||
| 668 | Ga0495622_0116978 | |||
| 669 | Ga0495625_0355160 | |||
| 670 | Ga0495588_0170905 | |||
| 671 | Ga0495649_0005342 | |||
| 672 | Ga0495681_0079292 | |||
| 673 | Ga0496104_1603930 | |||
| 674 | Ga0496108_0502612 | |||
| 675 | Ga0496112_1738323 | |||
| 676 | Ga0496113_0005362 | |||
| 677 | Ga0496114_0031218 | |||
| 678 | Ga0496115_0000158 | |||
| 679 | Ga0496115_0000177 | |||
| 680 | Ga0496115_0070527 | |||
| 681 | Ga0496115_0470912 | |||
| 682 | Ga0496121_0074694 | |||
| 683 | Ga0496121_0153138 | |||
| 684 | Ga0496122_0158717 | |||
| 685 | Ga0496123_0034574 | |||
| 686 | Ga0496124_0000018 | |||
| 687 | Ga0496125_0000517 | |||
| 688 | Ga0496126_0012227 | |||
| 689 | Ga0496126_0121963 | |||
| 690 | Ga0496126_0159912 | |||
| 691 | Ga0496126_0658420 | |||
| 692 | Ga0495682_0156794 | |||
| 693 | Ga0501032_0324943 | |||
| 694 | Ga0501033_0001185 | |||
| 695 | Ga0501033_0434278 | |||
| 696 | Ga0501034_0004493 | |||
| 697 | Ga0501036_0008195 | |||
| 698 | Ga0501036_0309413 | |||
| 699 | Ga0501037_0212686 | |||
| 700 | Ga0501039_0774798 | |||
| 701 | Ga0501043_0167609 | |||
| 702 | Ga0501043_0200613 | |||
| 703 | Ga0501046_0119683 | |||
| 704 | Ga0501046_0408153 | |||
| 705 | Ga0501047_0116423 | |||
| 706 | Ga0501047_0660177 | |||
| 707 | Ga0501047_0835071 | |||
| 708 | Ga0501070_0001983 | |||
| 709 | Ga0501077_0769662 | |||
| 710 | Ga0501080_0239872 | |||
| 711 | Ga0501035_0043677 | |||
| 712 | Ga0501035_0058432 | |||
| 713 | Ga0501035_0107098 | |||
| 714 | Ga0501035_0121014 | |||
| 715 | Ga0501044_0039228 | |||
| 716 | Ga0501044_0120077 | |||
| 717 | Ga0501044_0148412 | |||
| 718 | Ga0501044_0728146 | |||
| 719 | nmdc:mga00v17_38711_c1 | |||
| 720 | Ga0500658_0116105 | |||
| 721 | Ga0500627_0008393 | |||
| 722 | Ga0466962_0001511 | |||
| 723 | Ga0466962_0006237 | |||
| 724 | Ga0466962_0226149 | |||
| 725 | 2538833171 | |||
| 726 | 2643908934 | |||
| 727 | 2643915492 | |||
| 728 | 2739730383 | |||
| 729 | 2842781327 | |||
| 730 | 2895397060 | |||
| 731 | 2939614143 | |||
| 732 | 8002872690 | |||
| 733 | 8021626008 | |||
| 734 | 8021651747 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2fex-assembly2.cif.gz_C-2 | the crystal structure of dj-1 superfamily protein atu0886 from agrobacterium tumefaciens | 0.5269 | 49 | 87 |
| 4q5g-assembly1.cif.gz_A-2 | crystal structure of mouse serum amyloid a3 | 0.421 | 93 | 162 |
| 2h1j-assembly2.cif.gz_B | 3.1 a x-ray structure of putative oligoendopeptidase f: crystals grown by microfluidic seeding | 0.4108 | 19 | 127 |
| 7l7f-assembly1.cif.gz_D | cryo-em structure of human ace2 receptor bound to protein encoded by vaccine candidate bnt162b1 | 0.3469 | 19 | 155 |
| 1npc-assembly1.cif.gz_A | the structure of neutral protease from bacillus cereus at 0.2-nm resolution | 0.3442 | 50 | 166 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A1ZAW0_568_674_3.30.160.380 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Dicer dimerisation domain | 0.7625 | 144 | 164 | 3.30.160.380 |
| af_Q2FXE0_43_154_1.10.10.2910 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; | 0.6829 | 23 | 78 | 1.10.10.2910 |
| af_Q09884_534_629_3.30.160.380 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Dicer dimerisation domain | 0.5906 | 135 | 165 | 3.30.160.380 |
| af_Q5BJS0_244_335_3.30.160.20 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.5777 | 131 | 165 | 3.30.160.20 |
| 2fexA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.5234 | 49 | 87 | 3.40.50.880 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-F0BGA3-F1-model_v4 | IrrE N-terminal-like domain-containing protein | 0.9996 | 11 | 156 |
|
| AF-A0A0G9H6P7-F1-model_v4 | IrrE N-terminal-like domain-containing protein | 0.9987 | 11 | 166 |
|
| AF-B0RY64-F1-model_v4 | ImmA/IrrE family metallo-endopeptidase | 0.9983 | 9 | 156 |
|
| AF-A0A3S0PFY5-F1-model_v4 | ImmA/IrrE family metallo-endopeptidase | 0.9977 | 22 | 164 |
|
| AF-A0A2W6VXR7-F1-model_v4 | Uncharacterized protein | 0.9977 | 11 | 157 |
|