F424353

General Info

Members Datasets Scaffolds Average Seq Length
367 192 734 165

Family's Representative Sequence

Representative Sequence 3300014969|Ga0157376_10030620|Ga0157376_100306201
Length 194
Sequence MPVALPSSTDEASVMRVAEIGFEAPAKLLARYGLALERVAPGAAIPGSFWGDEEAGIIGTTVYARDDTPVHSLLHEAGHLIVLPPERRSQVHTDATDSIAEEDATCYLQIVLADELPGVGRARLMADMDAWGYTFRLGSAQAWFGEDAANARQWLVEHGLLDPQGRPVSANRRRFGASKTLLLSHVDTTPAGAV

Samples

Sample ID Description Type Environment
1 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
13 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
14 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
17 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
18 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
19 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
58 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
66 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
67 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
68 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
69 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
70 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
71 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
74 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
75 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
82 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
84 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
85 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
87 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
88 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
89 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
114 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
121 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
122 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
123 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
124 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
125 3300044536 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E Metagenome Unclassified
126 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
127 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
128 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
129 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
130 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
131 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
132 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
133 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
134 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
135 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
136 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
137 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
138 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
139 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
140 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
141 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
142 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
143 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
144 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
145 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
146 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
147 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
148 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
149 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
150 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
151 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
157 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
158 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
159 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
160 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
161 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
162 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
163 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
164 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
165 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
175 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
180 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
181 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
182 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
183 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
184 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
185 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
186 2739367700 Dyella sp. YR388 Isolate Unclassified
187 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
188 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
189 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
190 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
191 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
192 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.46
Metatranscriptomes 0.82
Isolates 2.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.16
Nodule 0
Rhizoplane 2.72
Rhizosphere 64.03
Stem 0
Stem Tuber 0
Unclassified 0.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157376_10030620 3300014969 Bacteria 4299
2 JGI24740J21852_10022400 3300001979 Bacteria 2175
3 JGI24739J22299_10000089 3300001989 Bacteria 26418
4 JGI24735J21928_10002530 3300002067 Bacteria 6323
5 JGI25156J39149_1001534 3300002705 Bacteria 9572
6 JGI25156J39149_1001864 3300002705 Bacteria 8246
7 JGI25156J39149_1002490 3300002705 Bacteria 6564
8 JGI25162J39368_1000057 3300002737 Bacteria 145686
9 JGI25162J39368_1000338 3300002737 Bacteria 40747
10 JGI25154J39366_1006259 3300002738 Bacteria 1768
11 JGI25157J39369_1000182 3300002741 Bacteria 53311
12 JGI25157J39369_1001918 3300002741 Bacteria 6287
13 JGI25157J39369_1007373 3300002741 Bacteria 1591
14 JGI25164J39214_1000032 3300002772 Bacteria 144465
15 JGI25164J39214_1000043 3300002772 Bacteria 126257
16 JGI25164J39214_1001119 3300002772 Bacteria 7640
17 JGI25164J39214_1013601 3300002772 Bacteria 761
18 JGI25165J46597_1000113 3300003214 Bacteria 145686
19 JGI25165J46597_1000136 3300003214 Bacteria 122521
20 JGI25165J46597_1002037 3300003214 Bacteria 7651
21 rootH1_10132142 3300003316 Bacteria 1178
22 rootH1_10166365 3300003316 Bacteria 1159
23 Ga0006562J51391_1011821 3300003578 Bacteria 850
24 Ga0055538_1001003 3300003751 Bacteria 6516
25 Ga0055533_1000782 3300003756 Bacteria 9978
26 Ga0055525_1000164 3300003759 Bacteria 85555
27 Ga0055527_1000065 3300003760 Bacteria 88416
28 Ga0055527_1000317 3300003760 Bacteria 25995
29 Ga0055527_1002917 3300003760 Bacteria 2703
30 Ga0055527_1003327 3300003760 Bacteria 2421
31 Ga0055535_1000043 3300003761 Bacteria 145953
32 Ga0055535_1000690 3300003761 Bacteria 25995
33 Ga0055535_1000754 3300003761 Bacteria 24119
34 Ga0055535_1001562 3300003761 Bacteria 11138
35 Ga0055542_1000067 3300003762 Bacteria 154585
36 Ga0055542_1000072 3300003762 Bacteria 145686
37 Ga0055542_1000140 3300003762 Bacteria 90195
38 Ga0055542_1000224 3300003762 Bacteria 67911
39 Ga0055542_1001528 3300003762 Bacteria 11142
40 Ga0055529_1000339 3300003763 Bacteria 52374
41 Ga0055529_1000451 3300003763 Bacteria 40551
42 Ga0055529_1000822 3300003763 Bacteria 18554
43 Ga0055529_1002055 3300003763 Bacteria 4354
44 Ga0065165_1013513 3300005262 Bacteria 3240
45 Ga0065715_10137965 3300005293 Bacteria 1899
46 Ga0070683_100597717 3300005329 Bacteria 1056
47 Ga0070680_100381121 3300005336 Bacteria 1201
48 Ga0070682_100178658 3300005337 Bacteria 1481
49 Ga0070660_100015685 3300005339 Bacteria 5478
50 Ga0070660_100228905 3300005339 Bacteria 1512
51 Ga0070689_100001462 3300005340 Bacteria 15069
52 Ga0070661_100007538 3300005344 Bacteria 7508
53 Ga0070661_100062948 3300005344 Bacteria 2724
54 Ga0070688_100028808 3300005365 Bacteria 3320
55 Ga0070659_100006933 3300005366 Bacteria 8203
56 Ga0070659_100133111 3300005366 Bacteria 2020
57 Ga0070659_100211253 3300005366 Bacteria 1599
58 Ga0070659_100213328 3300005366 Bacteria 1591
59 Ga0070659_100753843 3300005366 Bacteria 844
60 Ga0070714_100000088 3300005435 Bacteria 77301
61 Ga0070714_100002264 3300005435 Bacteria 14154
62 Ga0070713_100006101 3300005436 Bacteria 8312
63 Ga0070694_100163371 3300005444 Bacteria 1636
64 Ga0070663_100003752 3300005455 Bacteria 8816
65 Ga0070663_100818827 3300005455 Bacteria 799
66 Ga0070662_100151164 3300005457 Bacteria 1808
67 Ga0070662_100588615 3300005457 Bacteria 935
68 Ga0070681_10117473 3300005458 Bacteria 2596
69 Ga0070681_10191046 3300005458 Bacteria 1967
70 Ga0070685_10015608 3300005466 Bacteria 4037
71 Ga0070679_100017411 3300005530 Bacteria 6955
72 Ga0068853_100082525 3300005539 Bacteria 2815
73 Ga0068853_100253872 3300005539 Bacteria 1614
74 Ga0068853_100943368 3300005539 Bacteria 829
75 Ga0070696_100026950 3300005546 Bacteria 3912
76 Ga0070696_100313841 3300005546 Bacteria 1204
77 Ga0070693_100001999 3300005547 Bacteria 9336
78 Ga0070693_100291276 3300005547 Bacteria 1097
79 Ga0068855_100037446 3300005563 Bacteria 5767
80 Ga0068855_100160142 3300005563 Bacteria 2555
81 Ga0068855_100214682 3300005563 Bacteria 2160
82 Ga0068857_100004412 3300005577 Bacteria 11893
83 Ga0068857_100112428 3300005577 Bacteria 2448
84 Ga0068857_100414105 3300005577 Bacteria 1256
85 Ga0068854_100007475 3300005578 Bacteria 6982
86 Ga0068854_100147198 3300005578 Bacteria 1813
87 Ga0068854_100155724 3300005578 Bacteria 1765
88 Ga0068854_100746509 3300005578 Bacteria 849
89 Ga0068856_100000447 3300005614 Bacteria 45620
90 Ga0068856_100116668 3300005614 Bacteria 2670
91 Ga0068852_100121517 3300005616 Bacteria 2392
92 Ga0068859_100497687 3300005617 Bacteria 1314
93 Ga0068851_10056948 3300005834 Bacteria 1995
94 Ga0068858_100480092 3300005842 Bacteria 1200
95 Ga0068860_100430450 3300005843 Bacteria 1309
96 Ga0068862_100035072 3300005844 Bacteria 4247
97 Ga0075364_10067670 3300006051 Bacteria 2348
98 Ga0097620_100497741 3300006931 Bacteria 1314
99 Ga0105240_10019235 3300009093 Bacteria 9128
100 Ga0105240_10065905 3300009093 Bacteria 4494
101 Ga0105240_10128740 3300009093 Bacteria 3039
102 Ga0105240_10185474 3300009093 Bacteria 2451
103 Ga0105240_10429365 3300009093 Bacteria 1483
104 Ga0105241_10245941 3300009174 Bacteria 1514
105 Ga0105237_10000007 3300009545 Bacteria 367690
106 Ga0105237_10000063 3300009545 Bacteria 141759
107 Ga0105237_10421291 3300009545 Bacteria 1340
108 Ga0105238_10140924 3300009551 Bacteria 2388
109 Ga0105238_10317843 3300009551 Bacteria 1543
110 Ga0105238_10982216 3300009551 Bacteria 865
111 Ga0105238_11126064 3300009551 Bacteria 808
112 Ga0157314_1000730 3300012500 Bacteria 2882
113 Ga0157347_1024315 3300012502 Bacteria 727
114 Ga0157373_10014081 3300013100 Bacteria 5862
115 Ga0157373_10103514 3300013100 Bacteria 2002
116 Ga0157373_10191560 3300013100 Bacteria 1441
117 Ga0157373_10505280 3300013100 Bacteria 874
118 Ga0157371_10010685 3300013102 Bacteria 7129
119 Ga0157371_10236462 3300013102 Bacteria 1313
120 Ga0157371_10394269 3300013102 Bacteria 1012
121 Ga0157370_10002036 3300013104 Bacteria 24836
122 Ga0157370_10004621 3300013104 Bacteria 15745
123 Ga0157370_10026436 3300013104 Bacteria 5731
124 Ga0157370_11792214 3300013104 Bacteria 551
125 Ga0157369_10070852 3300013105 Bacteria 3744
126 Ga0157369_10518763 3300013105 Bacteria 1233
127 Ga0163162_10043913 3300013306 Bacteria 4475
128 Ga0157372_10126650 3300013307 Bacteria 2937
129 Ga0157372_10266920 3300013307 Bacteria 1988
130 Ga0157372_10311548 3300013307 Bacteria 1832
131 Ga0157372_10600585 3300013307 Bacteria 1283
132 Ga0157372_10674915 3300013307 Bacteria 1203
133 Ga0182008_10048730 3300014497 Bacteria 2104
134 Ga0182006_1145095 3300015261 Bacteria 808
135 Ga0182007_10012840 3300015262 Bacteria 3212
136 Ga0183369_1007 3300015685 Bacteria 414878
137 Ga0183368_1002 3300015687 Bacteria 1865598
138 Ga0183361_15013 3300016635 Bacteria 719
139 Ga0206356_10569860 3300020070 Bacteria 3765
140 Ga0206353_10004922 3300020082 Bacteria 4078
141 Ga0209435_103523 3300025206 Bacteria 1787
142 Ga0209760_103980 3300025207 Bacteria 1288
143 Ga0209784_100073 3300025224 Bacteria 146019
144 Ga0209566_101719 3300025225 Bacteria 5324
145 Ga0209674_100043 3300025226 Bacteria 369728
146 Ga0209674_100678 3300025226 Bacteria 12135
147 Ga0209672_100049 3300025228 Bacteria 238787
148 Ga0209672_100058 3300025228 Bacteria 211992
149 Ga0209672_101032 3300025228 Bacteria 12045
150 Ga0209672_101104 3300025228 Bacteria 11422
151 Ga0209563_100051 3300025230 Bacteria 340545
152 Ga0207427_100013 3300025231 Bacteria 581419
153 Ga0207427_100069 3300025231 Bacteria 161547
154 Ga0207427_100081 3300025231 Bacteria 144588
155 Ga0207427_100224 3300025231 Bacteria 48341
156 Ga0207427_102570 3300025231 Bacteria 4702
157 Ga0209437_100015 3300025233 Bacteria 713457
158 Ga0209437_100168 3300025233 Bacteria 144520
159 Ga0209437_100273 3300025233 Bacteria 76643
160 Ga0209437_100287 3300025233 Bacteria 74024
161 Ga0209437_102587 3300025233 Bacteria 3475
162 Ga0209258_100049 3300025242 Bacteria 358328
163 Ga0209258_100087 3300025242 Bacteria 238787
164 Ga0209258_100149 3300025242 Bacteria 162184
165 Ga0209258_100164 3300025242 Bacteria 148838
166 Ga0209258_100551 3300025242 Bacteria 33759
167 Ga0209646_1000393 3300025246 Bacteria 26898
168 Ga0209646_1001743 3300025246 Bacteria 5487
169 Ga0209646_1004069 3300025246 Bacteria 2733
170 Ga0209646_1006511 3300025246 Bacteria 1958
171 Ga0209026_1000060 3300025250 Bacteria 220052
172 Ga0209026_1000094 3300025250 Bacteria 169671
173 Ga0209026_1000145 3300025250 Bacteria 111490
174 Ga0209026_1000866 3300025250 Bacteria 15820
175 Ga0209026_1001725 3300025250 Bacteria 9108
176 Ga0209026_1001959 3300025250 Bacteria 8284
177 Ga0209148_1000002 3300025254 Bacteria 2399500
178 Ga0209148_1000010 3300025254 Bacteria 1265567
179 Ga0209148_1000039 3300025254 Bacteria 482479
180 Ga0209148_1000096 3300025254 Bacteria 238787
181 Ga0209148_1000143 3300025254 Bacteria 162184
182 Ga0209759_1000249 3300025256 Bacteria 80341
183 Ga0209759_1000295 3300025256 Bacteria 69093
184 Ga0209759_1000761 3300025256 Bacteria 27563
185 Ga0209759_1003734 3300025256 Bacteria 5954
186 Ga0209759_1009407 3300025256 Bacteria 2957
187 Ga0209129_1010470 3300025258 Bacteria 2308
188 Ga0209233_1000009 3300025261 Bacteria 1265567
189 Ga0209233_1000083 3300025261 Bacteria 336016
190 Ga0209233_1000092 3300025261 Bacteria 308668
191 Ga0209233_1000151 3300025261 Bacteria 176515
192 Ga0209455_1000034 3300025272 Bacteria 483129
193 Ga0209455_1000082 3300025272 Bacteria 257909
194 Ga0209455_1000088 3300025272 Bacteria 238787
195 Ga0209455_1010397 3300025272 Bacteria 2368
196 Ga0209758_1005240 3300025297 Bacteria 10158
197 Ga0207647_10006001 3300025904 Bacteria 8850
198 Ga0207647_10006719 3300025904 Bacteria 8351
199 Ga0207705_10008157 3300025909 Bacteria 7669
200 Ga0207654_10093148 3300025911 Bacteria 1841
201 Ga0207707_10164449 3300025912 Bacteria 1939
202 Ga0207695_10005651 3300025913 Bacteria 16501
203 Ga0207695_10015963 3300025913 Bacteria 8815
204 Ga0207695_10017386 3300025913 Bacteria 8367
205 Ga0207695_10042408 3300025913 Bacteria 4860
206 Ga0207695_10402970 3300025913 Bacteria 1252
207 Ga0207671_10000021 3300025914 Bacteria 300409
208 Ga0207671_10000074 3300025914 Bacteria 156482
209 Ga0207671_10271724 3300025914 Bacteria 1335
210 Ga0207660_10082373 3300025917 Bacteria 2367
211 Ga0207657_10107836 3300025919 Bacteria 2303
212 Ga0207657_10130005 3300025919 Bacteria 2064
213 Ga0207657_10162614 3300025919 Bacteria 1813
214 Ga0207657_10368396 3300025919 Bacteria 1132
215 Ga0207649_10016099 3300025920 Bacteria 4211
216 Ga0207694_10213209 3300025924 Bacteria 1573
217 Ga0207694_10377509 3300025924 Bacteria 1176
218 Ga0207694_10416113 3300025924 Bacteria 1119
219 Ga0207700_10006249 3300025928 Bacteria 7184
220 Ga0207664_10000066 3300025929 Bacteria 109573
221 Ga0207664_10000315 3300025929 Bacteria 36069
222 Ga0207664_10744324 3300025929 Bacteria 881
223 Ga0207690_10004293 3300025932 Bacteria 8411
224 Ga0207690_10012344 3300025932 Bacteria 5110
225 Ga0207690_10114807 3300025932 Bacteria 1945
226 Ga0207706_10017342 3300025933 Bacteria 6486
227 Ga0207706_10195663 3300025933 Bacteria 1774
228 Ga0207706_10355319 3300025933 Bacteria 1274
229 Ga0207670_10001715 3300025936 Bacteria 11438
230 Ga0207667_10000141 3300025949 Bacteria 109666
231 Ga0207667_10001686 3300025949 Bacteria 27833
232 Ga0207667_10022326 3300025949 Bacteria 6992
233 Ga0207640_10005354 3300025981 Bacteria 6996
234 Ga0207640_10012031 3300025981 Bacteria 4918
235 Ga0207640_10255295 3300025981 Bacteria 1363
236 Ga0207639_10063648 3300026041 Bacteria 2857
237 Ga0207639_10305497 3300026041 Bacteria 1408
238 Ga0207678_10001930 3300026067 Bacteria 18917
239 Ga0207678_10098268 3300026067 Bacteria 2501
240 Ga0207702_10000644 3300026078 Bacteria 38190
241 Ga0207674_10000168 3300026116 Bacteria 78785
242 Ga0207674_10182013 3300026116 Bacteria 2053
243 Ga0268264_10287619 3300028381 Bacteria 1542
244 Ga0265340_10142311 3300031247 Unclassified 1096
245 Ga0307516_10269343 3300031730 Bacteria 1390
246 Ga0307414_10134537 3300032004 Bacteria 1925
247 Ga0395899_0000068 3300037312 Bacteria 202264
248 Ga0395899_0003472 3300037312 Bacteria 12490
249 Ga0395900_0000012 3300037418 Bacteria 401198
250 Ga0395900_0084262 3300037418 Bacteria 3266
251 Ga0395898_0000144 3300037466 Bacteria 187889
252 Ga0395898_0000278 3300037466 Bacteria 124490
253 Ga0395898_1327594 3300037466 Bacteria 648
254 Ga0395901_0001173 3300038443 Bacteria 27860
255 Ga0395901_0323462 3300038443 Bacteria 1595
256 Ga0436361_0755138 3300039447 Bacteria 1043
257 Ga0451793_1877366 3300041452 Bacteria 1509
258 Ga0451853_1577216 3300041512 Bacteria 596
259 Ga0439437_012721 3300042000 Bacteria 974
260 Ga0439448_0138534 3300042005 Bacteria 841
261 Ga0466988_0131779 3300044536 Bacteria 1466
262 Ga0466969_0000538 3300044656 Bacteria 20767
263 Ga0466969_0017506 3300044656 Bacteria 3739
264 Ga0466969_0055681 3300044656 Bacteria 1933
265 Ga0466972_0181250 3300044658 Bacteria 987
266 Ga0466982_0000004 3300044672 Bacteria 386724
267 Ga0466965_0010378 3300044683 Bacteria 4344
268 Ga0466965_0344206 3300044683 Bacteria 815
269 Ga0466966_0003574 3300044684 Bacteria 10260
270 Ga0466966_0005847 3300044684 Bacteria 8109
271 Ga0466961_0015318 3300044693 Bacteria 4924
272 Ga0466961_0034067 3300044693 Bacteria 3270
273 Ga0466963_0736767 3300044694 Bacteria 695
274 Ga0466964_0058382 3300044706 Bacteria 1599
275 Ga0466964_0073804 3300044706 Bacteria 1449
276 Ga0466971_0003256 3300044719 Bacteria 6927
277 Ga0466971_0019109 3300044719 Bacteria 3041
278 Ga0466971_0027097 3300044719 Bacteria 2565
279 Ga0466968_0243922 3300044735 Bacteria 851
280 Ga0466970_0013242 3300044765 Bacteria 4227
281 Ga0466970_0037021 3300044765 Bacteria 2585
282 Ga0466970_0092781 3300044765 Bacteria 1640
283 Ga0466957_0002918 3300044842 Bacteria 9264
284 Ga0466957_0008967 3300044842 Bacteria 5702
285 Ga0466960_0007681 3300044901 Bacteria 4391
286 Ga0466959_0000204 3300045049 Bacteria 38407
287 Ga0466959_0009505 3300045049 Bacteria 6918
288 Ga0466959_0033034 3300045049 Bacteria 3828
289 Ga0466958_0013023 3300045836 Bacteria 4725
290 Ga0466958_0038045 3300045836 Bacteria 2885
291 Ga0466958_0319713 3300045836 Bacteria 997
292 Ga0466967_0145910 3300045976 Bacteria 2208
293 Ga0495638_0000007 3300046460 Bacteria 602783
294 Ga0495638_0000343 3300046460 Bacteria 58771
295 Ga0495638_0005670 3300046460 Bacteria 9198
296 Ga0495650_0000078 3300046471 Bacteria 245487
297 Ga0495606_0000242 3300046507 Bacteria 96491
298 Ga0495606_0015919 3300046507 Bacteria 5767
299 Ga0495631_0217566 3300046518 Bacteria 816
300 Ga0495597_0157985 3300046542 Bacteria 927
301 Ga0495622_0116978 3300046557 Bacteria 1218
302 Ga0495625_0355160 3300046660 Bacteria 925
303 Ga0495588_0170905 3300046674 Bacteria 1149
304 Ga0495649_0005342 3300046694 Bacteria 8196
305 Ga0495681_0079292 3300047470 Bacteria 1469
306 Ga0496104_1603930 3300048907 Bacteria 553
307 Ga0496108_0502612 3300048911 Bacteria 1059
308 Ga0496112_1738323 3300048915 Bacteria 536
309 Ga0496113_0005362 3300048916 Bacteria 7993
310 Ga0496114_0031218 3300048917 Bacteria 4383
311 Ga0496115_0000158 3300048918 Bacteria 63464
312 Ga0496115_0000177 3300048918 Bacteria 59539
313 Ga0496115_0070527 3300048918 Bacteria 2833
314 Ga0496115_0470912 3300048918 Bacteria 1012
315 Ga0496121_0074694 3300048924 Bacteria 2710
316 Ga0496121_0153138 3300048924 Bacteria 1694
317 Ga0496122_0158717 3300048925 Bacteria 1383
318 Ga0496123_0034574 3300048926 Bacteria 3617
319 Ga0496124_0000018 3300048927 Bacteria 442940
320 Ga0496125_0000517 3300048928 Bacteria 67165
321 Ga0496126_0012227 3300048929 Bacteria 8805
322 Ga0496126_0121963 3300048929 Bacteria 2259
323 Ga0496126_0159912 3300048929 Bacteria 1925
324 Ga0496126_0658420 3300048929 Bacteria 818
325 Ga0495682_0156794 3300049460 Bacteria 811
326 Ga0501032_0324943 3300049569 Bacteria 992
327 Ga0501033_0001185 3300049570 Bacteria 23529
328 Ga0501033_0434278 3300049570 Bacteria 913
329 Ga0501034_0004493 3300049571 Bacteria 15500
330 Ga0501036_0008195 3300049572 Bacteria 8565
331 Ga0501036_0309413 3300049572 Bacteria 1321
332 Ga0501037_0212686 3300049573 Bacteria 1363
333 Ga0501039_0774798 3300049575 Bacteria 749
334 Ga0501043_0167609 3300049579 Bacteria 1714
335 Ga0501043_0200613 3300049579 Bacteria 1548
336 Ga0501046_0119683 3300049580 Bacteria 2004
337 Ga0501046_0408153 3300049580 Bacteria 980
338 Ga0501047_0116423 3300049581 Bacteria 2554
339 Ga0501047_0660177 3300049581 Bacteria 865
340 Ga0501047_0835071 3300049581 Bacteria 735
341 Ga0501070_0001983 3300049586 Bacteria 18007
342 Ga0501077_0769662 3300049593 Bacteria 619
343 Ga0501080_0239872 3300049742 Bacteria 1655
344 Ga0501035_0043677 3300049822 Bacteria 4038
345 Ga0501035_0058432 3300049822 Bacteria 3436
346 Ga0501035_0107098 3300049822 Bacteria 2450
347 Ga0501035_0121014 3300049822 Bacteria 2288
348 Ga0501044_0039228 3300049823 Bacteria 4941
349 Ga0501044_0120077 3300049823 Bacteria 2630
350 Ga0501044_0148412 3300049823 Bacteria 2328
351 Ga0501044_0728146 3300049823 Bacteria 875
352 nmdc:mga00v17_38711_c1 3300050491 Bacteria 2853
353 Ga0500658_0116105 3300053134 Bacteria 1183
354 Ga0500627_0008393 3300053158 Bacteria 3667
355 Ga0466962_0001511 3300061719 Bacteria 10859
356 Ga0466962_0006237 3300061719 Bacteria 5725
357 Ga0466962_0226149 3300061719 Bacteria 917
358 2538833171 2537561836 Bacteria 3910579
359 2643908934 2643221579 Bacteria 4443405
360 2643915492 2643221581 Bacteria 3893603
361 2739730383 2739367700 Bacteria 4747630
362 2842781327 2842780639 Bacteria 4337790
363 2895397060 2895395659 Bacteria 3983269
364 2939614143 2939611941 Bacteria 3892017
365 8002872690 8002869464 Bacteria 3588529
366 8021626008 8021622325 Bacteria 4844743
367 8021651747 8021648035 Bacteria 4772378
368 Ga0157376_10030620
369 JGI24740J21852_10022400
370 JGI24739J22299_10000089
371 JGI24735J21928_10002530
372 JGI25156J39149_1001534
373 JGI25156J39149_1001864
374 JGI25156J39149_1002490
375 JGI25162J39368_1000057
376 JGI25162J39368_1000338
377 JGI25154J39366_1006259
378 JGI25157J39369_1000182
379 JGI25157J39369_1001918
380 JGI25157J39369_1007373
381 JGI25164J39214_1000032
382 JGI25164J39214_1000043
383 JGI25164J39214_1001119
384 JGI25164J39214_1013601
385 JGI25165J46597_1000113
386 JGI25165J46597_1000136
387 JGI25165J46597_1002037
388 rootH1_10132142
389 rootH1_10166365
390 Ga0006562J51391_1011821
391 Ga0055538_1001003
392 Ga0055533_1000782
393 Ga0055525_1000164
394 Ga0055527_1000065
395 Ga0055527_1000317
396 Ga0055527_1002917
397 Ga0055527_1003327
398 Ga0055535_1000043
399 Ga0055535_1000690
400 Ga0055535_1000754
401 Ga0055535_1001562
402 Ga0055542_1000067
403 Ga0055542_1000072
404 Ga0055542_1000140
405 Ga0055542_1000224
406 Ga0055542_1001528
407 Ga0055529_1000339
408 Ga0055529_1000451
409 Ga0055529_1000822
410 Ga0055529_1002055
411 Ga0065165_1013513
412 Ga0065715_10137965
413 Ga0070683_100597717
414 Ga0070680_100381121
415 Ga0070682_100178658
416 Ga0070660_100015685
417 Ga0070660_100228905
418 Ga0070689_100001462
419 Ga0070661_100007538
420 Ga0070661_100062948
421 Ga0070688_100028808
422 Ga0070659_100006933
423 Ga0070659_100133111
424 Ga0070659_100211253
425 Ga0070659_100213328
426 Ga0070659_100753843
427 Ga0070714_100000088
428 Ga0070714_100002264
429 Ga0070713_100006101
430 Ga0070694_100163371
431 Ga0070663_100003752
432 Ga0070663_100818827
433 Ga0070662_100151164
434 Ga0070662_100588615
435 Ga0070681_10117473
436 Ga0070681_10191046
437 Ga0070685_10015608
438 Ga0070679_100017411
439 Ga0068853_100082525
440 Ga0068853_100253872
441 Ga0068853_100943368
442 Ga0070696_100026950
443 Ga0070696_100313841
444 Ga0070693_100001999
445 Ga0070693_100291276
446 Ga0068855_100037446
447 Ga0068855_100160142
448 Ga0068855_100214682
449 Ga0068857_100004412
450 Ga0068857_100112428
451 Ga0068857_100414105
452 Ga0068854_100007475
453 Ga0068854_100147198
454 Ga0068854_100155724
455 Ga0068854_100746509
456 Ga0068856_100000447
457 Ga0068856_100116668
458 Ga0068852_100121517
459 Ga0068859_100497687
460 Ga0068851_10056948
461 Ga0068858_100480092
462 Ga0068860_100430450
463 Ga0068862_100035072
464 Ga0075364_10067670
465 Ga0097620_100497741
466 Ga0105240_10019235
467 Ga0105240_10065905
468 Ga0105240_10128740
469 Ga0105240_10185474
470 Ga0105240_10429365
471 Ga0105241_10245941
472 Ga0105237_10000007
473 Ga0105237_10000063
474 Ga0105237_10421291
475 Ga0105238_10140924
476 Ga0105238_10317843
477 Ga0105238_10982216
478 Ga0105238_11126064
479 Ga0157314_1000730
480 Ga0157347_1024315
481 Ga0157373_10014081
482 Ga0157373_10103514
483 Ga0157373_10191560
484 Ga0157373_10505280
485 Ga0157371_10010685
486 Ga0157371_10236462
487 Ga0157371_10394269
488 Ga0157370_10002036
489 Ga0157370_10004621
490 Ga0157370_10026436
491 Ga0157370_11792214
492 Ga0157369_10070852
493 Ga0157369_10518763
494 Ga0163162_10043913
495 Ga0157372_10126650
496 Ga0157372_10266920
497 Ga0157372_10311548
498 Ga0157372_10600585
499 Ga0157372_10674915
500 Ga0182008_10048730
501 Ga0182006_1145095
502 Ga0182007_10012840
503 Ga0183369_1007
504 Ga0183368_1002
505 Ga0183361_15013
506 Ga0206356_10569860
507 Ga0206353_10004922
508 Ga0209435_103523
509 Ga0209760_103980
510 Ga0209784_100073
511 Ga0209566_101719
512 Ga0209674_100043
513 Ga0209674_100678
514 Ga0209672_100049
515 Ga0209672_100058
516 Ga0209672_101032
517 Ga0209672_101104
518 Ga0209563_100051
519 Ga0207427_100013
520 Ga0207427_100069
521 Ga0207427_100081
522 Ga0207427_100224
523 Ga0207427_102570
524 Ga0209437_100015
525 Ga0209437_100168
526 Ga0209437_100273
527 Ga0209437_100287
528 Ga0209437_102587
529 Ga0209258_100049
530 Ga0209258_100087
531 Ga0209258_100149
532 Ga0209258_100164
533 Ga0209258_100551
534 Ga0209646_1000393
535 Ga0209646_1001743
536 Ga0209646_1004069
537 Ga0209646_1006511
538 Ga0209026_1000060
539 Ga0209026_1000094
540 Ga0209026_1000145
541 Ga0209026_1000866
542 Ga0209026_1001725
543 Ga0209026_1001959
544 Ga0209148_1000002
545 Ga0209148_1000010
546 Ga0209148_1000039
547 Ga0209148_1000096
548 Ga0209148_1000143
549 Ga0209759_1000249
550 Ga0209759_1000295
551 Ga0209759_1000761
552 Ga0209759_1003734
553 Ga0209759_1009407
554 Ga0209129_1010470
555 Ga0209233_1000009
556 Ga0209233_1000083
557 Ga0209233_1000092
558 Ga0209233_1000151
559 Ga0209455_1000034
560 Ga0209455_1000082
561 Ga0209455_1000088
562 Ga0209455_1010397
563 Ga0209758_1005240
564 Ga0207647_10006001
565 Ga0207647_10006719
566 Ga0207705_10008157
567 Ga0207654_10093148
568 Ga0207707_10164449
569 Ga0207695_10005651
570 Ga0207695_10015963
571 Ga0207695_10017386
572 Ga0207695_10042408
573 Ga0207695_10402970
574 Ga0207671_10000021
575 Ga0207671_10000074
576 Ga0207671_10271724
577 Ga0207660_10082373
578 Ga0207657_10107836
579 Ga0207657_10130005
580 Ga0207657_10162614
581 Ga0207657_10368396
582 Ga0207649_10016099
583 Ga0207694_10213209
584 Ga0207694_10377509
585 Ga0207694_10416113
586 Ga0207700_10006249
587 Ga0207664_10000066
588 Ga0207664_10000315
589 Ga0207664_10744324
590 Ga0207690_10004293
591 Ga0207690_10012344
592 Ga0207690_10114807
593 Ga0207706_10017342
594 Ga0207706_10195663
595 Ga0207706_10355319
596 Ga0207670_10001715
597 Ga0207667_10000141
598 Ga0207667_10001686
599 Ga0207667_10022326
600 Ga0207640_10005354
601 Ga0207640_10012031
602 Ga0207640_10255295
603 Ga0207639_10063648
604 Ga0207639_10305497
605 Ga0207678_10001930
606 Ga0207678_10098268
607 Ga0207702_10000644
608 Ga0207674_10000168
609 Ga0207674_10182013
610 Ga0268264_10287619
611 Ga0265340_10142311
612 Ga0307516_10269343
613 Ga0307414_10134537
614 Ga0395899_0000068
615 Ga0395899_0003472
616 Ga0395900_0000012
617 Ga0395900_0084262
618 Ga0395898_0000144
619 Ga0395898_0000278
620 Ga0395898_1327594
621 Ga0395901_0001173
622 Ga0395901_0323462
623 Ga0436361_0755138
624 Ga0451793_1877366
625 Ga0451853_1577216
626 Ga0439437_012721
627 Ga0439448_0138534
628 Ga0466988_0131779
629 Ga0466969_0000538
630 Ga0466969_0017506
631 Ga0466969_0055681
632 Ga0466972_0181250
633 Ga0466982_0000004
634 Ga0466965_0010378
635 Ga0466965_0344206
636 Ga0466966_0003574
637 Ga0466966_0005847
638 Ga0466961_0015318
639 Ga0466961_0034067
640 Ga0466963_0736767
641 Ga0466964_0058382
642 Ga0466964_0073804
643 Ga0466971_0003256
644 Ga0466971_0019109
645 Ga0466971_0027097
646 Ga0466968_0243922
647 Ga0466970_0013242
648 Ga0466970_0037021
649 Ga0466970_0092781
650 Ga0466957_0002918
651 Ga0466957_0008967
652 Ga0466960_0007681
653 Ga0466959_0000204
654 Ga0466959_0009505
655 Ga0466959_0033034
656 Ga0466958_0013023
657 Ga0466958_0038045
658 Ga0466958_0319713
659 Ga0466967_0145910
660 Ga0495638_0000007
661 Ga0495638_0000343
662 Ga0495638_0005670
663 Ga0495650_0000078
664 Ga0495606_0000242
665 Ga0495606_0015919
666 Ga0495631_0217566
667 Ga0495597_0157985
668 Ga0495622_0116978
669 Ga0495625_0355160
670 Ga0495588_0170905
671 Ga0495649_0005342
672 Ga0495681_0079292
673 Ga0496104_1603930
674 Ga0496108_0502612
675 Ga0496112_1738323
676 Ga0496113_0005362
677 Ga0496114_0031218
678 Ga0496115_0000158
679 Ga0496115_0000177
680 Ga0496115_0070527
681 Ga0496115_0470912
682 Ga0496121_0074694
683 Ga0496121_0153138
684 Ga0496122_0158717
685 Ga0496123_0034574
686 Ga0496124_0000018
687 Ga0496125_0000517
688 Ga0496126_0012227
689 Ga0496126_0121963
690 Ga0496126_0159912
691 Ga0496126_0658420
692 Ga0495682_0156794
693 Ga0501032_0324943
694 Ga0501033_0001185
695 Ga0501033_0434278
696 Ga0501034_0004493
697 Ga0501036_0008195
698 Ga0501036_0309413
699 Ga0501037_0212686
700 Ga0501039_0774798
701 Ga0501043_0167609
702 Ga0501043_0200613
703 Ga0501046_0119683
704 Ga0501046_0408153
705 Ga0501047_0116423
706 Ga0501047_0660177
707 Ga0501047_0835071
708 Ga0501070_0001983
709 Ga0501077_0769662
710 Ga0501080_0239872
711 Ga0501035_0043677
712 Ga0501035_0058432
713 Ga0501035_0107098
714 Ga0501035_0121014
715 Ga0501044_0039228
716 Ga0501044_0120077
717 Ga0501044_0148412
718 Ga0501044_0728146
719 nmdc:mga00v17_38711_c1
720 Ga0500658_0116105
721 Ga0500627_0008393
722 Ga0466962_0001511
723 Ga0466962_0006237
724 Ga0466962_0226149
725 2538833171
726 2643908934
727 2643915492
728 2739730383
729 2842781327
730 2895397060
731 2939614143
732 8002872690
733 8021626008
734 8021651747

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fex-assembly2.cif.gz_C-2 the crystal structure of dj-1 superfamily protein atu0886 from agrobacterium tumefaciens 0.5269 49 87
4q5g-assembly1.cif.gz_A-2 crystal structure of mouse serum amyloid a3 0.421 93 162
2h1j-assembly2.cif.gz_B 3.1 a x-ray structure of putative oligoendopeptidase f: crystals grown by microfluidic seeding 0.4108 19 127
7l7f-assembly1.cif.gz_D cryo-em structure of human ace2 receptor bound to protein encoded by vaccine candidate bnt162b1 0.3469 19 155
1npc-assembly1.cif.gz_A the structure of neutral protease from bacillus cereus at 0.2-nm resolution 0.3442 50 166
ID Description Score Start End Superfamily
af_A1ZAW0_568_674_3.30.160.380 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Dicer dimerisation domain 0.7625 144 164 3.30.160.380
af_Q2FXE0_43_154_1.10.10.2910 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.6829 23 78 1.10.10.2910
af_Q09884_534_629_3.30.160.380 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Dicer dimerisation domain 0.5906 135 165 3.30.160.380
af_Q5BJS0_244_335_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.5777 131 165 3.30.160.20
2fexA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.5234 49 87 3.40.50.880
ID Description Score Start End GO Terms
AF-F0BGA3-F1-model_v4 IrrE N-terminal-like domain-containing protein 0.9996 11 156
AF-A0A0G9H6P7-F1-model_v4 IrrE N-terminal-like domain-containing protein 0.9987 11 166
AF-B0RY64-F1-model_v4 ImmA/IrrE family metallo-endopeptidase 0.9983 9 156
AF-A0A3S0PFY5-F1-model_v4 ImmA/IrrE family metallo-endopeptidase 0.9977 22 164
AF-A0A2W6VXR7-F1-model_v4 Uncharacterized protein 0.9977 11 157

Map