F424373

General Info

Members Datasets Scaffolds Average Seq Length
367 189 367 139

Family's Representative Sequence

Representative Sequence 3300025924|Ga0207694_10563255|Ga0207694_105632552
Length 169
Sequence MLMPRKVKHRKQHRGRLKGNATGGMELSFGEYGIQALDPGWITARQIEAARIAMTRHIKRGGKVWINVFPDKPVTEKPAETRMGSGKGNPERWVAVVKPGRILFELSYSDPVIARQAIDRAKVDYRDVLAPAEYPRYTQFGFRARRLRSGVRQQIFSDDWQQYERWLKR

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
3 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
24 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
81 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
82 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
83 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
84 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
85 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
86 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
87 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
94 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
95 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
96 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
100 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
101 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
102 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
103 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
104 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
105 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
106 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
107 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
108 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
109 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
110 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
111 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
112 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
113 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
114 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
115 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
116 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
119 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
120 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
121 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
122 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
123 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
124 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
125 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
126 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
127 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
134 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
135 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
136 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
152 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
153 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
154 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
155 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
156 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
157 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
158 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
159 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
160 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
161 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
162 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
163 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
164 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
165 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
166 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
169 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
170 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
171 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
172 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
173 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
176 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
180 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
181 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
182 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
183 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
184 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
189 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.09
Metatranscriptomes 1.91
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.27
Nodule 0
Rhizoplane 5.72
Rhizosphere 85.83
Stem 0
Stem Tuber 0
Unclassified 2.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100072291 3300005331 Bacteria 2962
2 Ga0070670_100308982 3300005331 Bacteria 1384
3 Ga0070682_100421436 3300005337 Bacteria 1015
4 Ga0070692_10771600 3300005345 Bacteria 654
5 Ga0070668_100099742 3300005347 Bacteria 2300
6 Ga0070668_101501911 3300005347 Bacteria 616
7 Ga0070675_100145203 3300005354 Bacteria 2031
8 Ga0070675_100331669 3300005354 Bacteria 1346
9 Ga0070675_101028433 3300005354 Bacteria 757
10 Ga0070671_100054471 3300005355 Bacteria 3326
11 Ga0070714_100282882 3300005435 Bacteria 1542
12 Ga0070711_100998811 3300005439 Bacteria 718
13 Ga0070700_100885467 3300005441 Bacteria 726
14 Ga0070708_100013384 3300005445 Bacteria 6714
15 Ga0070678_100909357 3300005456 Bacteria 805
16 Ga0070678_101168521 3300005456 Bacteria 713
17 Ga0070681_11170099 3300005458 Bacteria 691
18 Ga0068867_101080123 3300005459 Bacteria 732
19 Ga0070706_100009462 3300005467 Bacteria 9064
20 Ga0070707_102021496 3300005468 Bacteria 544
21 Ga0070672_100952255 3300005543 Bacteria 760
22 Ga0070686_101855949 3300005544 Bacteria 514
23 Ga0070665_100508646 3300005548 Bacteria 1216
24 Ga0070664_101562395 3300005564 Bacteria 625
25 Ga0068864_100372994 3300005618 Bacteria 1351
26 Ga0068864_100544882 3300005618 Bacteria 1121
27 Ga0068864_102408460 3300005618 Bacteria 533
28 Ga0068861_100172911 3300005719 Bacteria 1792
29 Ga0068861_100909766 3300005719 Bacteria 834
30 Ga0068861_101533540 3300005719 Bacteria 655
31 Ga0068861_102491225 3300005719 Bacteria 521
32 Ga0068858_100032644 3300005842 Bacteria 4834
33 Ga0081538_10004878 3300005981 Bacteria 12213
34 Ga0081538_10012203 3300005981 Bacteria 6904
35 Ga0081540_1276518 3300005983 Bacteria 580
36 Ga0081539_10246336 3300005985 Bacteria 797
37 Ga0075365_10356734 3300006038 Bacteria 1031
38 Ga0075365_10638301 3300006038 Bacteria 753
39 Ga0075363_100378451 3300006048 Bacteria 830
40 Ga0075364_10003025 3300006051 Bacteria 9498
41 Ga0075364_10008896 3300006051 Bacteria 6014
42 Ga0075362_10024835 3300006177 Bacteria 2545
43 Ga0075367_10018520 3300006178 Bacteria 3844
44 Ga0075367_10073940 3300006178 Bacteria 2055
45 Ga0075366_10140134 3300006195 Bacteria 1462
46 Ga0075370_10359185 3300006353 Bacteria 871
47 Ga0075428_100173727 3300006844 Bacteria 2334
48 Ga0075430_100006208 3300006846 Bacteria 10075
49 Ga0075431_100021250 3300006847 Bacteria 6633
50 Ga0075431_101246716 3300006847 Bacteria 705
51 Ga0075429_100001166 3300006880 Bacteria 21212
52 Ga0111539_10092465 3300009094 Bacteria 3555
53 Ga0111539_10713719 3300009094 Bacteria 1167
54 Ga0105245_10008148 3300009098 Bacteria 9165
55 Ga0105245_12513199 3300009098 Bacteria 568
56 Ga0114129_10039268 3300009147 Bacteria 6674
57 Ga0114129_10339295 3300009147 Bacteria 1993
58 Ga0114129_10746943 3300009147 Bacteria 1253
59 Ga0114129_11213673 3300009147 Bacteria 939
60 Ga0105243_11264417 3300009148 Bacteria 754
61 Ga0105243_11353155 3300009148 Bacteria 731
62 Ga0105241_10133236 3300009174 Bacteria 2014
63 Ga0105242_10026961 3300009176 Bacteria 4557
64 Ga0105248_10648331 3300009177 Bacteria 1191
65 Ga0105237_11495490 3300009545 Bacteria 682
66 Ga0105249_10032898 3300009553 Bacteria 4693
67 Ga0105239_11129550 3300010375 Bacteria 902
68 Ga0105246_10333189 3300011119 Bacteria 1238
69 Ga0105246_11193365 3300011119 Bacteria 700
70 Ga0157373_11281200 3300013100 Bacteria 554
71 Ga0157371_10325298 3300013102 Bacteria 1116
72 Ga0157378_10305298 3300013297 Bacteria 1541
73 Ga0157378_10518648 3300013297 Bacteria 1193
74 Ga0163162_10197074 3300013306 Bacteria 2143
75 Ga0163162_10628599 3300013306 Bacteria 1198
76 Ga0163162_11514103 3300013306 Bacteria 764
77 Ga0157375_10064497 3300013308 Bacteria 3647
78 Ga0157375_10692711 3300013308 Bacteria 1173
79 Ga0157380_10418337 3300014326 Bacteria 1277
80 Ga0157380_10834218 3300014326 Bacteria 942
81 Ga0157377_10335667 3300014745 Bacteria 1009
82 Ga0157379_10074891 3300014968 Bacteria 3030
83 Ga0157379_10315338 3300014968 Bacteria 1427
84 Ga0157376_10655959 3300014969 Bacteria 1050
85 Ga0157376_11247708 3300014969 Bacteria 772
86 Ga0163161_10278729 3300017792 Bacteria 1311
87 Ga0206356_11820259 3300020070 Bacteria 1110
88 Ga0206354_10894703 3300020081 Bacteria 1008
89 Ga0207645_10450858 3300025907 Bacteria 868
90 Ga0207684_10018731 3300025910 Bacteria 5924
91 Ga0207654_10214708 3300025911 Bacteria 1273
92 Ga0207681_10302102 3300025923 Bacteria 1267
93 Ga0207694_10563255 3300025924 Bacteria 957
94 Ga0207659_10179893 3300025926 Bacteria 1675
95 Ga0207687_10132055 3300025927 Bacteria 1884
96 Ga0207664_10150730 3300025929 Bacteria 1975
97 Ga0207670_10264338 3300025936 Bacteria 1335
98 Ga0207704_10988842 3300025938 Bacteria 711
99 Ga0207689_10433887 3300025942 Bacteria 1097
100 Ga0207651_10353150 3300025960 Bacteria 1239
101 Ga0207651_10678770 3300025960 Bacteria 906
102 Ga0207712_10099690 3300025961 Bacteria 2157
103 Ga0207712_10577536 3300025961 Bacteria 970
104 Ga0207668_10287542 3300025972 Bacteria 1351
105 Ga0207668_10773314 3300025972 Bacteria 848
106 Ga0207703_10628079 3300026035 Bacteria 1018
107 Ga0207708_10224425 3300026075 Bacteria 1506
108 Ga0207648_10417354 3300026089 Bacteria 1218
109 Ga0207648_10997705 3300026089 Bacteria 784
110 Ga0207648_11863315 3300026089 Bacteria 563
111 Ga0207676_10500508 3300026095 Bacteria 1154
112 Ga0207675_100292827 3300026118 Bacteria 1584
113 Ga0207675_100477854 3300026118 Bacteria 1238
114 Ga0207675_100736227 3300026118 Bacteria 997
115 Ga0207683_10839345 3300026121 Bacteria 853
116 Ga0209813_10138387 3300027866 Bacteria 862
117 Ga0207428_10013861 3300027907 Bacteria 7022
118 Ga0265338_10058404 3300028800 Bacteria 3405
119 Ga0265327_10059607 3300031251 Bacteria 1954
120 Ga0307413_10137773 3300031824 Bacteria 1681
121 Ga0307413_11763774 3300031824 Bacteria 553
122 Ga0307410_10058772 3300031852 Bacteria 2623
123 Ga0307406_11480252 3300031901 Bacteria 597
124 Ga0307407_11459331 3300031903 Bacteria 540
125 Ga0307409_100088306 3300031995 Bacteria 2530
126 Ga0307416_100059107 3300032002 Bacteria 3113
127 Ga0307416_100993020 3300032002 Bacteria 942
128 Ga0307416_101556228 3300032002 Bacteria 767
129 Ga0307411_10013103 3300032005 Bacteria 4558
130 Ga0307415_100114281 3300032126 Bacteria 2009
131 Ga0307415_100991016 3300032126 Bacteria 780
132 Ga0316593_10029545 3300032168 Bacteria 1774
133 Ga0373949_0196101 3300035090 Bacteria 604
134 Ga0373955_0835980 3300035172 Bacteria 566
135 Ga0316574_0019582 3300035398 Bacteria 3994
136 Ga0316574_0100364 3300035398 Bacteria 1852
137 Ga0373931_0118785 3300035691 Bacteria 1509
138 Ga0373937_0367355 3300036401 Bacteria 1364
139 Ga0395905_0455215 3300037471 Bacteria 1178
140 Ga0400483_039045 3300039062 Bacteria 1495
141 Ga0400483_217638 3300039062 Bacteria 24445
142 Ga0436365_0457109 3300039437 Bacteria 556
143 Ga0436365_1349538 3300039437 Bacteria 11547
144 Ga0436363_0590906 3300039450 Bacteria 1137
145 Ga0451791_0430095 3300041451 Bacteria 529
146 Ga0451802_2189947 3300041460 Bacteria 606
147 Ga0451837_0831887 3300041494 Bacteria 2631
148 Ga0451849_0096465 3300041505 Bacteria 939
149 Ga0451843_1731555 3300041509 Bacteria 1421
150 Ga0439463_040859 3300042016 Bacteria 1179
151 Ga0439435_0042842 3300042436 Bacteria 1272
152 Ga0451577_0842467 3300042876 Bacteria 827
153 Ga0453683_0054837 3300044673 Bacteria 2495
154 Ga0466966_0270060 3300044684 Bacteria 1023
155 Ga0466961_0101230 3300044693 Bacteria 1815
156 Ga0453684_0044776 3300044712 Bacteria 5915
157 Ga0466960_0066880 3300044901 Bacteria 1778
158 Ga0466959_0048982 3300045049 Bacteria 3104
159 Ga0451576_0020503 3300045051 Bacteria 7196
160 Ga0466967_0725384 3300045976 Bacteria 985
161 Ga0466967_0888325 3300045976 Bacteria 886
162 Ga0495618_0558682 3300046514 Bacteria 685
163 Ga0495621_0004585 3300046539 Bacteria 3902
164 Ga0495668_0604875 3300046616 Bacteria 606
165 Ga0495668_0777216 3300046616 Bacteria 530
166 Ga0495634_0198626 3300046642 Bacteria 1247
167 Ga0495647_0189863 3300046681 Bacteria 897
168 Ga0495658_1091228 3300046683 Bacteria 509
169 Ga0495676_0304058 3300047321 Bacteria 1075
170 Ga0495686_0671707 3300047472 Bacteria 531
171 Ga0495614_0007043 3300048089 Bacteria 5022
172 Ga0495614_0149505 3300048089 Bacteria 1041
173 Ga0496102_0080016 3300048905 Bacteria 3010
174 Ga0496102_0629520 3300048905 Bacteria 996
175 Ga0496102_0697512 3300048905 Bacteria 938
176 Ga0496104_0257011 3300048907 Bacteria 1660
177 Ga0496106_1053607 3300048909 Bacteria 638
178 Ga0496108_0367131 3300048911 Bacteria 1257
179 Ga0496108_0546924 3300048911 Bacteria 1010
180 Ga0496108_1360180 3300048911 Bacteria 595
181 Ga0496109_0220667 3300048912 Bacteria 1783
182 Ga0496109_1774313 3300048912 Bacteria 550
183 Ga0496109_2033325 3300048912 Bacteria 506
184 Ga0496110_0146540 3300048913 Bacteria 2136
185 Ga0496110_0216850 3300048913 Bacteria 1740
186 Ga0496110_0440560 3300048913 Bacteria 1187
187 Ga0496110_1662257 3300048913 Bacteria 549
188 Ga0496111_0085941 3300048914 Bacteria 2301
189 Ga0496111_0264148 3300048914 Bacteria 1277
190 Ga0496113_0238147 3300048916 Bacteria 1452
191 Ga0496114_0758720 3300048917 Bacteria 848
192 Ga0501031_0002118 3300049568 Bacteria 12520
193 Ga0501031_0028511 3300049568 Bacteria 3639
194 Ga0501031_0072221 3300049568 Bacteria 2247
195 Ga0501031_0386141 3300049568 Bacteria 906
196 Ga0501032_0002622 3300049569 Bacteria 14061
197 Ga0501032_0004421 3300049569 Bacteria 10604
198 Ga0501032_0015820 3300049569 Bacteria 5319
199 Ga0501033_0003063 3300049570 Bacteria 13899
200 Ga0501033_0066505 3300049570 Bacteria 2650
201 Ga0501034_0003206 3300049571 Bacteria 18765
202 Ga0501034_0010612 3300049571 Bacteria 9586
203 Ga0501034_0016208 3300049571 Bacteria 7645
204 Ga0501034_0030403 3300049571 Bacteria 5490
205 Ga0501034_0074913 3300049571 Bacteria 3392
206 Ga0501034_0157858 3300049571 Bacteria 2241
207 Ga0501034_0244576 3300049571 Bacteria 1739
208 Ga0501036_0003710 3300049572 Bacteria 12240
209 Ga0501036_0016080 3300049572 Bacteria 6252
210 Ga0501036_0209144 3300049572 Bacteria 1639
211 Ga0501037_0003123 3300049573 Bacteria 12009
212 Ga0501037_0010809 3300049573 Bacteria 6708
213 Ga0501037_0101513 3300049573 Bacteria 2076
214 Ga0501037_0151733 3300049573 Bacteria 1655
215 Ga0501038_0012658 3300049574 Bacteria 7710
216 Ga0501038_0028598 3300049574 Bacteria 4951
217 Ga0501038_0041638 3300049574 Bacteria 4005
218 Ga0501038_0051794 3300049574 Bacteria 3540
219 Ga0501038_0213019 3300049574 Bacteria 1544
220 Ga0501038_0562994 3300049574 Bacteria 866
221 Ga0501039_0007612 3300049575 Bacteria 8273
222 Ga0501039_0015250 3300049575 Bacteria 5881
223 Ga0501039_0221448 3300049575 Bacteria 1488
224 Ga0501039_1017332 3300049575 Bacteria 643
225 Ga0501040_0011866 3300049576 Bacteria 5701
226 Ga0501040_0022843 3300049576 Bacteria 4190
227 Ga0501040_0031214 3300049576 Bacteria 3598
228 Ga0501040_0160008 3300049576 Bacteria 1591
229 Ga0501041_0001188 3300049577 Bacteria 14191
230 Ga0501041_0001660 3300049577 Bacteria 12450
231 Ga0501041_0203771 3300049577 Bacteria 1240
232 Ga0501042_0009997 3300049578 Bacteria 6343
233 Ga0501042_0034321 3300049578 Bacteria 3597
234 Ga0501043_0049602 3300049579 Bacteria 3300
235 Ga0501043_0077065 3300049579 Bacteria 2619
236 Ga0501043_0205396 3300049579 Bacteria 1527
237 Ga0501043_0469289 3300049579 Bacteria 943
238 Ga0501046_0004156 3300049580 Bacteria 13179
239 Ga0501046_0006809 3300049580 Bacteria 10086
240 Ga0501046_0217979 3300049580 Bacteria 1414
241 Ga0501047_0044597 3300049581 Bacteria 4285
242 Ga0501047_0064576 3300049581 Bacteria 3530
243 Ga0501048_0006265 3300049582 Bacteria 9047
244 Ga0501048_0026202 3300049582 Bacteria 4244
245 Ga0501048_0068237 3300049582 Bacteria 2512
246 Ga0501048_0184157 3300049582 Bacteria 1480
247 Ga0501067_0026623 3300049583 Bacteria 3202
248 Ga0501067_0055369 3300049583 Bacteria 2198
249 Ga0501067_0064839 3300049583 Bacteria 2022
250 Ga0501068_0003273 3300049584 Bacteria 8682
251 Ga0501068_0006337 3300049584 Bacteria 6518
252 Ga0501068_0010460 3300049584 Bacteria 5214
253 Ga0501069_0003229 3300049585 Bacteria 8360
254 Ga0501069_0005227 3300049585 Bacteria 6746
255 Ga0501069_0128775 3300049585 Bacteria 1448
256 Ga0501069_0330144 3300049585 Bacteria 897
257 Ga0501070_0000976 3300049586 Bacteria 25697
258 Ga0501070_0033676 3300049586 Bacteria 4287
259 Ga0501070_0044003 3300049586 Bacteria 3715
260 Ga0501070_0046845 3300049586 Bacteria 3596
261 Ga0501070_0142692 3300049586 Bacteria 1977
262 Ga0501071_0018161 3300049587 Bacteria 4864
263 Ga0501071_0034240 3300049587 Bacteria 3613
264 Ga0501071_0087843 3300049587 Bacteria 2281
265 Ga0501071_0179832 3300049587 Bacteria 1585
266 Ga0501071_0367171 3300049587 Bacteria 1096
267 Ga0501071_0384585 3300049587 Bacteria 1070
268 Ga0501072_0000404 3300049588 Bacteria 30870
269 Ga0501072_0005272 3300049588 Bacteria 9844
270 Ga0501072_0014321 3300049588 Bacteria 6078
271 Ga0501072_0015662 3300049588 Bacteria 5811
272 Ga0501072_0029187 3300049588 Bacteria 4306
273 Ga0501072_0068224 3300049588 Bacteria 2807
274 Ga0501072_0301203 3300049588 Bacteria 1274
275 Ga0501073_0004116 3300049589 Bacteria 10914
276 Ga0501073_0009591 3300049589 Bacteria 7139
277 Ga0501073_0021685 3300049589 Bacteria 4627
278 Ga0501073_0023426 3300049589 Bacteria 4433
279 Ga0501074_0002343 3300049590 Bacteria 13180
280 Ga0501074_0002634 3300049590 Bacteria 12568
281 Ga0501074_0039612 3300049590 Bacteria 3412
282 Ga0501074_0197214 3300049590 Bacteria 1435
283 Ga0501074_0611671 3300049590 Bacteria 770
284 Ga0501075_0001943 3300049591 Bacteria 13629
285 Ga0501075_0070735 3300049591 Bacteria 2636
286 Ga0501075_0175107 3300049591 Bacteria 1637
287 Ga0501076_0007602 3300049592 Bacteria 7891
288 Ga0501076_0008207 3300049592 Bacteria 7649
289 Ga0501076_0010290 3300049592 Bacteria 6933
290 Ga0501077_0001912 3300049593 Bacteria 12613
291 Ga0501077_0002204 3300049593 Bacteria 11750
292 Ga0501077_0006635 3300049593 Bacteria 7107
293 Ga0501077_0207683 3300049593 Bacteria 1244
294 Ga0501079_0000076 3300049741 Bacteria 46459
295 Ga0501079_0003409 3300049741 Bacteria 11673
296 Ga0501079_0043024 3300049741 Bacteria 3486
297 Ga0501079_0219509 3300049741 Bacteria 1485
298 Ga0501080_0016669 3300049742 Bacteria 6784
299 Ga0501080_0041881 3300049742 Bacteria 4265
300 Ga0501080_0054851 3300049742 Bacteria 3711
301 Ga0501080_0100018 3300049742 Bacteria 2690
302 Ga0501080_0234619 3300049742 Bacteria 1676
303 Ga0501080_0260676 3300049742 Bacteria 1579
304 Ga0501080_0292722 3300049742 Bacteria 1478
305 Ga0501081_0006383 3300049743 Bacteria 7649
306 Ga0501081_0021249 3300049743 Bacteria 4331
307 Ga0501081_0278802 3300049743 Bacteria 1223
308 Ga0501081_0794724 3300049743 Bacteria 712
309 Ga0501081_1356357 3300049743 Bacteria 539
310 Ga0501083_0000616 3300049744 Bacteria 22924
311 Ga0501083_0011542 3300049744 Bacteria 6196
312 Ga0501083_0013540 3300049744 Bacteria 5702
313 Ga0501083_0039064 3300049744 Bacteria 3224
314 Ga0501083_0076500 3300049744 Bacteria 2221
315 Ga0501035_0010773 3300049822 Bacteria 8466
316 Ga0501035_0066446 3300049822 Bacteria 3200
317 Ga0501035_0076906 3300049822 Bacteria 2950
318 Ga0501035_0519980 3300049822 Bacteria 978
319 Ga0501044_0005788 3300049823 Bacteria 13687
320 Ga0501044_0099507 3300049823 Bacteria 2926
321 Ga0501044_0302646 3300049823 Bacteria 1527
322 Ga0501045_0000077 3300049824 Bacteria 46550
323 Ga0501045_0002201 3300049824 Bacteria 13214
324 Ga0501045_0015318 3300049824 Bacteria 5443
325 Ga0501045_0065281 3300049824 Bacteria 2672
326 nmdc:mga03n38_43726_c1 3300050490 Bacteria 1964
327 nmdc:mga00v17_10759_c1 3300050491 Bacteria 5012
328 nmdc:mga00v17_296624_c1 3300050491 Bacteria 1050
329 nmdc:mga00v17_49407_c1 3300050491 Bacteria 2552
330 nmdc:mga0yw44_296981_c1 3300050492 Bacteria 1082
331 nmdc:mga0yw44_463066_c1 3300050492 Bacteria 859
332 nmdc:mga0yw44_533192_c1 3300050492 Bacteria 797
333 nmdc:mga0k408_86558_c1 3300050493 Bacteria 1839
334 nmdc:mga06z11_20149_c1 3300050494 Bacteria 3079
335 nmdc:mga06z11_56325_c1 3300050494 Bacteria 2033
336 nmdc:mga06z11_85308_c1 3300050494 Bacteria 1703
337 nmdc:mga05p37_1786356_c1 3300050507 Bacteria 594
338 nmdc:mga05p37_227564_c1 3300050507 Bacteria 2248
339 nmdc:mga05p37_585156_c1 3300050507 Bacteria 1263
340 nmdc:mga05p37_819372_c1 3300050507 Bacteria 1015
341 nmdc:mga09592_183_c1 3300050508 Bacteria 44709
342 nmdc:mga0qj67_5012_c1 3300050509 Bacteria 9622
343 nmdc:mga08y16_29130_c1 3300050511 Bacteria 5819
344 nmdc:mga08y16_844054_c1 3300050511 Bacteria 906
345 nmdc:mga08y16_953382_c1 3300050511 Bacteria 841
346 nmdc:mga0n895_2224983_c1 3300050512 Bacteria 503
347 Ga0495612_0334204 3300053078 Bacteria 683
348 Ga0495619_0516576 3300053085 Bacteria 821
349 Ga0500566_0000391 3300053094 Bacteria 24277
350 Ga0501084_0000125 3300054114 Bacteria 57691
351 Ga0501084_0003582 3300054114 Bacteria 12609
352 Ga0501084_0029240 3300054114 Bacteria 4609
353 Ga0501084_0056040 3300054114 Bacteria 3298
354 Ga0590075_023920 3300059424 Bacteria 1531
355 Ga0590075_135057 3300059424 Bacteria 648
356 Ga0587077_014462 3300059493 Bacteria 1299
357 Ga0587085_090915 3300059506 Bacteria 630
358 Ga0587088_051351 3300059508 Bacteria 809
359 Ga0587101_048474 3300059623 Bacteria 724
360 Ga0501082_0011395 3300060353 Bacteria 7649
361 Ga0501082_0030512 3300060353 Bacteria 4645
362 Ga0501082_0375410 3300060353 Bacteria 1240
363 Ga0501082_0503765 3300060353 Bacteria 1058
364 Ga0501082_1203407 3300060353 Bacteria 662
365 Ga0530510_0001850 3300061734 Bacteria 14459
366 Ga0530510_0001934 3300061734 Bacteria 14165
367 Ga0530510_0841014 3300061734 Bacteria 701

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005467 Ga0070706_100009462 Ga0070706_1000094624 136
2 3300005564 Ga0070664_101562395 Ga0070664_1015623952 136
3 3300013306 Ga0163162_11514103 Ga0163162_115141032 136
4 3300025910 Ga0207684_10018731 Ga0207684_100187318 136
5 3300039437 Ga0436365_0457109 Ga0436365_0457109_81_491 136
6 3300042876 Ga0451577_0842467 Ga0451577_0842467_377_799 136
7 3300044673 Ga0453683_0054837 Ga0453683_0054837_1034_1456 136
8 3300045051 Ga0451576_0020503 Ga0451576_0020503_497_919 136
9 3300046683 Ga0495658_1091228 Ga0495658_1091228_14_424 136
10 3300049571 Ga0501034_0010612 Ga0501034_0010612_6933_7343 136
11 3300049573 Ga0501037_0101513 Ga0501037_0101513_480_890 136
12 3300049584 Ga0501068_0006337 Ga0501068_0006337_76_486 136
13 3300049586 Ga0501070_0142692 Ga0501070_0142692_783_1193 136
14 3300049588 Ga0501072_0029187 Ga0501072_0029187_126_536 136
15 3300049589 Ga0501073_0009591 Ga0501073_0009591_296_706 136
16 3300049590 Ga0501074_0002343 Ga0501074_0002343_370_780 136
17 3300049742 Ga0501080_0054851 Ga0501080_0054851_2690_3100 136
18 3300059424 Ga0590075_135057 Ga0590075_135057_59_472 136
19 3300006038 Ga0075365_10356734 Ga0075365_103567342 137
20 3300042436 Ga0439435_0042842 Ga0439435_0042842_205_618 137
21 3300044712 Ga0453684_0044776 Ga0453684_0044776_5299_5724 137
22 3300059506 Ga0587085_090915 Ga0587085_090915_13_426 137
23 3300005331 Ga0070670_100072291 Ga0070670_1000722915 138
24 3300005331 Ga0070670_100308982 Ga0070670_1003089822 138
25 3300005337 Ga0070682_100421436 Ga0070682_1004214362 138
26 3300005345 Ga0070692_10771600 Ga0070692_107716002 138
27 3300005347 Ga0070668_100099742 Ga0070668_1000997422 138
28 3300005347 Ga0070668_101501911 Ga0070668_1015019111 138
29 3300005354 Ga0070675_100145203 Ga0070675_1001452035 138
30 3300005354 Ga0070675_100331669 Ga0070675_1003316694 138
31 3300005354 Ga0070675_101028433 Ga0070675_1010284331 138
32 3300005355 Ga0070671_100054471 Ga0070671_1000544714 138
33 3300005435 Ga0070714_100282882 Ga0070714_1002828822 138
34 3300005439 Ga0070711_100998811 Ga0070711_1009988112 138
35 3300005441 Ga0070700_100885467 Ga0070700_1008854672 138
36 3300005445 Ga0070708_100013384 Ga0070708_1000133849 138
37 3300005456 Ga0070678_100909357 Ga0070678_1009093572 138
38 3300005456 Ga0070678_101168521 Ga0070678_1011685212 138
39 3300005458 Ga0070681_11170099 Ga0070681_111700992 138
40 3300005459 Ga0068867_101080123 Ga0068867_1010801232 138
41 3300005468 Ga0070707_102021496 Ga0070707_1020214961 138
42 3300005543 Ga0070672_100952255 Ga0070672_1009522552 138
43 3300005544 Ga0070686_101855949 Ga0070686_1018559491 138
44 3300005548 Ga0070665_100508646 Ga0070665_1005086462 138
45 3300005618 Ga0068864_100372994 Ga0068864_1003729942 138
46 3300005618 Ga0068864_100544882 Ga0068864_1005448822 138
47 3300005618 Ga0068864_102408460 Ga0068864_1024084602 138
48 3300005719 Ga0068861_100172911 Ga0068861_1001729113 138
49 3300005719 Ga0068861_100909766 Ga0068861_1009097662 138
50 3300005719 Ga0068861_101533540 Ga0068861_1015335402 138
51 3300005719 Ga0068861_102491225 Ga0068861_1024912251 138
52 3300005842 Ga0068858_100032644 Ga0068858_1000326445 138
53 3300005981 Ga0081538_10004878 Ga0081538_1000487816 138
54 3300005981 Ga0081538_10012203 Ga0081538_1001220314 138
55 3300005983 Ga0081540_1276518 Ga0081540_12765182 138
56 3300005985 Ga0081539_10246336 Ga0081539_102463362 138
57 3300006038 Ga0075365_10638301 Ga0075365_106383011 138
58 3300006048 Ga0075363_100378451 Ga0075363_1003784512 138
59 3300006051 Ga0075364_10003025 Ga0075364_1000302519 138
60 3300006051 Ga0075364_10008896 Ga0075364_100088962 138
61 3300006177 Ga0075362_10024835 Ga0075362_100248357 138
62 3300006178 Ga0075367_10018520 Ga0075367_100185209 138
63 3300006178 Ga0075367_10073940 Ga0075367_100739402 138
64 3300006195 Ga0075366_10140134 Ga0075366_101401344 138
65 3300006353 Ga0075370_10359185 Ga0075370_103591852 138
66 3300006844 Ga0075428_100173727 Ga0075428_1001737273 138
67 3300006846 Ga0075430_100006208 Ga0075430_1000062083 138
68 3300006847 Ga0075431_100021250 Ga0075431_10002125011 138
69 3300006847 Ga0075431_101246716 Ga0075431_1012467162 138
70 3300006880 Ga0075429_100001166 Ga0075429_10000116611 138
71 3300009094 Ga0111539_10092465 Ga0111539_100924652 138
72 3300009094 Ga0111539_10713719 Ga0111539_107137191 138
73 3300009098 Ga0105245_10008148 Ga0105245_100081483 138
74 3300009098 Ga0105245_12513199 Ga0105245_125131991 138
75 3300009147 Ga0114129_10039268 Ga0114129_1003926814 138
76 3300009147 Ga0114129_10339295 Ga0114129_103392953 138
77 3300009147 Ga0114129_10746943 Ga0114129_107469434 138
78 3300009147 Ga0114129_11213673 Ga0114129_112136732 138
79 3300009148 Ga0105243_11264417 Ga0105243_112644172 138
80 3300009148 Ga0105243_11353155 Ga0105243_113531552 138
81 3300009174 Ga0105241_10133236 Ga0105241_101332362 138
82 3300009176 Ga0105242_10026961 Ga0105242_100269615 138
83 3300009177 Ga0105248_10648331 Ga0105248_106483312 138
84 3300009545 Ga0105237_11495490 Ga0105237_114954901 138
85 3300009553 Ga0105249_10032898 Ga0105249_100328986 138
86 3300010375 Ga0105239_11129550 Ga0105239_111295502 138
87 3300011119 Ga0105246_10333189 Ga0105246_103331891 138
88 3300011119 Ga0105246_11193365 Ga0105246_111933652 138
89 3300013100 Ga0157373_11281200 Ga0157373_112812001 138
90 3300013102 Ga0157371_10325298 Ga0157371_103252982 138
91 3300013297 Ga0157378_10305298 Ga0157378_103052982 138
92 3300013297 Ga0157378_10518648 Ga0157378_105186482 138
93 3300013306 Ga0163162_10197074 Ga0163162_101970746 138
94 3300013306 Ga0163162_10628599 Ga0163162_106285991 138
95 3300013308 Ga0157375_10064497 Ga0157375_100644972 138
96 3300013308 Ga0157375_10692711 Ga0157375_106927112 138
97 3300014326 Ga0157380_10418337 Ga0157380_104183372 138
98 3300014326 Ga0157380_10834218 Ga0157380_108342182 138
99 3300014745 Ga0157377_10335667 Ga0157377_103356672 138
100 3300014968 Ga0157379_10074891 Ga0157379_100748911 138
101 3300014968 Ga0157379_10315338 Ga0157379_103153381 138
102 3300014969 Ga0157376_10655959 Ga0157376_106559592 138
103 3300014969 Ga0157376_11247708 Ga0157376_112477082 138
104 3300017792 Ga0163161_10278729 Ga0163161_102787292 138
105 3300020070 Ga0206356_11820259 Ga0206356_118202592 138
106 3300020081 Ga0206354_10894703 Ga0206354_108947031 138
107 3300025907 Ga0207645_10450858 Ga0207645_104508582 138
108 3300025911 Ga0207654_10214708 Ga0207654_102147082 138
109 3300025923 Ga0207681_10302102 Ga0207681_103021024 138
110 3300025924 Ga0207694_10563255 Ga0207694_105632552 138
111 3300025926 Ga0207659_10179893 Ga0207659_101798935 138
112 3300025927 Ga0207687_10132055 Ga0207687_101320552 138
113 3300025929 Ga0207664_10150730 Ga0207664_101507301 138
114 3300025936 Ga0207670_10264338 Ga0207670_102643384 138
115 3300025938 Ga0207704_10988842 Ga0207704_109888422 138
116 3300025942 Ga0207689_10433887 Ga0207689_104338872 138
117 3300025960 Ga0207651_10353150 Ga0207651_103531501 138
118 3300025960 Ga0207651_10678770 Ga0207651_106787703 138
119 3300025961 Ga0207712_10099690 Ga0207712_100996905 138
120 3300025961 Ga0207712_10577536 Ga0207712_105775362 138
121 3300025972 Ga0207668_10287542 Ga0207668_102875422 138
122 3300025972 Ga0207668_10773314 Ga0207668_107733142 138
123 3300026035 Ga0207703_10628079 Ga0207703_106280792 138
124 3300026075 Ga0207708_10224425 Ga0207708_102244252 138
125 3300026089 Ga0207648_10417354 Ga0207648_104173542 138
126 3300026089 Ga0207648_10997705 Ga0207648_109977052 138
127 3300026089 Ga0207648_11863315 Ga0207648_118633151 138
128 3300026095 Ga0207676_10500508 Ga0207676_105005084 138
129 3300026118 Ga0207675_100292827 Ga0207675_1002928272 138
130 3300026118 Ga0207675_100477854 Ga0207675_1004778542 138
131 3300026118 Ga0207675_100736227 Ga0207675_1007362272 138
132 3300026121 Ga0207683_10839345 Ga0207683_108393451 138
133 3300027866 Ga0209813_10138387 Ga0209813_101383872 138
134 3300027907 Ga0207428_10013861 Ga0207428_1001386110 138
135 3300028800 Ga0265338_10058404 Ga0265338_100584042 138
136 3300031251 Ga0265327_10059607 Ga0265327_100596072 138
137 3300031824 Ga0307413_10137773 Ga0307413_101377732 138
138 3300031824 Ga0307413_11763774 Ga0307413_117637741 138
139 3300031852 Ga0307410_10058772 Ga0307410_100587722 138
140 3300031901 Ga0307406_11480252 Ga0307406_114802521 138
141 3300031903 Ga0307407_11459331 Ga0307407_114593311 138
142 3300031995 Ga0307409_100088306 Ga0307409_1000883063 138
143 3300032002 Ga0307416_100059107 Ga0307416_1000591076 138
144 3300032002 Ga0307416_100993020 Ga0307416_1009930202 138
145 3300032002 Ga0307416_101556228 Ga0307416_1015562282 138
146 3300032005 Ga0307411_10013103 Ga0307411_100131032 138
147 3300032126 Ga0307415_100114281 Ga0307415_1001142813 138
148 3300032126 Ga0307415_100991016 Ga0307415_1009910161 138
149 3300032168 Ga0316593_10029545 Ga0316593_100295455 138
150 3300035090 Ga0373949_0196101 Ga0373949_0196101_57_473 138
151 3300035172 Ga0373955_0835980 Ga0373955_0835980_34_450 138
152 3300035398 Ga0316574_0019582 Ga0316574_0019582_2329_2745 138
153 3300035398 Ga0316574_0100364 Ga0316574_0100364_1269_1685 138
154 3300035691 Ga0373931_0118785 Ga0373931_0118785_699_1115 138
155 3300036401 Ga0373937_0367355 Ga0373937_0367355_194_610 138
156 3300037471 Ga0395905_0455215 Ga0395905_0455215_667_1083 138
157 3300039062 Ga0400483_039045 Ga0400483_039045_835_1251 138
158 3300039062 Ga0400483_217638 Ga0400483_217638_5376_5798 138
159 3300039437 Ga0436365_1349538 Ga0436365_1349538_10849_11265 138
160 3300039450 Ga0436363_0590906 Ga0436363_0590906_551_967 138
161 3300041451 Ga0451791_0430095 Ga0451791_0430095_32_448 138
162 3300041460 Ga0451802_2189947 Ga0451802_2189947_173_589 138
163 3300041494 Ga0451837_0831887 Ga0451837_0831887_558_974 138
164 3300041505 Ga0451849_0096465 Ga0451849_0096465_253_669 138
165 3300041509 Ga0451843_1731555 Ga0451843_1731555_390_806 138
166 3300042016 Ga0439463_040859 Ga0439463_040859_590_1006 138
167 3300044684 Ga0466966_0270060 Ga0466966_0270060_153_569 138
168 3300044693 Ga0466961_0101230 Ga0466961_0101230_235_651 138
169 3300044901 Ga0466960_0066880 Ga0466960_0066880_1036_1452 138
170 3300045049 Ga0466959_0048982 Ga0466959_0048982_629_1045 138
171 3300045976 Ga0466967_0725384 Ga0466967_0725384_377_793 138
172 3300045976 Ga0466967_0888325 Ga0466967_0888325_301_717 138
173 3300046514 Ga0495618_0558682 Ga0495618_0558682_63_479 138
174 3300046539 Ga0495621_0004585 Ga0495621_0004585_3442_3858 138
175 3300046616 Ga0495668_0604875 Ga0495668_0604875_102_518 138
176 3300046616 Ga0495668_0777216 Ga0495668_0777216_13_429 138
177 3300046642 Ga0495634_0198626 Ga0495634_0198626_47_463 138
178 3300046681 Ga0495647_0189863 Ga0495647_0189863_159_575 138
179 3300047321 Ga0495676_0304058 Ga0495676_0304058_590_1006 138
180 3300047472 Ga0495686_0671707 Ga0495686_0671707_59_475 138
181 3300048089 Ga0495614_0007043 Ga0495614_0007043_3405_3821 138
182 3300048089 Ga0495614_0149505 Ga0495614_0149505_482_898 138
183 3300048905 Ga0496102_0080016 Ga0496102_0080016_2460_2876 138
184 3300048905 Ga0496102_0629520 Ga0496102_0629520_101_517 138
185 3300048905 Ga0496102_0697512 Ga0496102_0697512_69_485 138
186 3300048907 Ga0496104_0257011 Ga0496104_0257011_890_1306 138
187 3300048909 Ga0496106_1053607 Ga0496106_1053607_131_547 138
188 3300048911 Ga0496108_0367131 Ga0496108_0367131_31_447 138
189 3300048911 Ga0496108_0546924 Ga0496108_0546924_121_537 138
190 3300048911 Ga0496108_1360180 Ga0496108_1360180_105_521 138
191 3300048912 Ga0496109_0220667 Ga0496109_0220667_494_910 138
192 3300048912 Ga0496109_1774313 Ga0496109_1774313_108_524 138
193 3300048912 Ga0496109_2033325 Ga0496109_2033325_64_480 138
194 3300048913 Ga0496110_0146540 Ga0496110_0146540_1444_1860 138
195 3300048913 Ga0496110_0216850 Ga0496110_0216850_243_659 138
196 3300048913 Ga0496110_0440560 Ga0496110_0440560_160_576 138
197 3300048913 Ga0496110_1662257 Ga0496110_1662257_98_514 138
198 3300048914 Ga0496111_0085941 Ga0496111_0085941_172_588 138
199 3300048914 Ga0496111_0264148 Ga0496111_0264148_225_641 138
200 3300048916 Ga0496113_0238147 Ga0496113_0238147_919_1335 138
201 3300048917 Ga0496114_0758720 Ga0496114_0758720_174_830 138
202 3300049568 Ga0501031_0002118 Ga0501031_0002118_4189_4614 138
203 3300049568 Ga0501031_0028511 Ga0501031_0028511_2980_3405 138
204 3300049568 Ga0501031_0072221 Ga0501031_0072221_1601_2017 138
205 3300049568 Ga0501031_0386141 Ga0501031_0386141_150_566 138
206 3300049569 Ga0501032_0002622 Ga0501032_0002622_1421_1837 138
207 3300049569 Ga0501032_0004421 Ga0501032_0004421_18_443 138
208 3300049569 Ga0501032_0015820 Ga0501032_0015820_2757_3182 138
209 3300049570 Ga0501033_0003063 Ga0501033_0003063_8195_8620 138
210 3300049570 Ga0501033_0066505 Ga0501033_0066505_1141_1566 138
211 3300049571 Ga0501034_0003206 Ga0501034_0003206_16109_16537 138
212 3300049571 Ga0501034_0016208 Ga0501034_0016208_3281_3706 138
213 3300049571 Ga0501034_0030403 Ga0501034_0030403_3413_3841 138
214 3300049571 Ga0501034_0074913 Ga0501034_0074913_2097_2513 138
215 3300049571 Ga0501034_0157858 Ga0501034_0157858_694_1110 138
216 3300049571 Ga0501034_0244576 Ga0501034_0244576_209_634 138
217 3300049572 Ga0501036_0003710 Ga0501036_0003710_11798_12223 138
218 3300049572 Ga0501036_0016080 Ga0501036_0016080_887_1303 138
219 3300049572 Ga0501036_0209144 Ga0501036_0209144_1064_1489 138
220 3300049573 Ga0501037_0003123 Ga0501037_0003123_524_940 138
221 3300049573 Ga0501037_0010809 Ga0501037_0010809_1078_1503 138
222 3300049573 Ga0501037_0151733 Ga0501037_0151733_146_571 138
223 3300049574 Ga0501038_0012658 Ga0501038_0012658_127_552 138
224 3300049574 Ga0501038_0028598 Ga0501038_0028598_14_439 138
225 3300049574 Ga0501038_0041638 Ga0501038_0041638_1756_2172 138
226 3300049574 Ga0501038_0051794 Ga0501038_0051794_2031_2456 138
227 3300049574 Ga0501038_0213019 Ga0501038_0213019_149_565 138
228 3300049574 Ga0501038_0562994 Ga0501038_0562994_60_476 138
229 3300049575 Ga0501039_0007612 Ga0501039_0007612_5064_5489 138
230 3300049575 Ga0501039_0015250 Ga0501039_0015250_3426_3851 138
231 3300049575 Ga0501039_0221448 Ga0501039_0221448_328_744 138
232 3300049575 Ga0501039_1017332 Ga0501039_1017332_121_546 138
233 3300049576 Ga0501040_0011866 Ga0501040_0011866_5140_5556 138
234 3300049576 Ga0501040_0022843 Ga0501040_0022843_2783_3208 138
235 3300049576 Ga0501040_0031214 Ga0501040_0031214_2031_2456 138
236 3300049576 Ga0501040_0160008 Ga0501040_0160008_458_883 138
237 3300049577 Ga0501041_0001188 Ga0501041_0001188_5495_5920 138
238 3300049577 Ga0501041_0001660 Ga0501041_0001660_7929_8354 138
239 3300049577 Ga0501041_0203771 Ga0501041_0203771_718_1143 138
240 3300049578 Ga0501042_0009997 Ga0501042_0009997_98_523 138
241 3300049578 Ga0501042_0034321 Ga0501042_0034321_1142_1567 138
242 3300049579 Ga0501043_0049602 Ga0501043_0049602_98_523 138
243 3300049579 Ga0501043_0077065 Ga0501043_0077065_529_945 138
244 3300049579 Ga0501043_0205396 Ga0501043_0205396_18_443 138
245 3300049579 Ga0501043_0469289 Ga0501043_0469289_421_846 138
246 3300049580 Ga0501046_0004156 Ga0501046_0004156_1364_1789 138
247 3300049580 Ga0501046_0006809 Ga0501046_0006809_8948_9373 138
248 3300049580 Ga0501046_0217979 Ga0501046_0217979_362_778 138
249 3300049581 Ga0501047_0044597 Ga0501047_0044597_1078_1503 138
250 3300049581 Ga0501047_0064576 Ga0501047_0064576_2428_2853 138
251 3300049582 Ga0501048_0006265 Ga0501048_0006265_7907_8332 138
252 3300049582 Ga0501048_0026202 Ga0501048_0026202_1789_2214 138
253 3300049582 Ga0501048_0068237 Ga0501048_0068237_97_522 138
254 3300049582 Ga0501048_0184157 Ga0501048_0184157_115_531 138
255 3300049583 Ga0501067_0026623 Ga0501067_0026623_2172_2588 138
256 3300049583 Ga0501067_0055369 Ga0501067_0055369_183_599 138
257 3300049583 Ga0501067_0064839 Ga0501067_0064839_1137_1562 138
258 3300049584 Ga0501068_0003273 Ga0501068_0003273_2061_2486 138
259 3300049584 Ga0501068_0010460 Ga0501068_0010460_3426_3851 138
260 3300049585 Ga0501069_0003229 Ga0501069_0003229_2657_3082 138
261 3300049585 Ga0501069_0005227 Ga0501069_0005227_5056_5472 138
262 3300049585 Ga0501069_0128775 Ga0501069_0128775_957_1382 138
263 3300049585 Ga0501069_0330144 Ga0501069_0330144_292_708 138
264 3300049586 Ga0501070_0000976 Ga0501070_0000976_6686_7102 138
265 3300049586 Ga0501070_0033676 Ga0501070_0033676_1085_1510 138
266 3300049586 Ga0501070_0044003 Ga0501070_0044003_2443_2859 138
267 3300049586 Ga0501070_0046845 Ga0501070_0046845_2079_2495 138
268 3300049587 Ga0501071_0018161 Ga0501071_0018161_3502_3918 138
269 3300049587 Ga0501071_0034240 Ga0501071_0034240_1143_1568 138
270 3300049587 Ga0501071_0087843 Ga0501071_0087843_303_719 138
271 3300049587 Ga0501071_0179832 Ga0501071_0179832_592_1008 138
272 3300049587 Ga0501071_0367171 Ga0501071_0367171_301_726 138
273 3300049587 Ga0501071_0384585 Ga0501071_0384585_169_585 138
274 3300049588 Ga0501072_0000404 Ga0501072_0000404_25297_25713 138
275 3300049588 Ga0501072_0005272 Ga0501072_0005272_8342_8767 138
276 3300049588 Ga0501072_0014321 Ga0501072_0014321_5213_5638 138
277 3300049588 Ga0501072_0015662 Ga0501072_0015662_824_1240 138
278 3300049588 Ga0501072_0068224 Ga0501072_0068224_585_1001 138
279 3300049588 Ga0501072_0301203 Ga0501072_0301203_510_926 138
280 3300049589 Ga0501073_0004116 Ga0501073_0004116_670_1086 138
281 3300049589 Ga0501073_0021685 Ga0501073_0021685_2705_3130 138
282 3300049589 Ga0501073_0023426 Ga0501073_0023426_1974_2399 138
283 3300049590 Ga0501074_0002634 Ga0501074_0002634_6075_6500 138
284 3300049590 Ga0501074_0039612 Ga0501074_0039612_2031_2456 138
285 3300049590 Ga0501074_0197214 Ga0501074_0197214_868_1284 138
286 3300049590 Ga0501074_0611671 Ga0501074_0611671_248_673 138
287 3300049591 Ga0501075_0001943 Ga0501075_0001943_2031_2456 138
288 3300049591 Ga0501075_0070735 Ga0501075_0070735_151_576 138
289 3300049591 Ga0501075_0175107 Ga0501075_0175107_561_977 138
290 3300049592 Ga0501076_0007602 Ga0501076_0007602_670_1086 138
291 3300049592 Ga0501076_0008207 Ga0501076_0008207_5194_5619 138
292 3300049592 Ga0501076_0010290 Ga0501076_0010290_3502_3927 138
293 3300049593 Ga0501077_0001912 Ga0501077_0001912_1141_1566 138
294 3300049593 Ga0501077_0002204 Ga0501077_0002204_1963_2388 138
295 3300049593 Ga0501077_0006635 Ga0501077_0006635_1308_1724 138
296 3300049593 Ga0501077_0207683 Ga0501077_0207683_25_441 138
297 3300049741 Ga0501079_0000076 Ga0501079_0000076_45316_45741 138
298 3300049741 Ga0501079_0003409 Ga0501079_0003409_8272_8697 138
299 3300049741 Ga0501079_0043024 Ga0501079_0043024_774_1190 138
300 3300049741 Ga0501079_0219509 Ga0501079_0219509_396_812 138
301 3300049742 Ga0501080_0016669 Ga0501080_0016669_1002_1418 138
302 3300049742 Ga0501080_0041881 Ga0501080_0041881_32_457 138
303 3300049742 Ga0501080_0100018 Ga0501080_0100018_2031_2456 138
304 3300049742 Ga0501080_0234619 Ga0501080_0234619_670_1086 138
305 3300049742 Ga0501080_0260676 Ga0501080_0260676_1078_1503 138
306 3300049742 Ga0501080_0292722 Ga0501080_0292722_560_976 138
307 3300049743 Ga0501081_0006383 Ga0501081_0006383_5194_5619 138
308 3300049743 Ga0501081_0021249 Ga0501081_0021249_98_523 138
309 3300049743 Ga0501081_0278802 Ga0501081_0278802_701_1126 138
310 3300049743 Ga0501081_0794724 Ga0501081_0794724_224_640 138
311 3300049743 Ga0501081_1356357 Ga0501081_1356357_42_467 138
312 3300049744 Ga0501083_0000616 Ga0501083_0000616_15126_15542 138
313 3300049744 Ga0501083_0011542 Ga0501083_0011542_3741_4166 138
314 3300049744 Ga0501083_0013540 Ga0501083_0013540_845_1261 138
315 3300049744 Ga0501083_0039064 Ga0501083_0039064_2426_2842 138
316 3300049744 Ga0501083_0076500 Ga0501083_0076500_719_1144 138
317 3300049822 Ga0501035_0010773 Ga0501035_0010773_5645_6070 138
318 3300049822 Ga0501035_0066446 Ga0501035_0066446_1083_1499 138
319 3300049822 Ga0501035_0076906 Ga0501035_0076906_2291_2716 138
320 3300049822 Ga0501035_0519980 Ga0501035_0519980_442_858 138
321 3300049823 Ga0501044_0005788 Ga0501044_0005788_5233_5649 138
322 3300049823 Ga0501044_0099507 Ga0501044_0099507_410_835 138
323 3300049823 Ga0501044_0302646 Ga0501044_0302646_957_1382 138
324 3300049824 Ga0501045_0000077 Ga0501045_0000077_8336_8761 138
325 3300049824 Ga0501045_0002201 Ga0501045_0002201_12019_12435 138
326 3300049824 Ga0501045_0015318 Ga0501045_0015318_1142_1567 138
327 3300049824 Ga0501045_0065281 Ga0501045_0065281_2131_2556 138
328 3300050490 nmdc:mga03n38_43726_c1 nmdc:mga03n38_43726_c1_1252_1668 138
329 3300050491 nmdc:mga00v17_10759_c1 nmdc:mga00v17_10759_c1_3551_3967 138
330 3300050491 nmdc:mga00v17_296624_c1 nmdc:mga00v17_296624_c1_545_961 138
331 3300050491 nmdc:mga00v17_49407_c1 nmdc:mga00v17_49407_c1_807_1223 138
332 3300050492 nmdc:mga0yw44_296981_c1 nmdc:mga0yw44_296981_c1_548_964 138
333 3300050492 nmdc:mga0yw44_463066_c1 nmdc:mga0yw44_463066_c1_412_828 138
334 3300050492 nmdc:mga0yw44_533192_c1 nmdc:mga0yw44_533192_c1_106_531 138
335 3300050493 nmdc:mga0k408_86558_c1 nmdc:mga0k408_86558_c1_913_1329 138
336 3300050494 nmdc:mga06z11_20149_c1 nmdc:mga06z11_20149_c1_130_546 138
337 3300050494 nmdc:mga06z11_56325_c1 nmdc:mga06z11_56325_c1_781_1197 138
338 3300050494 nmdc:mga06z11_85308_c1 nmdc:mga06z11_85308_c1_537_953 138
339 3300050507 nmdc:mga05p37_1786356_c1 nmdc:mga05p37_1786356_c1_131_547 138
340 3300050507 nmdc:mga05p37_227564_c1 nmdc:mga05p37_227564_c1_1301_1717 138
341 3300050507 nmdc:mga05p37_585156_c1 nmdc:mga05p37_585156_c1_372_788 138
342 3300050507 nmdc:mga05p37_819372_c1 nmdc:mga05p37_819372_c1_173_589 138
343 3300050508 nmdc:mga09592_183_c1 nmdc:mga09592_183_c1_28461_28877 138
344 3300050509 nmdc:mga0qj67_5012_c1 nmdc:mga0qj67_5012_c1_7972_8388 138
345 3300050511 nmdc:mga08y16_29130_c1 nmdc:mga08y16_29130_c1_4277_4693 138
346 3300050511 nmdc:mga08y16_844054_c1 nmdc:mga08y16_844054_c1_88_504 138
347 3300050511 nmdc:mga08y16_953382_c1 nmdc:mga08y16_953382_c1_113_535 138
348 3300050512 nmdc:mga0n895_2224983_c1 nmdc:mga0n895_2224983_c1_63_479 138
349 3300053078 Ga0495612_0334204 Ga0495612_0334204_141_557 138
350 3300053085 Ga0495619_0516576 Ga0495619_0516576_279_695 138
351 3300053094 Ga0500566_0000391 Ga0500566_0000391_11675_12100 138
352 3300054114 Ga0501084_0000125 Ga0501084_0000125_51745_52170 138
353 3300054114 Ga0501084_0003582 Ga0501084_0003582_6050_6475 138
354 3300054114 Ga0501084_0029240 Ga0501084_0029240_2830_3246 138
355 3300054114 Ga0501084_0056040 Ga0501084_0056040_719_1144 138
356 3300059424 Ga0590075_023920 Ga0590075_023920_448_864 138
357 3300059493 Ga0587077_014462 Ga0587077_014462_106_522 138
358 3300059508 Ga0587088_051351 Ga0587088_051351_203_619 138
359 3300059623 Ga0587101_048474 Ga0587101_048474_145_561 138
360 3300060353 Ga0501082_0011395 Ga0501082_0011395_5194_5619 138
361 3300060353 Ga0501082_0030512 Ga0501082_0030512_719_1144 138
362 3300060353 Ga0501082_0375410 Ga0501082_0375410_97_522 138
363 3300060353 Ga0501082_0503765 Ga0501082_0503765_168_584 138
364 3300060353 Ga0501082_1203407 Ga0501082_1203407_216_632 138
365 3300061734 Ga0530510_0001850 Ga0530510_0001850_12004_12429 138
366 3300061734 Ga0530510_0001934 Ga0530510_0001934_4385_4810 138
367 3300061734 Ga0530510_0841014 Ga0530510_0841014_156_572 138

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00252

Ribosomal_L16

Ribosomal protein L16p/L10e

4

124

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pa2-assembly2.cif.gz_B crystal structure of human ribosomal protein l10 core domain 0.8437 32 132
7po4-assembly1.cif.gz_N assembly intermediate of human mitochondrial ribosome large subunit (largely unfolded rrna with malsu1, l0r8f8 and acp) 0.8174 17 135
8eug-assembly1.cif.gz_I ytm1 associated nascent 60s ribosome state 3 0.8052 32 133
8flf-assembly1.cif.gz_BE human nuclear pre-60s ribosomal subunit (state l3) 0.8025 32 132
6gbz-assembly1.cif.gz_M 50s ribosomal subunit assembly intermediate state 5 0.7883 1 134
ID Description Score Start End Superfamily
6gbzM01 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Ribosomal protein L16/L10 0.8746 23 134 3.90.1170.10
2pa2B00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Ribosomal protein L16/L10 0.8437 32 132 3.90.1170.10
6gbzM01 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Ribosomal protein L16/L10 0.8425 23 134 3.90.1170.10
6qulN01 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Ribosomal protein L16/L10 0.7919 21 134 3.90.1170.10
4kbuQ01 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Ribosomal protein L16/L10 0.7734 22 138 3.90.1170.10
ID Description Score Start End GO Terms
AF-A0A2H5PR85-F1-model_v4 Ribosomal protein L10e/L16 domain-containing protein 0.9503 18 133 GO:0003735
GO:0005762
GO:0019843
GO:0032543
AF-A0A446PLD0-F1-model_v4 deleted 0.9136 18 133
AF-A0A2H5PR85-F1-model_v4 Ribosomal protein L10e/L16 domain-containing protein 0.9128 18 133 GO:0003735
GO:0005762
GO:0019843
GO:0032543
AF-A0A446PLD0-F1-model_v4 deleted 0.8741 18 133
AF-A0A257UHY6-F1-model_v4 deleted 0.8569 1 134

Feature Viewer

pLDDT pTM Quality
76.52 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map