F424387
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 367 | 230 | 734 | 433 |
Family's Representative Sequence
| Representative Sequence | 3300028556|Ga0265337_1000032|Ga0265337_100003244 |
| Length | 464 |
| Sequence | VELFTPGQAVWPGSQSRVRLDRFHGVTAAEKVCVIGAGSSGIASCQVLSARRIPYDCFEKGSQVGGNWRFENDNGQSSAYRSLHINSSRKLMAFKTFPMPDHLPDYPSHFQIAKYFDDFVEHFGLRDNIRFRTTVLSVEPVDGEWEVTVEDAEGKRETIRYRAVLVANGHHWDPRWPEPAFPGSEEFTGEQLHVHHYREPDVLEGKRVLVLGIGNSATDIAVESSRIADKTFLTMRRGAYVLPKFLNGKPVDEAAPPIASRLPLSVQRFFMARMLDMAAGDMTSYGLPQPDHKLLEAHPTVSSELLPRLGHGDILVKPNIDRFSGGRTVRFVDGSEEEIDLVVYCTGYKITFPFFDEQVVAARDNRLQLYRRVVSAAHPGLFFIGFIQPLGPIMPIAEAQSEWIADILGGRCSLPSPAEMQSEIAAAERKMKKRYVASKRHTIQVDFHPYLREIRRERKQAARA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 2 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 26 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 36 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 37 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 38 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 39 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 40 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 41 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 42 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 43 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 44 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 45 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 48 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 49 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 67 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 68 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 107 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 108 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 109 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 110 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 111 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 112 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 113 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 114 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 115 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 116 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 117 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 118 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 119 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 120 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 121 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 122 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 123 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 124 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 125 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 126 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 127 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 128 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 174 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 175 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 176 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 177 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 178 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 179 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 180 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 181 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 183 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 184 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 185 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 186 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 187 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 188 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 189 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 190 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 191 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 192 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 193 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 194 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 195 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 196 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 197 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 220 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 227 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 228 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 229 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 230 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.46 |
| Metatranscriptomes | 0.54 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.18 |
| Nodule | 0 |
| Rhizoplane | 12.81 |
| Rhizosphere | 82.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0265337_1000032 | 3300028556 | Bacteria | 61342 |
| 2 | CNAas_1002054 | 3300000532 | Bacteria | 1511 |
| 3 | JGI24746J21847_1000525 | 3300001977 | Bacteria | 5740 |
| 4 | JGI24740J21852_10019975 | 3300001979 | Bacteria | 2349 |
| 5 | JGI25404J52841_10010448 | 3300003659 | Bacteria | 1995 |
| 6 | Ga0070683_100064559 | 3300005329 | Bacteria | 3408 |
| 7 | Ga0070683_100104784 | 3300005329 | Bacteria | 2665 |
| 8 | Ga0070670_100217225 | 3300005331 | Bacteria | 1663 |
| 9 | Ga0070677_10000017 | 3300005333 | Bacteria | 52010 |
| 10 | Ga0070682_100000009 | 3300005337 | Bacteria | 291635 |
| 11 | Ga0070682_100000086 | 3300005337 | Bacteria | 83703 |
| 12 | Ga0068868_100003178 | 3300005338 | Bacteria | 11437 |
| 13 | Ga0070691_10000257 | 3300005341 | Bacteria | 18341 |
| 14 | Ga0070661_100000236 | 3300005344 | Bacteria | 45535 |
| 15 | Ga0070668_100007930 | 3300005347 | Bacteria | 7884 |
| 16 | Ga0070675_100000930 | 3300005354 | Bacteria | 20823 |
| 17 | Ga0070674_100000021 | 3300005356 | Bacteria | 87134 |
| 18 | Ga0070674_100000047 | 3300005356 | Bacteria | 52597 |
| 19 | Ga0070673_100002816 | 3300005364 | Bacteria | 10695 |
| 20 | Ga0070688_100007391 | 3300005365 | Bacteria | 5918 |
| 21 | Ga0070688_100018229 | 3300005365 | Bacteria | 4047 |
| 22 | Ga0070659_100014496 | 3300005366 | Bacteria | 5891 |
| 23 | Ga0070667_100005138 | 3300005367 | Bacteria | 10956 |
| 24 | Ga0070713_100007177 | 3300005436 | Bacteria | 7798 |
| 25 | Ga0070711_100008189 | 3300005439 | Bacteria | 6391 |
| 26 | Ga0070711_100017883 | 3300005439 | Bacteria | 4518 |
| 27 | Ga0070663_100016927 | 3300005455 | Bacteria | 4745 |
| 28 | Ga0070662_100000007 | 3300005457 | Bacteria | 168761 |
| 29 | Ga0070681_10069654 | 3300005458 | Bacteria | 3484 |
| 30 | Ga0068867_100005475 | 3300005459 | Bacteria | 8983 |
| 31 | Ga0070685_10005338 | 3300005466 | Bacteria | 6516 |
| 32 | Ga0070685_10006836 | 3300005466 | Bacteria | 5824 |
| 33 | Ga0070679_100002103 | 3300005530 | Bacteria | 17941 |
| 34 | Ga0070679_100012041 | 3300005530 | Bacteria | 8256 |
| 35 | Ga0070684_100036091 | 3300005535 | Bacteria | 4235 |
| 36 | Ga0070684_100048169 | 3300005535 | Bacteria | 3696 |
| 37 | Ga0070684_100089391 | 3300005535 | Bacteria | 2737 |
| 38 | Ga0070672_100000104 | 3300005543 | Bacteria | 42077 |
| 39 | Ga0070665_100000022 | 3300005548 | Bacteria | 379286 |
| 40 | Ga0070665_100035836 | 3300005548 | Bacteria | 4991 |
| 41 | Ga0070665_100169324 | 3300005548 | Bacteria | 2186 |
| 42 | Ga0070664_100059877 | 3300005564 | Bacteria | 3241 |
| 43 | Ga0070664_100099289 | 3300005564 | Bacteria | 2530 |
| 44 | Ga0068854_100002532 | 3300005578 | Bacteria | 11318 |
| 45 | Ga0068854_100019389 | 3300005578 | Bacteria | 4583 |
| 46 | Ga0068856_100017730 | 3300005614 | Bacteria | 6905 |
| 47 | Ga0068856_100023933 | 3300005614 | Bacteria | 5939 |
| 48 | Ga0068856_100065953 | 3300005614 | Bacteria | 3577 |
| 49 | Ga0068852_100001042 | 3300005616 | Bacteria | 18249 |
| 50 | Ga0068864_100000023 | 3300005618 | Bacteria | 257064 |
| 51 | Ga0068866_10000007 | 3300005718 | Bacteria | 121729 |
| 52 | Ga0068866_10000274 | 3300005718 | Bacteria | 24536 |
| 53 | Ga0068851_10002945 | 3300005834 | Bacteria | 7523 |
| 54 | Ga0068863_100000110 | 3300005841 | Bacteria | 86415 |
| 55 | Ga0068863_100153964 | 3300005841 | Bacteria | 2200 |
| 56 | Ga0068858_100000150 | 3300005842 | Bacteria | 73075 |
| 57 | Ga0068858_100000287 | 3300005842 | Bacteria | 54456 |
| 58 | Ga0068860_100021758 | 3300005843 | Bacteria | 6205 |
| 59 | Ga0068862_100030442 | 3300005844 | Bacteria | 4549 |
| 60 | Ga0081455_10005169 | 3300005937 | Bacteria | 14366 |
| 61 | Ga0081540_1000281 | 3300005983 | Bacteria | 52990 |
| 62 | Ga0081539_10002195 | 3300005985 | Bacteria | 28613 |
| 63 | Ga0070715_10000003 | 3300006163 | Bacteria | 345282 |
| 64 | Ga0070712_100002727 | 3300006175 | Bacteria | 10900 |
| 65 | Ga0075433_10001498 | 3300006852 | Bacteria | 17252 |
| 66 | Ga0068865_100000056 | 3300006881 | Bacteria | 62122 |
| 67 | Ga0105245_10000022 | 3300009098 | Bacteria | 181225 |
| 68 | Ga0105245_10007109 | 3300009098 | Bacteria | 9818 |
| 69 | Ga0105245_10014325 | 3300009098 | Bacteria | 6909 |
| 70 | Ga0105247_10000064 | 3300009101 | Bacteria | 123994 |
| 71 | Ga0105243_10075819 | 3300009148 | Bacteria | 2731 |
| 72 | Ga0105241_10008834 | 3300009174 | Bacteria | 7406 |
| 73 | Ga0105242_10002991 | 3300009176 | Bacteria | 13227 |
| 74 | Ga0105242_10003504 | 3300009176 | Bacteria | 12198 |
| 75 | Ga0105248_10001735 | 3300009177 | Bacteria | 24226 |
| 76 | Ga0105238_10000014 | 3300009551 | Bacteria | 241954 |
| 77 | Ga0105249_10010011 | 3300009553 | Bacteria | 8320 |
| 78 | Ga0105249_10063104 | 3300009553 | Bacteria | 3403 |
| 79 | Ga0105239_10040100 | 3300010375 | Bacteria | 5130 |
| 80 | Ga0105239_10061842 | 3300010375 | Bacteria | 4110 |
| 81 | Ga0157370_10168573 | 3300013104 | Bacteria | 2036 |
| 82 | Ga0157369_10000068 | 3300013105 | Bacteria | 144274 |
| 83 | Ga0157378_10015262 | 3300013297 | Bacteria | 6727 |
| 84 | Ga0157378_10051751 | 3300013297 | Bacteria | 3654 |
| 85 | Ga0157372_10008183 | 3300013307 | Bacteria | 11117 |
| 86 | Ga0157375_10009903 | 3300013308 | Bacteria | 8384 |
| 87 | Ga0157375_10012560 | 3300013308 | Bacteria | 7517 |
| 88 | Ga0157375_10165698 | 3300013308 | Bacteria | 2354 |
| 89 | Ga0157380_10000808 | 3300014326 | Bacteria | 19608 |
| 90 | Ga0157379_10015361 | 3300014968 | Bacteria | 6718 |
| 91 | Ga0157379_10035013 | 3300014968 | Bacteria | 4475 |
| 92 | Ga0163161_10000013 | 3300017792 | Bacteria | 258747 |
| 93 | Ga0163161_10015163 | 3300017792 | Bacteria | 5370 |
| 94 | Ga0206356_10615566 | 3300020070 | Bacteria | 1526 |
| 95 | Ga0224712_10002990 | 3300022467 | Bacteria | 4296 |
| 96 | Ga0207656_10001231 | 3300025321 | Bacteria | 8452 |
| 97 | Ga0207682_10000008 | 3300025893 | Bacteria | 87020 |
| 98 | Ga0207642_10000008 | 3300025899 | Bacteria | 132651 |
| 99 | Ga0207642_10000979 | 3300025899 | Bacteria | 8909 |
| 100 | Ga0207710_10000220 | 3300025900 | Bacteria | 50023 |
| 101 | Ga0207685_10000003 | 3300025905 | Bacteria | 344527 |
| 102 | Ga0207654_10030101 | 3300025911 | Bacteria | 2977 |
| 103 | Ga0207707_10007402 | 3300025912 | Bacteria | 9561 |
| 104 | Ga0207693_10001647 | 3300025915 | Bacteria | 19699 |
| 105 | Ga0207663_10025785 | 3300025916 | Bacteria | 3404 |
| 106 | Ga0207663_10058340 | 3300025916 | Bacteria | 2435 |
| 107 | Ga0207649_10000388 | 3300025920 | Bacteria | 32980 |
| 108 | Ga0207652_10000666 | 3300025921 | Bacteria | 33621 |
| 109 | Ga0207652_10000687 | 3300025921 | Bacteria | 32979 |
| 110 | Ga0207694_10000008 | 3300025924 | Bacteria | 484902 |
| 111 | Ga0207659_10000054 | 3300025926 | Bacteria | 76823 |
| 112 | Ga0207687_10000025 | 3300025927 | Bacteria | 175177 |
| 113 | Ga0207687_10000039 | 3300025927 | Bacteria | 114303 |
| 114 | Ga0207687_10000132 | 3300025927 | Bacteria | 50024 |
| 115 | Ga0207687_10011202 | 3300025927 | Bacteria | 5856 |
| 116 | Ga0207664_10147547 | 3300025929 | Bacteria | 1996 |
| 117 | Ga0207690_10046020 | 3300025932 | Bacteria | 2887 |
| 118 | Ga0207690_10057292 | 3300025932 | Bacteria | 2632 |
| 119 | Ga0207706_10000018 | 3300025933 | Bacteria | 168729 |
| 120 | Ga0207686_10000066 | 3300025934 | Bacteria | 95095 |
| 121 | Ga0207669_10000032 | 3300025937 | Bacteria | 82757 |
| 122 | Ga0207669_10000083 | 3300025937 | Bacteria | 47557 |
| 123 | Ga0207704_10000092 | 3300025938 | Bacteria | 52383 |
| 124 | Ga0207691_10000430 | 3300025940 | Bacteria | 41789 |
| 125 | Ga0207711_10000011 | 3300025941 | Bacteria | 518817 |
| 126 | Ga0207661_10008772 | 3300025944 | Bacteria | 7232 |
| 127 | Ga0207661_10014386 | 3300025944 | Bacteria | 5799 |
| 128 | Ga0207661_10018121 | 3300025944 | Bacteria | 5229 |
| 129 | Ga0207661_10175829 | 3300025944 | Bacteria | 1866 |
| 130 | Ga0207651_10001037 | 3300025960 | Bacteria | 12286 |
| 131 | Ga0207712_10000067 | 3300025961 | Bacteria | 130079 |
| 132 | Ga0207712_10004693 | 3300025961 | Bacteria | 8638 |
| 133 | Ga0207712_10090939 | 3300025961 | Bacteria | 2247 |
| 134 | Ga0207668_10085679 | 3300025972 | Bacteria | 2300 |
| 135 | Ga0207640_10000691 | 3300025981 | Bacteria | 19634 |
| 136 | Ga0207677_10000046 | 3300026023 | Bacteria | 105382 |
| 137 | Ga0207703_10000122 | 3300026035 | Bacteria | 92656 |
| 138 | Ga0207703_10001133 | 3300026035 | Bacteria | 25156 |
| 139 | Ga0207678_10002630 | 3300026067 | Bacteria | 16356 |
| 140 | Ga0207702_10001995 | 3300026078 | Bacteria | 19804 |
| 141 | Ga0207702_10012269 | 3300026078 | Bacteria | 7131 |
| 142 | Ga0207702_10013312 | 3300026078 | Bacteria | 6842 |
| 143 | Ga0207641_10000065 | 3300026088 | Bacteria | 156066 |
| 144 | Ga0207641_10016838 | 3300026088 | Bacteria | 5986 |
| 145 | Ga0207641_10132423 | 3300026088 | Bacteria | 2240 |
| 146 | Ga0207648_10005844 | 3300026089 | Bacteria | 12319 |
| 147 | Ga0207676_10000025 | 3300026095 | Bacteria | 261714 |
| 148 | Ga0207698_10000014 | 3300026142 | Bacteria | 240703 |
| 149 | Ga0268266_10000029 | 3300028379 | Bacteria | 424015 |
| 150 | Ga0268266_10114944 | 3300028379 | Bacteria | 2388 |
| 151 | Ga0268265_10042427 | 3300028380 | Bacteria | 3375 |
| 152 | Ga0268264_10034383 | 3300028381 | Bacteria | 4169 |
| 153 | Ga0265326_10000391 | 3300028558 | Bacteria | 17570 |
| 154 | Ga0265319_1000030 | 3300028563 | Bacteria | 129742 |
| 155 | Ga0265322_10000012 | 3300028654 | Bacteria | 152373 |
| 156 | Ga0265336_10001438 | 3300028666 | Bacteria | 10856 |
| 157 | Ga0265338_10000156 | 3300028800 | Bacteria | 125065 |
| 158 | Ga0265324_10000620 | 3300029957 | Bacteria | 24187 |
| 159 | Ga0265332_10048320 | 3300031238 | Bacteria | 1830 |
| 160 | Ga0265328_10002171 | 3300031239 | Bacteria | 8852 |
| 161 | Ga0265320_10000001 | 3300031240 | Bacteria | 847191 |
| 162 | Ga0265329_10005600 | 3300031242 | Bacteria | 5061 |
| 163 | Ga0265339_10036607 | 3300031249 | Bacteria | 2746 |
| 164 | Ga0265331_10012192 | 3300031250 | Bacteria | 4665 |
| 165 | Ga0265331_10020490 | 3300031250 | Bacteria | 3393 |
| 166 | Ga0265327_10000003 | 3300031251 | Bacteria | 852750 |
| 167 | Ga0265316_10015154 | 3300031344 | Bacteria | 6752 |
| 168 | Ga0265314_10000178 | 3300031711 | Bacteria | 94070 |
| 169 | Ga0316574_0079440 | 3300035398 | Bacteria | 2081 |
| 170 | Ga0373937_0069176 | 3300036401 | Bacteria | 3254 |
| 171 | Ga0373937_0162168 | 3300036401 | Bacteria | 2096 |
| 172 | Ga0316584_0030983 | 3300036712 | Bacteria | 3954 |
| 173 | Ga0451853_2210063 | 3300041512 | Bacteria | 4015 |
| 174 | Ga0466963_0000325 | 3300044694 | Bacteria | 21618 |
| 175 | Ga0466957_0011751 | 3300044842 | Bacteria | 5060 |
| 176 | Ga0466967_0000003 | 3300045976 | Bacteria | 169144 |
| 177 | Ga0495592_0141554 | 3300046454 | Bacteria | 1672 |
| 178 | Ga0495592_0175505 | 3300046454 | Bacteria | 1464 |
| 179 | Ga0495603_0000323 | 3300046455 | Bacteria | 25798 |
| 180 | Ga0495603_0000641 | 3300046455 | Bacteria | 19699 |
| 181 | Ga0495629_0011553 | 3300046459 | Bacteria | 6414 |
| 182 | Ga0495629_0013942 | 3300046459 | Bacteria | 5794 |
| 183 | Ga0495641_0000400 | 3300046461 | Bacteria | 36235 |
| 184 | Ga0495641_0020521 | 3300046461 | Bacteria | 3347 |
| 185 | Ga0495651_0179438 | 3300046462 | Bacteria | 1500 |
| 186 | Ga0495653_0105825 | 3300046463 | Bacteria | 2030 |
| 187 | Ga0495653_0170016 | 3300046463 | Bacteria | 1505 |
| 188 | Ga0495582_0000006 | 3300046473 | Bacteria | 140434 |
| 189 | Ga0495662_0000236 | 3300046476 | Bacteria | 23206 |
| 190 | Ga0495662_0091238 | 3300046476 | Bacteria | 1485 |
| 191 | Ga0495594_0000001 | 3300046499 | Bacteria | 293051 |
| 192 | Ga0495606_0000283 | 3300046507 | Bacteria | 88309 |
| 193 | Ga0495608_0000010 | 3300046511 | Bacteria | 258660 |
| 194 | Ga0495608_0007965 | 3300046511 | Bacteria | 7446 |
| 195 | Ga0495608_0030267 | 3300046511 | Bacteria | 3666 |
| 196 | Ga0495618_0000037 | 3300046514 | Bacteria | 99735 |
| 197 | Ga0495620_0000668 | 3300046515 | Bacteria | 21158 |
| 198 | Ga0495628_0000864 | 3300046516 | Bacteria | 28036 |
| 199 | Ga0495628_0127667 | 3300046516 | Bacteria | 1947 |
| 200 | Ga0495628_0138753 | 3300046516 | Bacteria | 1856 |
| 201 | Ga0495628_0263303 | 3300046516 | Bacteria | 1284 |
| 202 | Ga0495630_0000378 | 3300046517 | Bacteria | 35012 |
| 203 | Ga0495630_0005497 | 3300046517 | Bacteria | 8945 |
| 204 | Ga0495652_0000009 | 3300046529 | Bacteria | 311000 |
| 205 | Ga0495652_0029984 | 3300046529 | Bacteria | 4773 |
| 206 | Ga0495640_0017271 | 3300046533 | Bacteria | 5380 |
| 207 | Ga0495586_0025402 | 3300046535 | Bacteria | 3170 |
| 208 | Ga0495587_0065492 | 3300046536 | Bacteria | 2121 |
| 209 | Ga0495598_0004091 | 3300046537 | Bacteria | 3138 |
| 210 | Ga0495621_0020640 | 3300046539 | Bacteria | 2164 |
| 211 | Ga0495622_0000069 | 3300046557 | Bacteria | 89759 |
| 212 | Ga0495667_0000067 | 3300046559 | Bacteria | 81751 |
| 213 | Ga0495667_0042386 | 3300046559 | Bacteria | 3018 |
| 214 | Ga0495656_0005437 | 3300046615 | Bacteria | 4399 |
| 215 | Ga0495634_0000021 | 3300046642 | Bacteria | 120521 |
| 216 | Ga0495634_0000993 | 3300046642 | Bacteria | 26739 |
| 217 | Ga0495625_0000109 | 3300046660 | Bacteria | 125064 |
| 218 | Ga0495635_0000006 | 3300046663 | Bacteria | 301820 |
| 219 | Ga0495588_0000175 | 3300046674 | Bacteria | 80911 |
| 220 | Ga0495657_0000005 | 3300046675 | Bacteria | 254860 |
| 221 | Ga0495657_0019254 | 3300046675 | Bacteria | 4927 |
| 222 | Ga0495599_0009407 | 3300046678 | Bacteria | 5973 |
| 223 | Ga0495647_0000010 | 3300046681 | Bacteria | 94696 |
| 224 | Ga0495658_0000094 | 3300046683 | Bacteria | 46061 |
| 225 | Ga0495658_0001193 | 3300046683 | Bacteria | 13694 |
| 226 | Ga0495669_0001857 | 3300046684 | Bacteria | 8658 |
| 227 | Ga0495613_0000087 | 3300046689 | Bacteria | 88644 |
| 228 | Ga0495613_0000329 | 3300046689 | Bacteria | 42819 |
| 229 | Ga0495613_0231785 | 3300046689 | Bacteria | 1293 |
| 230 | Ga0495624_0000429 | 3300046690 | Bacteria | 33305 |
| 231 | Ga0495624_0000767 | 3300046690 | Bacteria | 25280 |
| 232 | Ga0495649_0003368 | 3300046694 | Bacteria | 10827 |
| 233 | Ga0495600_0019108 | 3300046809 | Bacteria | 4372 |
| 234 | Ga0495604_0000322 | 3300047317 | Bacteria | 42966 |
| 235 | Ga0495674_0000115 | 3300047319 | Bacteria | 60282 |
| 236 | Ga0495672_0066966 | 3300047320 | Bacteria | 2047 |
| 237 | Ga0495676_0001315 | 3300047321 | Bacteria | 21280 |
| 238 | Ga0495676_0009804 | 3300047321 | Bacteria | 8700 |
| 239 | Ga0495676_0113580 | 3300047321 | Bacteria | 1983 |
| 240 | Ga0495680_0001684 | 3300047322 | Bacteria | 23470 |
| 241 | Ga0495680_0001951 | 3300047322 | Bacteria | 21721 |
| 242 | Ga0495680_0006746 | 3300047322 | Bacteria | 10616 |
| 243 | Ga0495675_0000398 | 3300047444 | Bacteria | 30075 |
| 244 | Ga0495675_0032604 | 3300047444 | Bacteria | 3324 |
| 245 | Ga0495593_0043339 | 3300047673 | Bacteria | 2412 |
| 246 | Ga0495593_0094240 | 3300047673 | Bacteria | 1540 |
| 247 | Ga0495602_0000038 | 3300048088 | Bacteria | 130758 |
| 248 | Ga0495602_0018782 | 3300048088 | Bacteria | 6888 |
| 249 | Ga0496100_0000004 | 3300048903 | Bacteria | 321778 |
| 250 | Ga0496100_0000028 | 3300048903 | Bacteria | 113912 |
| 251 | Ga0496101_0000005 | 3300048904 | Bacteria | 331455 |
| 252 | Ga0496101_0000007 | 3300048904 | Bacteria | 321778 |
| 253 | Ga0496102_0000021 | 3300048905 | Bacteria | 246920 |
| 254 | Ga0496102_0248933 | 3300048905 | Bacteria | 1675 |
| 255 | Ga0496103_0000001 | 3300048906 | Bacteria | 643471 |
| 256 | Ga0496103_0068411 | 3300048906 | Bacteria | 2219 |
| 257 | Ga0496104_0000008 | 3300048907 | Bacteria | 516976 |
| 258 | Ga0496104_0000029 | 3300048907 | Bacteria | 202968 |
| 259 | Ga0496104_0000307 | 3300048907 | Bacteria | 43626 |
| 260 | Ga0496104_0049221 | 3300048907 | Bacteria | 3975 |
| 261 | Ga0496105_0000002 | 3300048908 | Bacteria | 753215 |
| 262 | Ga0496105_0000003 | 3300048908 | Bacteria | 713251 |
| 263 | Ga0496105_0000070 | 3300048908 | Bacteria | 80117 |
| 264 | Ga0496105_0047366 | 3300048908 | Bacteria | 3548 |
| 265 | Ga0496106_0000004 | 3300048909 | Bacteria | 279896 |
| 266 | Ga0496106_0000070 | 3300048909 | Bacteria | 82770 |
| 267 | Ga0496106_0000951 | 3300048909 | Bacteria | 21114 |
| 268 | Ga0496107_0000001 | 3300048910 | Bacteria | 321778 |
| 269 | Ga0496107_0000004 | 3300048910 | Bacteria | 297680 |
| 270 | Ga0496108_0000004 | 3300048911 | Bacteria | 545055 |
| 271 | Ga0496108_0000042 | 3300048911 | Bacteria | 146397 |
| 272 | Ga0496108_0003212 | 3300048911 | Bacteria | 13143 |
| 273 | Ga0496108_0010300 | 3300048911 | Bacteria | 7590 |
| 274 | Ga0496108_0010599 | 3300048911 | Bacteria | 7478 |
| 275 | Ga0496109_0000036 | 3300048912 | Bacteria | 153972 |
| 276 | Ga0496109_0000062 | 3300048912 | Bacteria | 112843 |
| 277 | Ga0496109_0000081 | 3300048912 | Bacteria | 99723 |
| 278 | Ga0496109_0000550 | 3300048912 | Bacteria | 31748 |
| 279 | Ga0496109_0296920 | 3300048912 | Bacteria | 1523 |
| 280 | Ga0496110_0000010 | 3300048913 | Bacteria | 102630 |
| 281 | Ga0496110_0061197 | 3300048913 | Bacteria | 3322 |
| 282 | Ga0496110_0080110 | 3300048913 | Bacteria | 2909 |
| 283 | Ga0496111_0002452 | 3300048914 | Bacteria | 11197 |
| 284 | Ga0496111_0003564 | 3300048914 | Bacteria | 9639 |
| 285 | Ga0496112_0000002 | 3300048915 | Bacteria | 782039 |
| 286 | Ga0496112_0017235 | 3300048915 | Bacteria | 6782 |
| 287 | Ga0496113_0000002 | 3300048916 | Bacteria | 220193 |
| 288 | Ga0496113_0117390 | 3300048916 | Bacteria | 2077 |
| 289 | Ga0496113_0248969 | 3300048916 | Bacteria | 1418 |
| 290 | Ga0496113_0250346 | 3300048916 | Bacteria | 1414 |
| 291 | Ga0496114_0000097 | 3300048917 | Bacteria | 63410 |
| 292 | Ga0496114_0026504 | 3300048917 | Bacteria | 4746 |
| 293 | Ga0496115_0000005 | 3300048918 | Bacteria | 290756 |
| 294 | Ga0496115_0000151 | 3300048918 | Bacteria | 64493 |
| 295 | Ga0496115_0066533 | 3300048918 | Unclassified | 2912 |
| 296 | Ga0496116_0000529 | 3300048919 | Bacteria | 51417 |
| 297 | Ga0496117_0018121 | 3300048920 | Bacteria | 5852 |
| 298 | Ga0496118_0015742 | 3300048921 | Bacteria | 6981 |
| 299 | Ga0496119_0101050 | 3300048922 | Bacteria | 1619 |
| 300 | Ga0496120_0012066 | 3300048923 | Bacteria | 5901 |
| 301 | Ga0496121_0046117 | 3300048924 | Bacteria | 3734 |
| 302 | Ga0496125_0016701 | 3300048928 | Bacteria | 7038 |
| 303 | Ga0496126_0074268 | 3300048929 | Bacteria | 3020 |
| 304 | Ga0501032_0003667 | 3300049569 | Bacteria | 11679 |
| 305 | Ga0501033_0002178 | 3300049570 | Bacteria | 16914 |
| 306 | Ga0501034_0071666 | 3300049571 | Bacteria | 3475 |
| 307 | Ga0501034_0127756 | 3300049571 | Bacteria | 2527 |
| 308 | Ga0501034_0133810 | 3300049571 | Bacteria | 2461 |
| 309 | Ga0501036_0001191 | 3300049572 | Bacteria | 19824 |
| 310 | Ga0501037_0007676 | 3300049573 | Bacteria | 7895 |
| 311 | Ga0501038_0018359 | 3300049574 | Bacteria | 6314 |
| 312 | Ga0501039_0222850 | 3300049575 | Bacteria | 1482 |
| 313 | Ga0501042_0221594 | 3300049578 | Bacteria | 1364 |
| 314 | Ga0501043_0012433 | 3300049579 | Bacteria | 6657 |
| 315 | Ga0501046_0001288 | 3300049580 | Bacteria | 24284 |
| 316 | Ga0501047_0012978 | 3300049581 | Bacteria | 7888 |
| 317 | Ga0501047_0047315 | 3300049581 | Bacteria | 4156 |
| 318 | Ga0501047_0102494 | 3300049581 | Bacteria | 2741 |
| 319 | Ga0501048_0001273 | 3300049582 | Bacteria | 19105 |
| 320 | Ga0501069_0004841 | 3300049585 | Bacteria | 6972 |
| 321 | Ga0501070_0031614 | 3300049586 | Bacteria | 4434 |
| 322 | Ga0501070_0035595 | 3300049586 | Bacteria | 4160 |
| 323 | Ga0501070_0126154 | 3300049586 | Bacteria | 2115 |
| 324 | Ga0501070_0149724 | 3300049586 | Bacteria | 1925 |
| 325 | Ga0501073_0027297 | 3300049589 | Bacteria | 4084 |
| 326 | Ga0501074_0025410 | 3300049590 | Bacteria | 4301 |
| 327 | Ga0501074_0036780 | 3300049590 | Bacteria | 3546 |
| 328 | Ga0501079_0105518 | 3300049741 | Bacteria | 2186 |
| 329 | Ga0501080_0043479 | 3300049742 | Bacteria | 4183 |
| 330 | Ga0501080_0056756 | 3300049742 | Bacteria | 3645 |
| 331 | Ga0501083_0015042 | 3300049744 | Bacteria | 5415 |
| 332 | Ga0501083_0022913 | 3300049744 | Bacteria | 4333 |
| 333 | Ga0501083_0071343 | 3300049744 | Bacteria | 2309 |
| 334 | Ga0501035_0000877 | 3300049822 | Bacteria | 31897 |
| 335 | Ga0501044_0051116 | 3300049823 | Bacteria | 4262 |
| 336 | Ga0501044_0320921 | 3300049823 | Bacteria | 1473 |
| 337 | Ga0501045_0016227 | 3300049824 | Bacteria | 5287 |
| 338 | nmdc:mga0yw44_32765_c1 | 3300050492 | Bacteria | 3031 |
| 339 | nmdc:mga0yw44_89961_c1 | 3300050492 | Bacteria | 1938 |
| 340 | nmdc:mga0a205_12683_c1 | 3300050515 | Bacteria | 7807 |
| 341 | nmdc:mga0a205_15_c2 | 3300050515 | Bacteria | 75060 |
| 342 | Ga0495601_0000065 | 3300053077 | Bacteria | 58386 |
| 343 | Ga0495601_0005931 | 3300053077 | Bacteria | 7124 |
| 344 | Ga0495601_0006099 | 3300053077 | Bacteria | 7033 |
| 345 | Ga0495601_0096648 | 3300053077 | Bacteria | 1905 |
| 346 | Ga0495612_0000088 | 3300053078 | Bacteria | 40813 |
| 347 | Ga0495612_0002972 | 3300053078 | Bacteria | 7039 |
| 348 | Ga0495612_0006400 | 3300053078 | Bacteria | 4841 |
| 349 | Ga0495655_0000013 | 3300053083 | Bacteria | 63264 |
| 350 | Ga0495655_0001661 | 3300053083 | Bacteria | 3444 |
| 351 | Ga0495595_0000005 | 3300053084 | Bacteria | 258660 |
| 352 | Ga0495595_0001230 | 3300053084 | Bacteria | 9958 |
| 353 | Ga0495619_0000036 | 3300053085 | Bacteria | 125188 |
| 354 | Ga0495619_0000069 | 3300053085 | Bacteria | 82755 |
| 355 | Ga0495619_0000489 | 3300053085 | Bacteria | 26595 |
| 356 | Ga0495619_0001068 | 3300053085 | Bacteria | 17953 |
| 357 | Ga0495619_0005329 | 3300053085 | Bacteria | 8144 |
| 358 | Ga0495619_0005750 | 3300053085 | Bacteria | 7857 |
| 359 | Ga0495619_0007514 | 3300053085 | Bacteria | 6903 |
| 360 | Ga0495619_0020344 | 3300053085 | Bacteria | 4225 |
| 361 | Ga0495619_0174771 | 3300053085 | Bacteria | 1486 |
| 362 | Ga0500566_0025552 | 3300053094 | Bacteria | 3461 |
| 363 | Ga0500566_0050024 | 3300053094 | Bacteria | 2394 |
| 364 | Ga0500641_0032788 | 3300053096 | Bacteria | 2057 |
| 365 | Ga0500595_021303 | 3300053119 | Bacteria | 2316 |
| 366 | Ga0500614_001762 | 3300053123 | Bacteria | 5029 |
| 367 | Ga0500628_000014 | 3300053129 | Bacteria | 102838 |
| 368 | Ga0265337_1000032 | |||
| 369 | CNAas_1002054 | |||
| 370 | JGI24746J21847_1000525 | |||
| 371 | JGI24740J21852_10019975 | |||
| 372 | JGI25404J52841_10010448 | |||
| 373 | Ga0070683_100064559 | |||
| 374 | Ga0070683_100104784 | |||
| 375 | Ga0070670_100217225 | |||
| 376 | Ga0070677_10000017 | |||
| 377 | Ga0070682_100000009 | |||
| 378 | Ga0070682_100000086 | |||
| 379 | Ga0068868_100003178 | |||
| 380 | Ga0070691_10000257 | |||
| 381 | Ga0070661_100000236 | |||
| 382 | Ga0070668_100007930 | |||
| 383 | Ga0070675_100000930 | |||
| 384 | Ga0070674_100000021 | |||
| 385 | Ga0070674_100000047 | |||
| 386 | Ga0070673_100002816 | |||
| 387 | Ga0070688_100007391 | |||
| 388 | Ga0070688_100018229 | |||
| 389 | Ga0070659_100014496 | |||
| 390 | Ga0070667_100005138 | |||
| 391 | Ga0070713_100007177 | |||
| 392 | Ga0070711_100008189 | |||
| 393 | Ga0070711_100017883 | |||
| 394 | Ga0070663_100016927 | |||
| 395 | Ga0070662_100000007 | |||
| 396 | Ga0070681_10069654 | |||
| 397 | Ga0068867_100005475 | |||
| 398 | Ga0070685_10005338 | |||
| 399 | Ga0070685_10006836 | |||
| 400 | Ga0070679_100002103 | |||
| 401 | Ga0070679_100012041 | |||
| 402 | Ga0070684_100036091 | |||
| 403 | Ga0070684_100048169 | |||
| 404 | Ga0070684_100089391 | |||
| 405 | Ga0070672_100000104 | |||
| 406 | Ga0070665_100000022 | |||
| 407 | Ga0070665_100035836 | |||
| 408 | Ga0070665_100169324 | |||
| 409 | Ga0070664_100059877 | |||
| 410 | Ga0070664_100099289 | |||
| 411 | Ga0068854_100002532 | |||
| 412 | Ga0068854_100019389 | |||
| 413 | Ga0068856_100017730 | |||
| 414 | Ga0068856_100023933 | |||
| 415 | Ga0068856_100065953 | |||
| 416 | Ga0068852_100001042 | |||
| 417 | Ga0068864_100000023 | |||
| 418 | Ga0068866_10000007 | |||
| 419 | Ga0068866_10000274 | |||
| 420 | Ga0068851_10002945 | |||
| 421 | Ga0068863_100000110 | |||
| 422 | Ga0068863_100153964 | |||
| 423 | Ga0068858_100000150 | |||
| 424 | Ga0068858_100000287 | |||
| 425 | Ga0068860_100021758 | |||
| 426 | Ga0068862_100030442 | |||
| 427 | Ga0081455_10005169 | |||
| 428 | Ga0081540_1000281 | |||
| 429 | Ga0081539_10002195 | |||
| 430 | Ga0070715_10000003 | |||
| 431 | Ga0070712_100002727 | |||
| 432 | Ga0075433_10001498 | |||
| 433 | Ga0068865_100000056 | |||
| 434 | Ga0105245_10000022 | |||
| 435 | Ga0105245_10007109 | |||
| 436 | Ga0105245_10014325 | |||
| 437 | Ga0105247_10000064 | |||
| 438 | Ga0105243_10075819 | |||
| 439 | Ga0105241_10008834 | |||
| 440 | Ga0105242_10002991 | |||
| 441 | Ga0105242_10003504 | |||
| 442 | Ga0105248_10001735 | |||
| 443 | Ga0105238_10000014 | |||
| 444 | Ga0105249_10010011 | |||
| 445 | Ga0105249_10063104 | |||
| 446 | Ga0105239_10040100 | |||
| 447 | Ga0105239_10061842 | |||
| 448 | Ga0157370_10168573 | |||
| 449 | Ga0157369_10000068 | |||
| 450 | Ga0157378_10015262 | |||
| 451 | Ga0157378_10051751 | |||
| 452 | Ga0157372_10008183 | |||
| 453 | Ga0157375_10009903 | |||
| 454 | Ga0157375_10012560 | |||
| 455 | Ga0157375_10165698 | |||
| 456 | Ga0157380_10000808 | |||
| 457 | Ga0157379_10015361 | |||
| 458 | Ga0157379_10035013 | |||
| 459 | Ga0163161_10000013 | |||
| 460 | Ga0163161_10015163 | |||
| 461 | Ga0206356_10615566 | |||
| 462 | Ga0224712_10002990 | |||
| 463 | Ga0207656_10001231 | |||
| 464 | Ga0207682_10000008 | |||
| 465 | Ga0207642_10000008 | |||
| 466 | Ga0207642_10000979 | |||
| 467 | Ga0207710_10000220 | |||
| 468 | Ga0207685_10000003 | |||
| 469 | Ga0207654_10030101 | |||
| 470 | Ga0207707_10007402 | |||
| 471 | Ga0207693_10001647 | |||
| 472 | Ga0207663_10025785 | |||
| 473 | Ga0207663_10058340 | |||
| 474 | Ga0207649_10000388 | |||
| 475 | Ga0207652_10000666 | |||
| 476 | Ga0207652_10000687 | |||
| 477 | Ga0207694_10000008 | |||
| 478 | Ga0207659_10000054 | |||
| 479 | Ga0207687_10000025 | |||
| 480 | Ga0207687_10000039 | |||
| 481 | Ga0207687_10000132 | |||
| 482 | Ga0207687_10011202 | |||
| 483 | Ga0207664_10147547 | |||
| 484 | Ga0207690_10046020 | |||
| 485 | Ga0207690_10057292 | |||
| 486 | Ga0207706_10000018 | |||
| 487 | Ga0207686_10000066 | |||
| 488 | Ga0207669_10000032 | |||
| 489 | Ga0207669_10000083 | |||
| 490 | Ga0207704_10000092 | |||
| 491 | Ga0207691_10000430 | |||
| 492 | Ga0207711_10000011 | |||
| 493 | Ga0207661_10008772 | |||
| 494 | Ga0207661_10014386 | |||
| 495 | Ga0207661_10018121 | |||
| 496 | Ga0207661_10175829 | |||
| 497 | Ga0207651_10001037 | |||
| 498 | Ga0207712_10000067 | |||
| 499 | Ga0207712_10004693 | |||
| 500 | Ga0207712_10090939 | |||
| 501 | Ga0207668_10085679 | |||
| 502 | Ga0207640_10000691 | |||
| 503 | Ga0207677_10000046 | |||
| 504 | Ga0207703_10000122 | |||
| 505 | Ga0207703_10001133 | |||
| 506 | Ga0207678_10002630 | |||
| 507 | Ga0207702_10001995 | |||
| 508 | Ga0207702_10012269 | |||
| 509 | Ga0207702_10013312 | |||
| 510 | Ga0207641_10000065 | |||
| 511 | Ga0207641_10016838 | |||
| 512 | Ga0207641_10132423 | |||
| 513 | Ga0207648_10005844 | |||
| 514 | Ga0207676_10000025 | |||
| 515 | Ga0207698_10000014 | |||
| 516 | Ga0268266_10000029 | |||
| 517 | Ga0268266_10114944 | |||
| 518 | Ga0268265_10042427 | |||
| 519 | Ga0268264_10034383 | |||
| 520 | Ga0265326_10000391 | |||
| 521 | Ga0265319_1000030 | |||
| 522 | Ga0265322_10000012 | |||
| 523 | Ga0265336_10001438 | |||
| 524 | Ga0265338_10000156 | |||
| 525 | Ga0265324_10000620 | |||
| 526 | Ga0265332_10048320 | |||
| 527 | Ga0265328_10002171 | |||
| 528 | Ga0265320_10000001 | |||
| 529 | Ga0265329_10005600 | |||
| 530 | Ga0265339_10036607 | |||
| 531 | Ga0265331_10012192 | |||
| 532 | Ga0265331_10020490 | |||
| 533 | Ga0265327_10000003 | |||
| 534 | Ga0265316_10015154 | |||
| 535 | Ga0265314_10000178 | |||
| 536 | Ga0316574_0079440 | |||
| 537 | Ga0373937_0069176 | |||
| 538 | Ga0373937_0162168 | |||
| 539 | Ga0316584_0030983 | |||
| 540 | Ga0451853_2210063 | |||
| 541 | Ga0466963_0000325 | |||
| 542 | Ga0466957_0011751 | |||
| 543 | Ga0466967_0000003 | |||
| 544 | Ga0495592_0141554 | |||
| 545 | Ga0495592_0175505 | |||
| 546 | Ga0495603_0000323 | |||
| 547 | Ga0495603_0000641 | |||
| 548 | Ga0495629_0011553 | |||
| 549 | Ga0495629_0013942 | |||
| 550 | Ga0495641_0000400 | |||
| 551 | Ga0495641_0020521 | |||
| 552 | Ga0495651_0179438 | |||
| 553 | Ga0495653_0105825 | |||
| 554 | Ga0495653_0170016 | |||
| 555 | Ga0495582_0000006 | |||
| 556 | Ga0495662_0000236 | |||
| 557 | Ga0495662_0091238 | |||
| 558 | Ga0495594_0000001 | |||
| 559 | Ga0495606_0000283 | |||
| 560 | Ga0495608_0000010 | |||
| 561 | Ga0495608_0007965 | |||
| 562 | Ga0495608_0030267 | |||
| 563 | Ga0495618_0000037 | |||
| 564 | Ga0495620_0000668 | |||
| 565 | Ga0495628_0000864 | |||
| 566 | Ga0495628_0127667 | |||
| 567 | Ga0495628_0138753 | |||
| 568 | Ga0495628_0263303 | |||
| 569 | Ga0495630_0000378 | |||
| 570 | Ga0495630_0005497 | |||
| 571 | Ga0495652_0000009 | |||
| 572 | Ga0495652_0029984 | |||
| 573 | Ga0495640_0017271 | |||
| 574 | Ga0495586_0025402 | |||
| 575 | Ga0495587_0065492 | |||
| 576 | Ga0495598_0004091 | |||
| 577 | Ga0495621_0020640 | |||
| 578 | Ga0495622_0000069 | |||
| 579 | Ga0495667_0000067 | |||
| 580 | Ga0495667_0042386 | |||
| 581 | Ga0495656_0005437 | |||
| 582 | Ga0495634_0000021 | |||
| 583 | Ga0495634_0000993 | |||
| 584 | Ga0495625_0000109 | |||
| 585 | Ga0495635_0000006 | |||
| 586 | Ga0495588_0000175 | |||
| 587 | Ga0495657_0000005 | |||
| 588 | Ga0495657_0019254 | |||
| 589 | Ga0495599_0009407 | |||
| 590 | Ga0495647_0000010 | |||
| 591 | Ga0495658_0000094 | |||
| 592 | Ga0495658_0001193 | |||
| 593 | Ga0495669_0001857 | |||
| 594 | Ga0495613_0000087 | |||
| 595 | Ga0495613_0000329 | |||
| 596 | Ga0495613_0231785 | |||
| 597 | Ga0495624_0000429 | |||
| 598 | Ga0495624_0000767 | |||
| 599 | Ga0495649_0003368 | |||
| 600 | Ga0495600_0019108 | |||
| 601 | Ga0495604_0000322 | |||
| 602 | Ga0495674_0000115 | |||
| 603 | Ga0495672_0066966 | |||
| 604 | Ga0495676_0001315 | |||
| 605 | Ga0495676_0009804 | |||
| 606 | Ga0495676_0113580 | |||
| 607 | Ga0495680_0001684 | |||
| 608 | Ga0495680_0001951 | |||
| 609 | Ga0495680_0006746 | |||
| 610 | Ga0495675_0000398 | |||
| 611 | Ga0495675_0032604 | |||
| 612 | Ga0495593_0043339 | |||
| 613 | Ga0495593_0094240 | |||
| 614 | Ga0495602_0000038 | |||
| 615 | Ga0495602_0018782 | |||
| 616 | Ga0496100_0000004 | |||
| 617 | Ga0496100_0000028 | |||
| 618 | Ga0496101_0000005 | |||
| 619 | Ga0496101_0000007 | |||
| 620 | Ga0496102_0000021 | |||
| 621 | Ga0496102_0248933 | |||
| 622 | Ga0496103_0000001 | |||
| 623 | Ga0496103_0068411 | |||
| 624 | Ga0496104_0000008 | |||
| 625 | Ga0496104_0000029 | |||
| 626 | Ga0496104_0000307 | |||
| 627 | Ga0496104_0049221 | |||
| 628 | Ga0496105_0000002 | |||
| 629 | Ga0496105_0000003 | |||
| 630 | Ga0496105_0000070 | |||
| 631 | Ga0496105_0047366 | |||
| 632 | Ga0496106_0000004 | |||
| 633 | Ga0496106_0000070 | |||
| 634 | Ga0496106_0000951 | |||
| 635 | Ga0496107_0000001 | |||
| 636 | Ga0496107_0000004 | |||
| 637 | Ga0496108_0000004 | |||
| 638 | Ga0496108_0000042 | |||
| 639 | Ga0496108_0003212 | |||
| 640 | Ga0496108_0010300 | |||
| 641 | Ga0496108_0010599 | |||
| 642 | Ga0496109_0000036 | |||
| 643 | Ga0496109_0000062 | |||
| 644 | Ga0496109_0000081 | |||
| 645 | Ga0496109_0000550 | |||
| 646 | Ga0496109_0296920 | |||
| 647 | Ga0496110_0000010 | |||
| 648 | Ga0496110_0061197 | |||
| 649 | Ga0496110_0080110 | |||
| 650 | Ga0496111_0002452 | |||
| 651 | Ga0496111_0003564 | |||
| 652 | Ga0496112_0000002 | |||
| 653 | Ga0496112_0017235 | |||
| 654 | Ga0496113_0000002 | |||
| 655 | Ga0496113_0117390 | |||
| 656 | Ga0496113_0248969 | |||
| 657 | Ga0496113_0250346 | |||
| 658 | Ga0496114_0000097 | |||
| 659 | Ga0496114_0026504 | |||
| 660 | Ga0496115_0000005 | |||
| 661 | Ga0496115_0000151 | |||
| 662 | Ga0496115_0066533 | |||
| 663 | Ga0496116_0000529 | |||
| 664 | Ga0496117_0018121 | |||
| 665 | Ga0496118_0015742 | |||
| 666 | Ga0496119_0101050 | |||
| 667 | Ga0496120_0012066 | |||
| 668 | Ga0496121_0046117 | |||
| 669 | Ga0496125_0016701 | |||
| 670 | Ga0496126_0074268 | |||
| 671 | Ga0501032_0003667 | |||
| 672 | Ga0501033_0002178 | |||
| 673 | Ga0501034_0071666 | |||
| 674 | Ga0501034_0127756 | |||
| 675 | Ga0501034_0133810 | |||
| 676 | Ga0501036_0001191 | |||
| 677 | Ga0501037_0007676 | |||
| 678 | Ga0501038_0018359 | |||
| 679 | Ga0501039_0222850 | |||
| 680 | Ga0501042_0221594 | |||
| 681 | Ga0501043_0012433 | |||
| 682 | Ga0501046_0001288 | |||
| 683 | Ga0501047_0012978 | |||
| 684 | Ga0501047_0047315 | |||
| 685 | Ga0501047_0102494 | |||
| 686 | Ga0501048_0001273 | |||
| 687 | Ga0501069_0004841 | |||
| 688 | Ga0501070_0031614 | |||
| 689 | Ga0501070_0035595 | |||
| 690 | Ga0501070_0126154 | |||
| 691 | Ga0501070_0149724 | |||
| 692 | Ga0501073_0027297 | |||
| 693 | Ga0501074_0025410 | |||
| 694 | Ga0501074_0036780 | |||
| 695 | Ga0501079_0105518 | |||
| 696 | Ga0501080_0043479 | |||
| 697 | Ga0501080_0056756 | |||
| 698 | Ga0501083_0015042 | |||
| 699 | Ga0501083_0022913 | |||
| 700 | Ga0501083_0071343 | |||
| 701 | Ga0501035_0000877 | |||
| 702 | Ga0501044_0051116 | |||
| 703 | Ga0501044_0320921 | |||
| 704 | Ga0501045_0016227 | |||
| 705 | nmdc:mga0yw44_32765_c1 | |||
| 706 | nmdc:mga0yw44_89961_c1 | |||
| 707 | nmdc:mga0a205_12683_c1 | |||
| 708 | nmdc:mga0a205_15_c2 | |||
| 709 | Ga0495601_0000065 | |||
| 710 | Ga0495601_0005931 | |||
| 711 | Ga0495601_0006099 | |||
| 712 | Ga0495601_0096648 | |||
| 713 | Ga0495612_0000088 | |||
| 714 | Ga0495612_0002972 | |||
| 715 | Ga0495612_0006400 | |||
| 716 | Ga0495655_0000013 | |||
| 717 | Ga0495655_0001661 | |||
| 718 | Ga0495595_0000005 | |||
| 719 | Ga0495595_0001230 | |||
| 720 | Ga0495619_0000036 | |||
| 721 | Ga0495619_0000069 | |||
| 722 | Ga0495619_0000489 | |||
| 723 | Ga0495619_0001068 | |||
| 724 | Ga0495619_0005329 | |||
| 725 | Ga0495619_0005750 | |||
| 726 | Ga0495619_0007514 | |||
| 727 | Ga0495619_0020344 | |||
| 728 | Ga0495619_0174771 | |||
| 729 | Ga0500566_0025552 | |||
| 730 | Ga0500566_0050024 | |||
| 731 | Ga0500641_0032788 | |||
| 732 | Ga0500595_021303 | |||
| 733 | Ga0500614_001762 | |||
| 734 | Ga0500628_000014 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7lat-assembly1.cif.gz_A | campylobacter jejuni keto-acid reductoisomerase in complex with mg2+ | 0.9434 | 5 | 31 |
| 4oqy-assembly1.cif.gz_B | streptomyces sp. gf3546 imine reductase | 0.926 | 4 | 32 |
| 6l2k-assembly1.cif.gz_B | ilvc, a ketol-acid reductoisomerase, from streptococcus pneumoniae_r49e | 0.9214 | 5 | 31 |
| 6eod-assembly1.cif.gz_A | structure of reductive aminase from aspergillus terreus in complex with nadph | 0.9209 | 4 | 32 |
| 6toe-assembly3.cif.gz_D | imine reductase from myxococcus stipitatus v8 variant in complex with nad+ | 0.9195 | 4 | 33 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57604_107_240_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9861 | 4 | 34 | 3.40.50.720 |
| af_Q2FZ31_2_179_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.958 | 4 | 34 | 3.50.50.60 |
| af_Q2G2A7_273_342_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.93 | 91 | 120 | 2.40.50.140 |
| 4oqyB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.926 | 4 | 32 | 3.40.50.720 |
| af_P45522_400_562_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9257 | 4 | 34 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A838PQ62-F1-model_v4 | Flavin-containing monooxygenase 5 (EC 1.6.3.1) (Dimethylaniline monooxygenase [N-oxide-forming] 5) (Dimethylaniline oxidase 5) (NADPH oxidase) | 0.9654 | 128 | 421 |
GO:0004499
GO:0006629 GO:0050660 GO:0050661 |
| AF-A0A522F095-F1-model_v4 | Monooxygenase | 0.947 | 151 | 415 |
GO:0004499
GO:0050660 GO:0050661 |
| AF-M3G3V3-F1-model_v4 | Flavin-binding monooxygenase-like domain protein | 0.9458 | 177 | 374 |
GO:0004499
GO:0050660 GO:0050661 |
| AF-A0A353PAW9-F1-model_v4 | Monooxygenase | 0.9397 | 241 | 420 |
GO:0004499
GO:0050660 GO:0050661 |
| AF-A0A4V2Y667-F1-model_v4 | Monooxygenase | 0.9368 | 106 | 419 |
GO:0004499
GO:0050660 GO:0050661 |