F424387

General Info

Members Datasets Scaffolds Average Seq Length
367 230 734 433

Family's Representative Sequence

Representative Sequence 3300028556|Ga0265337_1000032|Ga0265337_100003244
Length 464
Sequence VELFTPGQAVWPGSQSRVRLDRFHGVTAAEKVCVIGAGSSGIASCQVLSARRIPYDCFEKGSQVGGNWRFENDNGQSSAYRSLHINSSRKLMAFKTFPMPDHLPDYPSHFQIAKYFDDFVEHFGLRDNIRFRTTVLSVEPVDGEWEVTVEDAEGKRETIRYRAVLVANGHHWDPRWPEPAFPGSEEFTGEQLHVHHYREPDVLEGKRVLVLGIGNSATDIAVESSRIADKTFLTMRRGAYVLPKFLNGKPVDEAAPPIASRLPLSVQRFFMARMLDMAAGDMTSYGLPQPDHKLLEAHPTVSSELLPRLGHGDILVKPNIDRFSGGRTVRFVDGSEEEIDLVVYCTGYKITFPFFDEQVVAARDNRLQLYRRVVSAAHPGLFFIGFIQPLGPIMPIAEAQSEWIADILGGRCSLPSPAEMQSEIAAAERKMKKRYVASKRHTIQVDFHPYLREIRRERKQAARA

Samples

Sample ID Description Type Environment
1 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
107 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
108 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
109 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
112 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
113 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
114 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
115 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
116 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
117 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
118 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
119 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
120 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
121 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
124 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
125 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
126 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
127 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
128 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
129 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
130 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
131 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
132 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
133 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
134 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
135 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
136 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
137 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
138 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
139 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
140 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
141 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
142 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
143 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
144 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
145 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
146 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
147 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
148 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
149 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
150 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
151 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
152 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
153 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
154 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
155 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
156 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
157 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
158 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
159 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
160 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
161 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
162 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
163 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
164 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
165 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
168 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
169 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
170 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
171 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
172 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
190 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
191 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
192 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
193 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
194 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
195 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
196 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
197 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
210 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
211 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
212 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
213 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
219 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
220 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
221 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
222 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
223 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
224 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
225 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
226 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
227 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
228 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
229 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
230 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0.54
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.18
Nodule 0
Rhizoplane 12.81
Rhizosphere 82.56
Stem 0
Stem Tuber 0
Unclassified 0.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265337_1000032 3300028556 Bacteria 61342
2 CNAas_1002054 3300000532 Bacteria 1511
3 JGI24746J21847_1000525 3300001977 Bacteria 5740
4 JGI24740J21852_10019975 3300001979 Bacteria 2349
5 JGI25404J52841_10010448 3300003659 Bacteria 1995
6 Ga0070683_100064559 3300005329 Bacteria 3408
7 Ga0070683_100104784 3300005329 Bacteria 2665
8 Ga0070670_100217225 3300005331 Bacteria 1663
9 Ga0070677_10000017 3300005333 Bacteria 52010
10 Ga0070682_100000009 3300005337 Bacteria 291635
11 Ga0070682_100000086 3300005337 Bacteria 83703
12 Ga0068868_100003178 3300005338 Bacteria 11437
13 Ga0070691_10000257 3300005341 Bacteria 18341
14 Ga0070661_100000236 3300005344 Bacteria 45535
15 Ga0070668_100007930 3300005347 Bacteria 7884
16 Ga0070675_100000930 3300005354 Bacteria 20823
17 Ga0070674_100000021 3300005356 Bacteria 87134
18 Ga0070674_100000047 3300005356 Bacteria 52597
19 Ga0070673_100002816 3300005364 Bacteria 10695
20 Ga0070688_100007391 3300005365 Bacteria 5918
21 Ga0070688_100018229 3300005365 Bacteria 4047
22 Ga0070659_100014496 3300005366 Bacteria 5891
23 Ga0070667_100005138 3300005367 Bacteria 10956
24 Ga0070713_100007177 3300005436 Bacteria 7798
25 Ga0070711_100008189 3300005439 Bacteria 6391
26 Ga0070711_100017883 3300005439 Bacteria 4518
27 Ga0070663_100016927 3300005455 Bacteria 4745
28 Ga0070662_100000007 3300005457 Bacteria 168761
29 Ga0070681_10069654 3300005458 Bacteria 3484
30 Ga0068867_100005475 3300005459 Bacteria 8983
31 Ga0070685_10005338 3300005466 Bacteria 6516
32 Ga0070685_10006836 3300005466 Bacteria 5824
33 Ga0070679_100002103 3300005530 Bacteria 17941
34 Ga0070679_100012041 3300005530 Bacteria 8256
35 Ga0070684_100036091 3300005535 Bacteria 4235
36 Ga0070684_100048169 3300005535 Bacteria 3696
37 Ga0070684_100089391 3300005535 Bacteria 2737
38 Ga0070672_100000104 3300005543 Bacteria 42077
39 Ga0070665_100000022 3300005548 Bacteria 379286
40 Ga0070665_100035836 3300005548 Bacteria 4991
41 Ga0070665_100169324 3300005548 Bacteria 2186
42 Ga0070664_100059877 3300005564 Bacteria 3241
43 Ga0070664_100099289 3300005564 Bacteria 2530
44 Ga0068854_100002532 3300005578 Bacteria 11318
45 Ga0068854_100019389 3300005578 Bacteria 4583
46 Ga0068856_100017730 3300005614 Bacteria 6905
47 Ga0068856_100023933 3300005614 Bacteria 5939
48 Ga0068856_100065953 3300005614 Bacteria 3577
49 Ga0068852_100001042 3300005616 Bacteria 18249
50 Ga0068864_100000023 3300005618 Bacteria 257064
51 Ga0068866_10000007 3300005718 Bacteria 121729
52 Ga0068866_10000274 3300005718 Bacteria 24536
53 Ga0068851_10002945 3300005834 Bacteria 7523
54 Ga0068863_100000110 3300005841 Bacteria 86415
55 Ga0068863_100153964 3300005841 Bacteria 2200
56 Ga0068858_100000150 3300005842 Bacteria 73075
57 Ga0068858_100000287 3300005842 Bacteria 54456
58 Ga0068860_100021758 3300005843 Bacteria 6205
59 Ga0068862_100030442 3300005844 Bacteria 4549
60 Ga0081455_10005169 3300005937 Bacteria 14366
61 Ga0081540_1000281 3300005983 Bacteria 52990
62 Ga0081539_10002195 3300005985 Bacteria 28613
63 Ga0070715_10000003 3300006163 Bacteria 345282
64 Ga0070712_100002727 3300006175 Bacteria 10900
65 Ga0075433_10001498 3300006852 Bacteria 17252
66 Ga0068865_100000056 3300006881 Bacteria 62122
67 Ga0105245_10000022 3300009098 Bacteria 181225
68 Ga0105245_10007109 3300009098 Bacteria 9818
69 Ga0105245_10014325 3300009098 Bacteria 6909
70 Ga0105247_10000064 3300009101 Bacteria 123994
71 Ga0105243_10075819 3300009148 Bacteria 2731
72 Ga0105241_10008834 3300009174 Bacteria 7406
73 Ga0105242_10002991 3300009176 Bacteria 13227
74 Ga0105242_10003504 3300009176 Bacteria 12198
75 Ga0105248_10001735 3300009177 Bacteria 24226
76 Ga0105238_10000014 3300009551 Bacteria 241954
77 Ga0105249_10010011 3300009553 Bacteria 8320
78 Ga0105249_10063104 3300009553 Bacteria 3403
79 Ga0105239_10040100 3300010375 Bacteria 5130
80 Ga0105239_10061842 3300010375 Bacteria 4110
81 Ga0157370_10168573 3300013104 Bacteria 2036
82 Ga0157369_10000068 3300013105 Bacteria 144274
83 Ga0157378_10015262 3300013297 Bacteria 6727
84 Ga0157378_10051751 3300013297 Bacteria 3654
85 Ga0157372_10008183 3300013307 Bacteria 11117
86 Ga0157375_10009903 3300013308 Bacteria 8384
87 Ga0157375_10012560 3300013308 Bacteria 7517
88 Ga0157375_10165698 3300013308 Bacteria 2354
89 Ga0157380_10000808 3300014326 Bacteria 19608
90 Ga0157379_10015361 3300014968 Bacteria 6718
91 Ga0157379_10035013 3300014968 Bacteria 4475
92 Ga0163161_10000013 3300017792 Bacteria 258747
93 Ga0163161_10015163 3300017792 Bacteria 5370
94 Ga0206356_10615566 3300020070 Bacteria 1526
95 Ga0224712_10002990 3300022467 Bacteria 4296
96 Ga0207656_10001231 3300025321 Bacteria 8452
97 Ga0207682_10000008 3300025893 Bacteria 87020
98 Ga0207642_10000008 3300025899 Bacteria 132651
99 Ga0207642_10000979 3300025899 Bacteria 8909
100 Ga0207710_10000220 3300025900 Bacteria 50023
101 Ga0207685_10000003 3300025905 Bacteria 344527
102 Ga0207654_10030101 3300025911 Bacteria 2977
103 Ga0207707_10007402 3300025912 Bacteria 9561
104 Ga0207693_10001647 3300025915 Bacteria 19699
105 Ga0207663_10025785 3300025916 Bacteria 3404
106 Ga0207663_10058340 3300025916 Bacteria 2435
107 Ga0207649_10000388 3300025920 Bacteria 32980
108 Ga0207652_10000666 3300025921 Bacteria 33621
109 Ga0207652_10000687 3300025921 Bacteria 32979
110 Ga0207694_10000008 3300025924 Bacteria 484902
111 Ga0207659_10000054 3300025926 Bacteria 76823
112 Ga0207687_10000025 3300025927 Bacteria 175177
113 Ga0207687_10000039 3300025927 Bacteria 114303
114 Ga0207687_10000132 3300025927 Bacteria 50024
115 Ga0207687_10011202 3300025927 Bacteria 5856
116 Ga0207664_10147547 3300025929 Bacteria 1996
117 Ga0207690_10046020 3300025932 Bacteria 2887
118 Ga0207690_10057292 3300025932 Bacteria 2632
119 Ga0207706_10000018 3300025933 Bacteria 168729
120 Ga0207686_10000066 3300025934 Bacteria 95095
121 Ga0207669_10000032 3300025937 Bacteria 82757
122 Ga0207669_10000083 3300025937 Bacteria 47557
123 Ga0207704_10000092 3300025938 Bacteria 52383
124 Ga0207691_10000430 3300025940 Bacteria 41789
125 Ga0207711_10000011 3300025941 Bacteria 518817
126 Ga0207661_10008772 3300025944 Bacteria 7232
127 Ga0207661_10014386 3300025944 Bacteria 5799
128 Ga0207661_10018121 3300025944 Bacteria 5229
129 Ga0207661_10175829 3300025944 Bacteria 1866
130 Ga0207651_10001037 3300025960 Bacteria 12286
131 Ga0207712_10000067 3300025961 Bacteria 130079
132 Ga0207712_10004693 3300025961 Bacteria 8638
133 Ga0207712_10090939 3300025961 Bacteria 2247
134 Ga0207668_10085679 3300025972 Bacteria 2300
135 Ga0207640_10000691 3300025981 Bacteria 19634
136 Ga0207677_10000046 3300026023 Bacteria 105382
137 Ga0207703_10000122 3300026035 Bacteria 92656
138 Ga0207703_10001133 3300026035 Bacteria 25156
139 Ga0207678_10002630 3300026067 Bacteria 16356
140 Ga0207702_10001995 3300026078 Bacteria 19804
141 Ga0207702_10012269 3300026078 Bacteria 7131
142 Ga0207702_10013312 3300026078 Bacteria 6842
143 Ga0207641_10000065 3300026088 Bacteria 156066
144 Ga0207641_10016838 3300026088 Bacteria 5986
145 Ga0207641_10132423 3300026088 Bacteria 2240
146 Ga0207648_10005844 3300026089 Bacteria 12319
147 Ga0207676_10000025 3300026095 Bacteria 261714
148 Ga0207698_10000014 3300026142 Bacteria 240703
149 Ga0268266_10000029 3300028379 Bacteria 424015
150 Ga0268266_10114944 3300028379 Bacteria 2388
151 Ga0268265_10042427 3300028380 Bacteria 3375
152 Ga0268264_10034383 3300028381 Bacteria 4169
153 Ga0265326_10000391 3300028558 Bacteria 17570
154 Ga0265319_1000030 3300028563 Bacteria 129742
155 Ga0265322_10000012 3300028654 Bacteria 152373
156 Ga0265336_10001438 3300028666 Bacteria 10856
157 Ga0265338_10000156 3300028800 Bacteria 125065
158 Ga0265324_10000620 3300029957 Bacteria 24187
159 Ga0265332_10048320 3300031238 Bacteria 1830
160 Ga0265328_10002171 3300031239 Bacteria 8852
161 Ga0265320_10000001 3300031240 Bacteria 847191
162 Ga0265329_10005600 3300031242 Bacteria 5061
163 Ga0265339_10036607 3300031249 Bacteria 2746
164 Ga0265331_10012192 3300031250 Bacteria 4665
165 Ga0265331_10020490 3300031250 Bacteria 3393
166 Ga0265327_10000003 3300031251 Bacteria 852750
167 Ga0265316_10015154 3300031344 Bacteria 6752
168 Ga0265314_10000178 3300031711 Bacteria 94070
169 Ga0316574_0079440 3300035398 Bacteria 2081
170 Ga0373937_0069176 3300036401 Bacteria 3254
171 Ga0373937_0162168 3300036401 Bacteria 2096
172 Ga0316584_0030983 3300036712 Bacteria 3954
173 Ga0451853_2210063 3300041512 Bacteria 4015
174 Ga0466963_0000325 3300044694 Bacteria 21618
175 Ga0466957_0011751 3300044842 Bacteria 5060
176 Ga0466967_0000003 3300045976 Bacteria 169144
177 Ga0495592_0141554 3300046454 Bacteria 1672
178 Ga0495592_0175505 3300046454 Bacteria 1464
179 Ga0495603_0000323 3300046455 Bacteria 25798
180 Ga0495603_0000641 3300046455 Bacteria 19699
181 Ga0495629_0011553 3300046459 Bacteria 6414
182 Ga0495629_0013942 3300046459 Bacteria 5794
183 Ga0495641_0000400 3300046461 Bacteria 36235
184 Ga0495641_0020521 3300046461 Bacteria 3347
185 Ga0495651_0179438 3300046462 Bacteria 1500
186 Ga0495653_0105825 3300046463 Bacteria 2030
187 Ga0495653_0170016 3300046463 Bacteria 1505
188 Ga0495582_0000006 3300046473 Bacteria 140434
189 Ga0495662_0000236 3300046476 Bacteria 23206
190 Ga0495662_0091238 3300046476 Bacteria 1485
191 Ga0495594_0000001 3300046499 Bacteria 293051
192 Ga0495606_0000283 3300046507 Bacteria 88309
193 Ga0495608_0000010 3300046511 Bacteria 258660
194 Ga0495608_0007965 3300046511 Bacteria 7446
195 Ga0495608_0030267 3300046511 Bacteria 3666
196 Ga0495618_0000037 3300046514 Bacteria 99735
197 Ga0495620_0000668 3300046515 Bacteria 21158
198 Ga0495628_0000864 3300046516 Bacteria 28036
199 Ga0495628_0127667 3300046516 Bacteria 1947
200 Ga0495628_0138753 3300046516 Bacteria 1856
201 Ga0495628_0263303 3300046516 Bacteria 1284
202 Ga0495630_0000378 3300046517 Bacteria 35012
203 Ga0495630_0005497 3300046517 Bacteria 8945
204 Ga0495652_0000009 3300046529 Bacteria 311000
205 Ga0495652_0029984 3300046529 Bacteria 4773
206 Ga0495640_0017271 3300046533 Bacteria 5380
207 Ga0495586_0025402 3300046535 Bacteria 3170
208 Ga0495587_0065492 3300046536 Bacteria 2121
209 Ga0495598_0004091 3300046537 Bacteria 3138
210 Ga0495621_0020640 3300046539 Bacteria 2164
211 Ga0495622_0000069 3300046557 Bacteria 89759
212 Ga0495667_0000067 3300046559 Bacteria 81751
213 Ga0495667_0042386 3300046559 Bacteria 3018
214 Ga0495656_0005437 3300046615 Bacteria 4399
215 Ga0495634_0000021 3300046642 Bacteria 120521
216 Ga0495634_0000993 3300046642 Bacteria 26739
217 Ga0495625_0000109 3300046660 Bacteria 125064
218 Ga0495635_0000006 3300046663 Bacteria 301820
219 Ga0495588_0000175 3300046674 Bacteria 80911
220 Ga0495657_0000005 3300046675 Bacteria 254860
221 Ga0495657_0019254 3300046675 Bacteria 4927
222 Ga0495599_0009407 3300046678 Bacteria 5973
223 Ga0495647_0000010 3300046681 Bacteria 94696
224 Ga0495658_0000094 3300046683 Bacteria 46061
225 Ga0495658_0001193 3300046683 Bacteria 13694
226 Ga0495669_0001857 3300046684 Bacteria 8658
227 Ga0495613_0000087 3300046689 Bacteria 88644
228 Ga0495613_0000329 3300046689 Bacteria 42819
229 Ga0495613_0231785 3300046689 Bacteria 1293
230 Ga0495624_0000429 3300046690 Bacteria 33305
231 Ga0495624_0000767 3300046690 Bacteria 25280
232 Ga0495649_0003368 3300046694 Bacteria 10827
233 Ga0495600_0019108 3300046809 Bacteria 4372
234 Ga0495604_0000322 3300047317 Bacteria 42966
235 Ga0495674_0000115 3300047319 Bacteria 60282
236 Ga0495672_0066966 3300047320 Bacteria 2047
237 Ga0495676_0001315 3300047321 Bacteria 21280
238 Ga0495676_0009804 3300047321 Bacteria 8700
239 Ga0495676_0113580 3300047321 Bacteria 1983
240 Ga0495680_0001684 3300047322 Bacteria 23470
241 Ga0495680_0001951 3300047322 Bacteria 21721
242 Ga0495680_0006746 3300047322 Bacteria 10616
243 Ga0495675_0000398 3300047444 Bacteria 30075
244 Ga0495675_0032604 3300047444 Bacteria 3324
245 Ga0495593_0043339 3300047673 Bacteria 2412
246 Ga0495593_0094240 3300047673 Bacteria 1540
247 Ga0495602_0000038 3300048088 Bacteria 130758
248 Ga0495602_0018782 3300048088 Bacteria 6888
249 Ga0496100_0000004 3300048903 Bacteria 321778
250 Ga0496100_0000028 3300048903 Bacteria 113912
251 Ga0496101_0000005 3300048904 Bacteria 331455
252 Ga0496101_0000007 3300048904 Bacteria 321778
253 Ga0496102_0000021 3300048905 Bacteria 246920
254 Ga0496102_0248933 3300048905 Bacteria 1675
255 Ga0496103_0000001 3300048906 Bacteria 643471
256 Ga0496103_0068411 3300048906 Bacteria 2219
257 Ga0496104_0000008 3300048907 Bacteria 516976
258 Ga0496104_0000029 3300048907 Bacteria 202968
259 Ga0496104_0000307 3300048907 Bacteria 43626
260 Ga0496104_0049221 3300048907 Bacteria 3975
261 Ga0496105_0000002 3300048908 Bacteria 753215
262 Ga0496105_0000003 3300048908 Bacteria 713251
263 Ga0496105_0000070 3300048908 Bacteria 80117
264 Ga0496105_0047366 3300048908 Bacteria 3548
265 Ga0496106_0000004 3300048909 Bacteria 279896
266 Ga0496106_0000070 3300048909 Bacteria 82770
267 Ga0496106_0000951 3300048909 Bacteria 21114
268 Ga0496107_0000001 3300048910 Bacteria 321778
269 Ga0496107_0000004 3300048910 Bacteria 297680
270 Ga0496108_0000004 3300048911 Bacteria 545055
271 Ga0496108_0000042 3300048911 Bacteria 146397
272 Ga0496108_0003212 3300048911 Bacteria 13143
273 Ga0496108_0010300 3300048911 Bacteria 7590
274 Ga0496108_0010599 3300048911 Bacteria 7478
275 Ga0496109_0000036 3300048912 Bacteria 153972
276 Ga0496109_0000062 3300048912 Bacteria 112843
277 Ga0496109_0000081 3300048912 Bacteria 99723
278 Ga0496109_0000550 3300048912 Bacteria 31748
279 Ga0496109_0296920 3300048912 Bacteria 1523
280 Ga0496110_0000010 3300048913 Bacteria 102630
281 Ga0496110_0061197 3300048913 Bacteria 3322
282 Ga0496110_0080110 3300048913 Bacteria 2909
283 Ga0496111_0002452 3300048914 Bacteria 11197
284 Ga0496111_0003564 3300048914 Bacteria 9639
285 Ga0496112_0000002 3300048915 Bacteria 782039
286 Ga0496112_0017235 3300048915 Bacteria 6782
287 Ga0496113_0000002 3300048916 Bacteria 220193
288 Ga0496113_0117390 3300048916 Bacteria 2077
289 Ga0496113_0248969 3300048916 Bacteria 1418
290 Ga0496113_0250346 3300048916 Bacteria 1414
291 Ga0496114_0000097 3300048917 Bacteria 63410
292 Ga0496114_0026504 3300048917 Bacteria 4746
293 Ga0496115_0000005 3300048918 Bacteria 290756
294 Ga0496115_0000151 3300048918 Bacteria 64493
295 Ga0496115_0066533 3300048918 Unclassified 2912
296 Ga0496116_0000529 3300048919 Bacteria 51417
297 Ga0496117_0018121 3300048920 Bacteria 5852
298 Ga0496118_0015742 3300048921 Bacteria 6981
299 Ga0496119_0101050 3300048922 Bacteria 1619
300 Ga0496120_0012066 3300048923 Bacteria 5901
301 Ga0496121_0046117 3300048924 Bacteria 3734
302 Ga0496125_0016701 3300048928 Bacteria 7038
303 Ga0496126_0074268 3300048929 Bacteria 3020
304 Ga0501032_0003667 3300049569 Bacteria 11679
305 Ga0501033_0002178 3300049570 Bacteria 16914
306 Ga0501034_0071666 3300049571 Bacteria 3475
307 Ga0501034_0127756 3300049571 Bacteria 2527
308 Ga0501034_0133810 3300049571 Bacteria 2461
309 Ga0501036_0001191 3300049572 Bacteria 19824
310 Ga0501037_0007676 3300049573 Bacteria 7895
311 Ga0501038_0018359 3300049574 Bacteria 6314
312 Ga0501039_0222850 3300049575 Bacteria 1482
313 Ga0501042_0221594 3300049578 Bacteria 1364
314 Ga0501043_0012433 3300049579 Bacteria 6657
315 Ga0501046_0001288 3300049580 Bacteria 24284
316 Ga0501047_0012978 3300049581 Bacteria 7888
317 Ga0501047_0047315 3300049581 Bacteria 4156
318 Ga0501047_0102494 3300049581 Bacteria 2741
319 Ga0501048_0001273 3300049582 Bacteria 19105
320 Ga0501069_0004841 3300049585 Bacteria 6972
321 Ga0501070_0031614 3300049586 Bacteria 4434
322 Ga0501070_0035595 3300049586 Bacteria 4160
323 Ga0501070_0126154 3300049586 Bacteria 2115
324 Ga0501070_0149724 3300049586 Bacteria 1925
325 Ga0501073_0027297 3300049589 Bacteria 4084
326 Ga0501074_0025410 3300049590 Bacteria 4301
327 Ga0501074_0036780 3300049590 Bacteria 3546
328 Ga0501079_0105518 3300049741 Bacteria 2186
329 Ga0501080_0043479 3300049742 Bacteria 4183
330 Ga0501080_0056756 3300049742 Bacteria 3645
331 Ga0501083_0015042 3300049744 Bacteria 5415
332 Ga0501083_0022913 3300049744 Bacteria 4333
333 Ga0501083_0071343 3300049744 Bacteria 2309
334 Ga0501035_0000877 3300049822 Bacteria 31897
335 Ga0501044_0051116 3300049823 Bacteria 4262
336 Ga0501044_0320921 3300049823 Bacteria 1473
337 Ga0501045_0016227 3300049824 Bacteria 5287
338 nmdc:mga0yw44_32765_c1 3300050492 Bacteria 3031
339 nmdc:mga0yw44_89961_c1 3300050492 Bacteria 1938
340 nmdc:mga0a205_12683_c1 3300050515 Bacteria 7807
341 nmdc:mga0a205_15_c2 3300050515 Bacteria 75060
342 Ga0495601_0000065 3300053077 Bacteria 58386
343 Ga0495601_0005931 3300053077 Bacteria 7124
344 Ga0495601_0006099 3300053077 Bacteria 7033
345 Ga0495601_0096648 3300053077 Bacteria 1905
346 Ga0495612_0000088 3300053078 Bacteria 40813
347 Ga0495612_0002972 3300053078 Bacteria 7039
348 Ga0495612_0006400 3300053078 Bacteria 4841
349 Ga0495655_0000013 3300053083 Bacteria 63264
350 Ga0495655_0001661 3300053083 Bacteria 3444
351 Ga0495595_0000005 3300053084 Bacteria 258660
352 Ga0495595_0001230 3300053084 Bacteria 9958
353 Ga0495619_0000036 3300053085 Bacteria 125188
354 Ga0495619_0000069 3300053085 Bacteria 82755
355 Ga0495619_0000489 3300053085 Bacteria 26595
356 Ga0495619_0001068 3300053085 Bacteria 17953
357 Ga0495619_0005329 3300053085 Bacteria 8144
358 Ga0495619_0005750 3300053085 Bacteria 7857
359 Ga0495619_0007514 3300053085 Bacteria 6903
360 Ga0495619_0020344 3300053085 Bacteria 4225
361 Ga0495619_0174771 3300053085 Bacteria 1486
362 Ga0500566_0025552 3300053094 Bacteria 3461
363 Ga0500566_0050024 3300053094 Bacteria 2394
364 Ga0500641_0032788 3300053096 Bacteria 2057
365 Ga0500595_021303 3300053119 Bacteria 2316
366 Ga0500614_001762 3300053123 Bacteria 5029
367 Ga0500628_000014 3300053129 Bacteria 102838
368 Ga0265337_1000032
369 CNAas_1002054
370 JGI24746J21847_1000525
371 JGI24740J21852_10019975
372 JGI25404J52841_10010448
373 Ga0070683_100064559
374 Ga0070683_100104784
375 Ga0070670_100217225
376 Ga0070677_10000017
377 Ga0070682_100000009
378 Ga0070682_100000086
379 Ga0068868_100003178
380 Ga0070691_10000257
381 Ga0070661_100000236
382 Ga0070668_100007930
383 Ga0070675_100000930
384 Ga0070674_100000021
385 Ga0070674_100000047
386 Ga0070673_100002816
387 Ga0070688_100007391
388 Ga0070688_100018229
389 Ga0070659_100014496
390 Ga0070667_100005138
391 Ga0070713_100007177
392 Ga0070711_100008189
393 Ga0070711_100017883
394 Ga0070663_100016927
395 Ga0070662_100000007
396 Ga0070681_10069654
397 Ga0068867_100005475
398 Ga0070685_10005338
399 Ga0070685_10006836
400 Ga0070679_100002103
401 Ga0070679_100012041
402 Ga0070684_100036091
403 Ga0070684_100048169
404 Ga0070684_100089391
405 Ga0070672_100000104
406 Ga0070665_100000022
407 Ga0070665_100035836
408 Ga0070665_100169324
409 Ga0070664_100059877
410 Ga0070664_100099289
411 Ga0068854_100002532
412 Ga0068854_100019389
413 Ga0068856_100017730
414 Ga0068856_100023933
415 Ga0068856_100065953
416 Ga0068852_100001042
417 Ga0068864_100000023
418 Ga0068866_10000007
419 Ga0068866_10000274
420 Ga0068851_10002945
421 Ga0068863_100000110
422 Ga0068863_100153964
423 Ga0068858_100000150
424 Ga0068858_100000287
425 Ga0068860_100021758
426 Ga0068862_100030442
427 Ga0081455_10005169
428 Ga0081540_1000281
429 Ga0081539_10002195
430 Ga0070715_10000003
431 Ga0070712_100002727
432 Ga0075433_10001498
433 Ga0068865_100000056
434 Ga0105245_10000022
435 Ga0105245_10007109
436 Ga0105245_10014325
437 Ga0105247_10000064
438 Ga0105243_10075819
439 Ga0105241_10008834
440 Ga0105242_10002991
441 Ga0105242_10003504
442 Ga0105248_10001735
443 Ga0105238_10000014
444 Ga0105249_10010011
445 Ga0105249_10063104
446 Ga0105239_10040100
447 Ga0105239_10061842
448 Ga0157370_10168573
449 Ga0157369_10000068
450 Ga0157378_10015262
451 Ga0157378_10051751
452 Ga0157372_10008183
453 Ga0157375_10009903
454 Ga0157375_10012560
455 Ga0157375_10165698
456 Ga0157380_10000808
457 Ga0157379_10015361
458 Ga0157379_10035013
459 Ga0163161_10000013
460 Ga0163161_10015163
461 Ga0206356_10615566
462 Ga0224712_10002990
463 Ga0207656_10001231
464 Ga0207682_10000008
465 Ga0207642_10000008
466 Ga0207642_10000979
467 Ga0207710_10000220
468 Ga0207685_10000003
469 Ga0207654_10030101
470 Ga0207707_10007402
471 Ga0207693_10001647
472 Ga0207663_10025785
473 Ga0207663_10058340
474 Ga0207649_10000388
475 Ga0207652_10000666
476 Ga0207652_10000687
477 Ga0207694_10000008
478 Ga0207659_10000054
479 Ga0207687_10000025
480 Ga0207687_10000039
481 Ga0207687_10000132
482 Ga0207687_10011202
483 Ga0207664_10147547
484 Ga0207690_10046020
485 Ga0207690_10057292
486 Ga0207706_10000018
487 Ga0207686_10000066
488 Ga0207669_10000032
489 Ga0207669_10000083
490 Ga0207704_10000092
491 Ga0207691_10000430
492 Ga0207711_10000011
493 Ga0207661_10008772
494 Ga0207661_10014386
495 Ga0207661_10018121
496 Ga0207661_10175829
497 Ga0207651_10001037
498 Ga0207712_10000067
499 Ga0207712_10004693
500 Ga0207712_10090939
501 Ga0207668_10085679
502 Ga0207640_10000691
503 Ga0207677_10000046
504 Ga0207703_10000122
505 Ga0207703_10001133
506 Ga0207678_10002630
507 Ga0207702_10001995
508 Ga0207702_10012269
509 Ga0207702_10013312
510 Ga0207641_10000065
511 Ga0207641_10016838
512 Ga0207641_10132423
513 Ga0207648_10005844
514 Ga0207676_10000025
515 Ga0207698_10000014
516 Ga0268266_10000029
517 Ga0268266_10114944
518 Ga0268265_10042427
519 Ga0268264_10034383
520 Ga0265326_10000391
521 Ga0265319_1000030
522 Ga0265322_10000012
523 Ga0265336_10001438
524 Ga0265338_10000156
525 Ga0265324_10000620
526 Ga0265332_10048320
527 Ga0265328_10002171
528 Ga0265320_10000001
529 Ga0265329_10005600
530 Ga0265339_10036607
531 Ga0265331_10012192
532 Ga0265331_10020490
533 Ga0265327_10000003
534 Ga0265316_10015154
535 Ga0265314_10000178
536 Ga0316574_0079440
537 Ga0373937_0069176
538 Ga0373937_0162168
539 Ga0316584_0030983
540 Ga0451853_2210063
541 Ga0466963_0000325
542 Ga0466957_0011751
543 Ga0466967_0000003
544 Ga0495592_0141554
545 Ga0495592_0175505
546 Ga0495603_0000323
547 Ga0495603_0000641
548 Ga0495629_0011553
549 Ga0495629_0013942
550 Ga0495641_0000400
551 Ga0495641_0020521
552 Ga0495651_0179438
553 Ga0495653_0105825
554 Ga0495653_0170016
555 Ga0495582_0000006
556 Ga0495662_0000236
557 Ga0495662_0091238
558 Ga0495594_0000001
559 Ga0495606_0000283
560 Ga0495608_0000010
561 Ga0495608_0007965
562 Ga0495608_0030267
563 Ga0495618_0000037
564 Ga0495620_0000668
565 Ga0495628_0000864
566 Ga0495628_0127667
567 Ga0495628_0138753
568 Ga0495628_0263303
569 Ga0495630_0000378
570 Ga0495630_0005497
571 Ga0495652_0000009
572 Ga0495652_0029984
573 Ga0495640_0017271
574 Ga0495586_0025402
575 Ga0495587_0065492
576 Ga0495598_0004091
577 Ga0495621_0020640
578 Ga0495622_0000069
579 Ga0495667_0000067
580 Ga0495667_0042386
581 Ga0495656_0005437
582 Ga0495634_0000021
583 Ga0495634_0000993
584 Ga0495625_0000109
585 Ga0495635_0000006
586 Ga0495588_0000175
587 Ga0495657_0000005
588 Ga0495657_0019254
589 Ga0495599_0009407
590 Ga0495647_0000010
591 Ga0495658_0000094
592 Ga0495658_0001193
593 Ga0495669_0001857
594 Ga0495613_0000087
595 Ga0495613_0000329
596 Ga0495613_0231785
597 Ga0495624_0000429
598 Ga0495624_0000767
599 Ga0495649_0003368
600 Ga0495600_0019108
601 Ga0495604_0000322
602 Ga0495674_0000115
603 Ga0495672_0066966
604 Ga0495676_0001315
605 Ga0495676_0009804
606 Ga0495676_0113580
607 Ga0495680_0001684
608 Ga0495680_0001951
609 Ga0495680_0006746
610 Ga0495675_0000398
611 Ga0495675_0032604
612 Ga0495593_0043339
613 Ga0495593_0094240
614 Ga0495602_0000038
615 Ga0495602_0018782
616 Ga0496100_0000004
617 Ga0496100_0000028
618 Ga0496101_0000005
619 Ga0496101_0000007
620 Ga0496102_0000021
621 Ga0496102_0248933
622 Ga0496103_0000001
623 Ga0496103_0068411
624 Ga0496104_0000008
625 Ga0496104_0000029
626 Ga0496104_0000307
627 Ga0496104_0049221
628 Ga0496105_0000002
629 Ga0496105_0000003
630 Ga0496105_0000070
631 Ga0496105_0047366
632 Ga0496106_0000004
633 Ga0496106_0000070
634 Ga0496106_0000951
635 Ga0496107_0000001
636 Ga0496107_0000004
637 Ga0496108_0000004
638 Ga0496108_0000042
639 Ga0496108_0003212
640 Ga0496108_0010300
641 Ga0496108_0010599
642 Ga0496109_0000036
643 Ga0496109_0000062
644 Ga0496109_0000081
645 Ga0496109_0000550
646 Ga0496109_0296920
647 Ga0496110_0000010
648 Ga0496110_0061197
649 Ga0496110_0080110
650 Ga0496111_0002452
651 Ga0496111_0003564
652 Ga0496112_0000002
653 Ga0496112_0017235
654 Ga0496113_0000002
655 Ga0496113_0117390
656 Ga0496113_0248969
657 Ga0496113_0250346
658 Ga0496114_0000097
659 Ga0496114_0026504
660 Ga0496115_0000005
661 Ga0496115_0000151
662 Ga0496115_0066533
663 Ga0496116_0000529
664 Ga0496117_0018121
665 Ga0496118_0015742
666 Ga0496119_0101050
667 Ga0496120_0012066
668 Ga0496121_0046117
669 Ga0496125_0016701
670 Ga0496126_0074268
671 Ga0501032_0003667
672 Ga0501033_0002178
673 Ga0501034_0071666
674 Ga0501034_0127756
675 Ga0501034_0133810
676 Ga0501036_0001191
677 Ga0501037_0007676
678 Ga0501038_0018359
679 Ga0501039_0222850
680 Ga0501042_0221594
681 Ga0501043_0012433
682 Ga0501046_0001288
683 Ga0501047_0012978
684 Ga0501047_0047315
685 Ga0501047_0102494
686 Ga0501048_0001273
687 Ga0501069_0004841
688 Ga0501070_0031614
689 Ga0501070_0035595
690 Ga0501070_0126154
691 Ga0501070_0149724
692 Ga0501073_0027297
693 Ga0501074_0025410
694 Ga0501074_0036780
695 Ga0501079_0105518
696 Ga0501080_0043479
697 Ga0501080_0056756
698 Ga0501083_0015042
699 Ga0501083_0022913
700 Ga0501083_0071343
701 Ga0501035_0000877
702 Ga0501044_0051116
703 Ga0501044_0320921
704 Ga0501045_0016227
705 nmdc:mga0yw44_32765_c1
706 nmdc:mga0yw44_89961_c1
707 nmdc:mga0a205_12683_c1
708 nmdc:mga0a205_15_c2
709 Ga0495601_0000065
710 Ga0495601_0005931
711 Ga0495601_0006099
712 Ga0495601_0096648
713 Ga0495612_0000088
714 Ga0495612_0002972
715 Ga0495612_0006400
716 Ga0495655_0000013
717 Ga0495655_0001661
718 Ga0495595_0000005
719 Ga0495595_0001230
720 Ga0495619_0000036
721 Ga0495619_0000069
722 Ga0495619_0000489
723 Ga0495619_0001068
724 Ga0495619_0005329
725 Ga0495619_0005750
726 Ga0495619_0007514
727 Ga0495619_0020344
728 Ga0495619_0174771
729 Ga0500566_0025552
730 Ga0500566_0050024
731 Ga0500641_0032788
732 Ga0500595_021303
733 Ga0500614_001762
734 Ga0500628_000014

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00743

FMO-like

Flavin-binding monooxygenase-like

29

460

0.94

PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

34

95

0.86

PF13738

Pyr_redox_3

Pyridine nucleotide-disulphide oxidoreductase

33

240

0.82

PF13434

Lys_Orn_oxgnase

L-lysine 6-monooxygenase/L-ornithine 5-monooxygenase

107

242

0.78

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

30

248

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lat-assembly1.cif.gz_A campylobacter jejuni keto-acid reductoisomerase in complex with mg2+ 0.9434 5 31
4oqy-assembly1.cif.gz_B streptomyces sp. gf3546 imine reductase 0.926 4 32
6l2k-assembly1.cif.gz_B ilvc, a ketol-acid reductoisomerase, from streptococcus pneumoniae_r49e 0.9214 5 31
6eod-assembly1.cif.gz_A structure of reductive aminase from aspergillus terreus in complex with nadph 0.9209 4 32
6toe-assembly3.cif.gz_D imine reductase from myxococcus stipitatus v8 variant in complex with nad+ 0.9195 4 33
ID Description Score Start End Superfamily
af_Q57604_107_240_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9861 4 34 3.40.50.720
af_Q2FZ31_2_179_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.958 4 34 3.50.50.60
af_Q2G2A7_273_342_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.93 91 120 2.40.50.140
4oqyB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.926 4 32 3.40.50.720
af_P45522_400_562_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9257 4 34 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A838PQ62-F1-model_v4 Flavin-containing monooxygenase 5 (EC 1.6.3.1) (Dimethylaniline monooxygenase [N-oxide-forming] 5) (Dimethylaniline oxidase 5) (NADPH oxidase) 0.9654 128 421 GO:0004499
GO:0006629
GO:0050660
GO:0050661
AF-A0A522F095-F1-model_v4 Monooxygenase 0.947 151 415 GO:0004499
GO:0050660
GO:0050661
AF-M3G3V3-F1-model_v4 Flavin-binding monooxygenase-like domain protein 0.9458 177 374 GO:0004499
GO:0050660
GO:0050661
AF-A0A353PAW9-F1-model_v4 Monooxygenase 0.9397 241 420 GO:0004499
GO:0050660
GO:0050661
AF-A0A4V2Y667-F1-model_v4 Monooxygenase 0.9368 106 419 GO:0004499
GO:0050660
GO:0050661

Map