F424388

General Info

Members Datasets Scaffolds Average Seq Length
367 223 734 276

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10110333|Ga0265338_101103333
Length 315
Sequence MPHQPGRLASRRRIQIRPPMNRPRLGTNFGEKQRVTPSSQLTFTLLVGLGSLVGGFLGALTGLGGGVVIVPMLTLLFGIDIRYAIGASLVSVIATSSGAAAAYVREGYSNIRIGMFLEIATTLGALVGAWLAGIAPTHLIAIIFGLVLLFSAISSLRHPADRPGPEKPDRIAERLRLDSTYPSPNGPVKYHVTGVIPGFVLMHLAGILSGLLGIGSGAIKVLAMDQAMRLPFKVSTTTSNFMIGVTAAASAGIYLNRGYVDPGLAMPVMLGVLIGATAGARLLAGAKVRILRLVFGLVILALGIEMIYSGWTEKL

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
90 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
91 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
92 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
93 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
142 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
145 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
146 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
147 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
148 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
149 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
150 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
151 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
152 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
153 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
154 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
155 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
156 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
157 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
158 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
159 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
160 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
170 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
171 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
172 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
173 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
174 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
178 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
179 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
180 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
181 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
197 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
203 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
204 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
205 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
213 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
214 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
215 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
216 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
217 2831426010 Nostoc sp. 106C Isolate Unclassified
218 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
219 2849660919 Nostoc sp. T09 Isolate Unclassified
220 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
221 2913912277 Desmonostoc muscorum LEGE 12446 Isolate Unclassified
222 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
223 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97
Metatranscriptomes 0.54
Isolates 2.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.54
Nodule 0
Rhizoplane 5.72
Rhizosphere 89.37
Stem 0
Stem Tuber 0
Unclassified 7.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10110333 3300028800 Bacteria 2218
2 MRS1b_contig_2134205 2162886011 Bacteria 1054
3 rootH2_10060361 3300003320 Bacteria 22290
4 Ga0065712_10090419 3300005290 Bacteria 2405
5 Ga0065715_10133730 3300005293 Bacteria 1967
6 Ga0065715_10200326 3300005293 Bacteria 1365
7 Ga0065715_10258630 3300005293 Unclassified 1145
8 Ga0070658_10505478 3300005327 Bacteria 1044
9 Ga0070676_10015069 3300005328 Bacteria 4260
10 Ga0070683_100086273 3300005329 Bacteria 2943
11 Ga0070683_100183594 3300005329 Bacteria 1986
12 Ga0070666_10055277 3300005335 Bacteria 2679
13 Ga0070682_100020565 3300005337 Bacteria 3885
14 Ga0068868_100013662 3300005338 Bacteria 5963
15 Ga0068868_100112442 3300005338 Bacteria 2214
16 Ga0070660_100027548 3300005339 Bacteria 4242
17 Ga0070689_100046668 3300005340 Bacteria 3338
18 Ga0070691_10028477 3300005341 Bacteria 2611
19 Ga0070661_100021395 3300005344 Bacteria 4618
20 Ga0070661_100146856 3300005344 Bacteria 1781
21 Ga0070668_100009924 3300005347 Bacteria 7052
22 Ga0070671_100147722 3300005355 Bacteria 1985
23 Ga0070673_100450428 3300005364 Bacteria 1158
24 Ga0070659_100008550 3300005366 Bacteria 7482
25 Ga0070659_100054951 3300005366 Bacteria 3137
26 Ga0070667_100007050 3300005367 Bacteria 9345
27 Ga0070667_100063024 3300005367 Bacteria 3141
28 Ga0070709_10202754 3300005434 Bacteria 1406
29 Ga0070710_10183320 3300005437 Bacteria 1312
30 Ga0070711_100004405 3300005439 Bacteria 8307
31 Ga0070711_100043221 3300005439 Unclassified 3051
32 Ga0070705_100017510 3300005440 Bacteria 3741
33 Ga0070694_100146856 3300005444 Bacteria 1718
34 Ga0070708_100000932 3300005445 Bacteria 22137
35 Ga0070708_100004601 3300005445 Bacteria 10862
36 Ga0070708_100073162 3300005445 Unclassified 3089
37 Ga0070708_100353029 3300005445 Bacteria 1386
38 Ga0070708_100591474 3300005445 Bacteria 1046
39 Ga0070663_100020796 3300005455 Bacteria 4350
40 Ga0070662_100005192 3300005457 Bacteria 8309
41 Ga0068867_100011467 3300005459 Bacteria 6255
42 Ga0070706_100001716 3300005467 Bacteria 22776
43 Ga0070706_100043486 3300005467 Bacteria 4151
44 Ga0070706_100137027 3300005467 Bacteria 2285
45 Ga0070707_100003339 3300005468 Bacteria 15156
46 Ga0070707_100077288 3300005468 Unclassified 3212
47 Ga0070698_100000941 3300005471 Bacteria 31848
48 Ga0070699_100088665 3300005518 Unclassified 2702
49 Ga0070679_100123785 3300005530 Bacteria 2569
50 Ga0070684_100017001 3300005535 Bacteria 5960
51 Ga0070697_100000739 3300005536 Bacteria 24386
52 Ga0070697_100026037 3300005536 Bacteria 4667
53 Ga0070697_100048098 3300005536 Bacteria 3458
54 Ga0068853_100013101 3300005539 Bacteria 6765
55 Ga0068853_100096163 3300005539 Bacteria 2613
56 Ga0070665_100012938 3300005548 Bacteria 8403
57 Ga0070665_100106732 3300005548 Bacteria 2803
58 Ga0070665_100349188 3300005548 Bacteria 1485
59 Ga0068855_100016229 3300005563 Bacteria 8956
60 Ga0070664_100023284 3300005564 Bacteria 5115
61 Ga0070664_100169046 3300005564 Bacteria 1939
62 Ga0068857_100022628 3300005577 Bacteria 5528
63 Ga0068854_100344847 3300005578 Bacteria 1217
64 Ga0068856_100011231 3300005614 Bacteria 8693
65 Ga0068856_100026960 3300005614 Bacteria 5605
66 Ga0068852_100179605 3300005616 Bacteria 1989
67 Ga0068852_100534908 3300005616 Bacteria 1171
68 Ga0068859_100079744 3300005617 Bacteria 3314
69 Ga0068864_100047773 3300005618 Bacteria 3678
70 Ga0068861_100186659 3300005719 Bacteria 1730
71 Ga0068851_10045181 3300005834 Bacteria 2225
72 Ga0068863_100556601 3300005841 Bacteria 1133
73 Ga0068860_100002912 3300005843 Bacteria 17733
74 Ga0068860_100010483 3300005843 Bacteria 9160
75 Ga0068860_100307155 3300005843 Bacteria 1555
76 Ga0068862_100024412 3300005844 Bacteria 5073
77 Ga0070717_10171021 3300006028 Bacteria 1890
78 Ga0070717_10280524 3300006028 Bacteria 1478
79 Ga0070716_100160935 3300006173 Bacteria 1454
80 Ga0070712_100000167 3300006175 Bacteria 35889
81 Ga0097621_100008525 3300006237 Bacteria 7382
82 Ga0097621_100018537 3300006237 Bacteria 5320
83 Ga0097621_100316214 3300006237 Bacteria 1382
84 Ga0068871_100003384 3300006358 Bacteria 10964
85 Ga0068871_100007853 3300006358 Bacteria 7647
86 Ga0075430_100291794 3300006846 Unclassified 1349
87 Ga0075433_10016444 3300006852 Bacteria 6099
88 Ga0075434_100000063 3300006871 Bacteria 55215
89 Ga0075434_100030297 3300006871 Bacteria 5327
90 Ga0075434_100082184 3300006871 Bacteria 3219
91 Ga0068865_100012489 3300006881 Bacteria 5346
92 Ga0075436_100027532 3300006914 Bacteria 3911
93 Ga0097620_100079747 3300006931 Bacteria 3314
94 Ga0075435_100001228 3300007076 Bacteria 16420
95 Ga0075435_100175542 3300007076 Bacteria 1809
96 Ga0099794_10014729 3300007265 Bacteria 3433
97 Ga0099794_10111012 3300007265 Unclassified 1374
98 Ga0105240_10043898 3300009093 Bacteria 5685
99 Ga0105240_10044179 3300009093 Bacteria 5665
100 Ga0105240_10055130 3300009093 Bacteria 4978
101 Ga0105240_10070830 3300009093 Bacteria 4312
102 Ga0111539_10017480 3300009094 Bacteria 8879
103 Ga0105245_10003427 3300009098 Bacteria 14208
104 Ga0105245_10396342 3300009098 Bacteria 1378
105 Ga0105245_10403191 3300009098 Bacteria 1367
106 Ga0105247_10019234 3300009101 Bacteria 4099
107 Ga0114129_10086409 3300009147 Unclassified 4350
108 Ga0114129_10242904 3300009147 Bacteria 2420
109 Ga0114129_10379840 3300009147 Bacteria 1866
110 Ga0105241_10002566 3300009174 Bacteria 13638
111 Ga0105241_10006823 3300009174 Bacteria 8395
112 Ga0105242_10025178 3300009176 Bacteria 4705
113 Ga0105242_10211559 3300009176 Bacteria 1728
114 Ga0105242_10627391 3300009176 Bacteria 1042
115 Ga0105248_10006914 3300009177 Bacteria 12434
116 Ga0105248_10018486 3300009177 Bacteria 7704
117 Ga0105248_10155391 3300009177 Bacteria 2581
118 Ga0105248_10236419 3300009177 Bacteria 2057
119 Ga0105248_10316986 3300009177 Bacteria 1756
120 Ga0105237_10149998 3300009545 Unclassified 2327
121 Ga0105237_10242347 3300009545 Unclassified 1804
122 Ga0105238_10054468 3300009551 Bacteria 4016
123 Ga0105238_10058134 3300009551 Bacteria 3877
124 Ga0105238_10459367 3300009551 Bacteria 1271
125 Ga0105249_10020982 3300009553 Bacteria 5845
126 Ga0105249_10950254 3300009553 Bacteria 927
127 Ga0105239_10000468 3300010375 Bacteria 59019
128 Ga0105239_10063784 3300010375 Bacteria 4045
129 Ga0105239_10218945 3300010375 Bacteria 2135
130 Ga0105239_10249093 3300010375 Bacteria 1995
131 Ga0157373_10338145 3300013100 Bacteria 1073
132 Ga0157371_10026459 3300013102 Bacteria 4217
133 Ga0157371_10136652 3300013102 Bacteria 1746
134 Ga0157370_10011298 3300013104 Bacteria 9358
135 Ga0157369_10027935 3300013105 Bacteria 6248
136 Ga0157374_10027754 3300013296 Bacteria 5111
137 Ga0157374_10043278 3300013296 Bacteria 4159
138 Ga0157378_10000399 3300013297 Bacteria 42664
139 Ga0157378_10005707 3300013297 Bacteria 10892
140 Ga0157378_10022978 3300013297 Bacteria 5489
141 Ga0157378_10089861 3300013297 Bacteria 2791
142 Ga0163162_10002812 3300013306 Bacteria 16555
143 Ga0163162_10019485 3300013306 Bacteria 6656
144 Ga0163162_10126002 3300013306 Bacteria 2667
145 Ga0163162_10150112 3300013306 Bacteria 2448
146 Ga0157372_10005712 3300013307 Bacteria 13244
147 Ga0157372_10031591 3300013307 Bacteria 5798
148 Ga0157372_10049021 3300013307 Bacteria 4695
149 Ga0157372_10470824 3300013307 Bacteria 1464
150 Ga0157375_10038024 3300013308 Bacteria 4618
151 Ga0163163_10068683 3300014325 Bacteria 3526
152 Ga0163163_10560143 3300014325 Bacteria 1206
153 Ga0157379_10006256 3300014968 Bacteria 10251
154 Ga0157376_10012198 3300014969 Bacteria 6370
155 Ga0182006_1011999 3300015261 Unclassified 3795
156 Ga0213872_10014684 3300021361 Bacteria 3650
157 Ga0213874_10039836 3300021377 Bacteria 1401
158 Ga0213871_10005289 3300021441 Bacteria 2649
159 Ga0228598_1001020 3300024227 Bacteria 6143
160 Ga0207656_10090405 3300025321 Bacteria 1389
161 Ga0207642_10034796 3300025899 Bacteria 2145
162 Ga0207680_10006123 3300025903 Bacteria 5798
163 Ga0207680_10064585 3300025903 Bacteria 2245
164 Ga0207647_10019913 3300025904 Bacteria 4505
165 Ga0207647_10079010 3300025904 Bacteria 1975
166 Ga0207699_10156920 3300025906 Bacteria 1511
167 Ga0207699_10160481 3300025906 Bacteria 1496
168 Ga0207684_10002108 3300025910 Bacteria 20390
169 Ga0207684_10023034 3300025910 Bacteria 5319
170 Ga0207684_10135339 3300025910 Bacteria 2116
171 Ga0207654_10008450 3300025911 Bacteria 5206
172 Ga0207695_10059626 3300025913 Bacteria 3956
173 Ga0207695_10077686 3300025913 Bacteria 3370
174 Ga0207695_10328228 3300025913 Bacteria 1419
175 Ga0207671_10149398 3300025914 Bacteria 1805
176 Ga0207693_10000467 3300025915 Bacteria 36905
177 Ga0207663_10036270 3300025916 Bacteria 2965
178 Ga0207663_10124916 3300025916 Unclassified 1768
179 Ga0207660_10024406 3300025917 Bacteria 4094
180 Ga0207657_10002394 3300025919 Bacteria 20283
181 Ga0207657_10004552 3300025919 Bacteria 14655
182 Ga0207649_10021612 3300025920 Bacteria 3707
183 Ga0207652_10123248 3300025921 Bacteria 2308
184 Ga0207652_10195192 3300025921 Bacteria 1821
185 Ga0207652_10436680 3300025921 Bacteria 1180
186 Ga0207646_10004471 3300025922 Bacteria 15154
187 Ga0207646_10240795 3300025922 Bacteria 1634
188 Ga0207694_10029380 3300025924 Bacteria 4194
189 Ga0207687_10008053 3300025927 Bacteria 6895
190 Ga0207687_10119480 3300025927 Unclassified 1969
191 Ga0207700_10070600 3300025928 Bacteria 2686
192 Ga0207664_10053564 3300025929 Bacteria 3195
193 Ga0207690_10086486 3300025932 Bacteria 2203
194 Ga0207706_10000973 3300025933 Bacteria 29233
195 Ga0207706_10038786 3300025933 Bacteria 4225
196 Ga0207686_10063787 3300025934 Bacteria 2344
197 Ga0207686_10070412 3300025934 Bacteria 2247
198 Ga0207686_10203333 3300025934 Bacteria 1420
199 Ga0207670_10253347 3300025936 Bacteria 1361
200 Ga0207704_10023740 3300025938 Bacteria 3311
201 Ga0207704_10076375 3300025938 Bacteria 2146
202 Ga0207665_10011885 3300025939 Bacteria 5716
203 Ga0207665_10101435 3300025939 Bacteria 2010
204 Ga0207711_10014317 3300025941 Bacteria 6587
205 Ga0207711_10107284 3300025941 Bacteria 2479
206 Ga0207711_10285678 3300025941 Bacteria 1520
207 Ga0207661_10016360 3300025944 Bacteria 5471
208 Ga0207661_10188458 3300025944 Bacteria 1807
209 Ga0207661_10189342 3300025944 Bacteria 1803
210 Ga0207679_10654833 3300025945 Bacteria 950
211 Ga0207667_10014547 3300025949 Bacteria 8964
212 Ga0207712_10003681 3300025961 Bacteria 9667
213 Ga0207668_10022548 3300025972 Bacteria 4033
214 Ga0207640_10005830 3300025981 Bacteria 6717
215 Ga0207658_10068066 3300025986 Bacteria 2685
216 Ga0207658_10074100 3300025986 Bacteria 2586
217 Ga0207658_10160628 3300025986 Bacteria 1841
218 Ga0207677_10070157 3300026023 Bacteria 2468
219 Ga0207703_10227887 3300026035 Bacteria 1669
220 Ga0207678_10002113 3300026067 Bacteria 17991
221 Ga0207678_10300352 3300026067 Bacteria 1380
222 Ga0207708_10156258 3300026075 Bacteria 1799
223 Ga0207702_10006145 3300026078 Bacteria 10397
224 Ga0207702_10220218 3300026078 Bacteria 1768
225 Ga0207648_10050734 3300026089 Bacteria 3627
226 Ga0207674_10040757 3300026116 Bacteria 4808
227 Ga0207674_10141061 3300026116 Bacteria 2369
228 Ga0207698_10022003 3300026142 Bacteria 4421
229 Ga0209588_1005673 3300027671 Bacteria 3587
230 Ga0209588_1007590 3300027671 Bacteria 3195
231 Ga0207428_10059270 3300027907 Bacteria 3035
232 Ga0268266_10029264 3300028379 Bacteria 4683
233 Ga0268266_10078076 3300028379 Bacteria 2880
234 Ga0268266_10132703 3300028379 Unclassified 2229
235 Ga0268265_10110583 3300028380 Bacteria 2242
236 Ga0268264_10042139 3300028381 Bacteria 3778
237 Ga0268264_10185582 3300028381 Bacteria 1892
238 Ga0268264_10279111 3300028381 Bacteria 1564
239 Ga0265319_1067854 3300028563 Bacteria 1146
240 Ga0265338_10020998 3300028800 Bacteria 6831
241 Ga0265762_1000130 3300030760 Bacteria 11334
242 Ga0265760_10008865 3300031090 Unclassified 2874
243 Ga0265330_10054052 3300031235 Bacteria 1756
244 Ga0265332_10000162 3300031238 Bacteria 54127
245 Ga0265332_10013532 3300031238 Bacteria 3615
246 Ga0265325_10007497 3300031241 Bacteria 6522
247 Ga0265325_10009784 3300031241 Bacteria 5584
248 Ga0265325_10016110 3300031241 Bacteria 4182
249 Ga0265329_10022854 3300031242 Bacteria 2088
250 Ga0265340_10003511 3300031247 Bacteria 8821
251 Ga0265340_10165159 3300031247 Bacteria 1004
252 Ga0265339_10003417 3300031249 Bacteria 11101
253 Ga0265339_10032320 3300031249 Bacteria 2952
254 Ga0265331_10000034 3300031250 Bacteria 200155
255 Ga0265331_10009215 3300031250 Bacteria 5563
256 Ga0265331_10020932 3300031250 Unclassified 3352
257 Ga0265327_10023870 3300031251 Bacteria 3607
258 Ga0265316_10001333 3300031344 Bacteria 26547
259 Ga0265316_10010122 3300031344 Bacteria 8611
260 Ga0265316_10013489 3300031344 Bacteria 7252
261 Ga0265316_10016481 3300031344 Bacteria 6407
262 Ga0265316_10028805 3300031344 Bacteria 4576
263 Ga0265313_10012652 3300031595 Bacteria 5130
264 Ga0265314_10000883 3300031711 Bacteria 35735
265 Ga0265314_10000897 3300031711 Bacteria 35446
266 Ga0265314_10006083 3300031711 Bacteria 10723
267 Ga0265314_10048966 3300031711 Unclassified 2961
268 Ga0265314_10081863 3300031711 Bacteria 2125
269 Ga0265342_10079801 3300031712 Bacteria 1892
270 Ga0316578_10046179 3300031728 Unclassified 2538
271 Ga0373932_0013239 3300035112 Bacteria 2047
272 Ga0373942_0046556 3300035207 Bacteria 1202
273 Ga0373962_0007833 3300035242 Bacteria 2622
274 Ga0373931_0122172 3300035691 Bacteria 1489
275 Ga0373935_0273826 3300035692 Bacteria 1187
276 Ga0373927_0056773 3300035695 Bacteria 2532
277 Ga0316582_0068748 3300036647 Bacteria 2288
278 Ga0373925_0020765 3300037068 Bacteria 4785
279 Ga0436364_0833529 3300037853 Bacteria 5918
280 Ga0395901_0228801 3300038443 Unclassified 1942
281 Ga0395901_0230895 3300038443 Bacteria 1932
282 Ga0237819_04032 3300038705 Bacteria 2485
283 Ga0436365_1649783 3300039437 Bacteria 2381
284 Ga0436365_1865014 3300039437 Unclassified 2518
285 Ga0436360_0801171 3300039438 Bacteria 2534
286 Ga0436360_1062696 3300039438 Bacteria 4433
287 Ga0436360_1141634 3300039438 Bacteria 2699
288 Ga0436360_1346941 3300039438 Bacteria 1999
289 Ga0436361_0068400 3300039447 Bacteria 2501
290 Ga0436361_0619996 3300039447 Bacteria 1505
291 Ga0466966_0278675 3300044684 Bacteria 1006
292 Ga0466971_0003554 3300044719 Bacteria 6661
293 Ga0466959_0028114 3300045049 Bacteria 4170
294 Ga0451576_0419618 3300045051 Unclassified 1404
295 Ga0466967_0157976 3300045976 Bacteria 2126
296 Ga0495629_0025153 3300046459 Bacteria 4235
297 Ga0495580_0000249 3300046472 Bacteria 42609
298 Ga0495580_0017662 3300046472 Bacteria 5329
299 Ga0495580_0071109 3300046472 Unclassified 2430
300 Ga0495580_0212585 3300046472 Bacteria 1330
301 Ga0495582_0012561 3300046473 Bacteria 4668
302 Ga0495652_0357544 3300046529 Bacteria 1044
303 Ga0495645_0017215 3300046543 Bacteria 5177
304 Ga0495667_0321107 3300046559 Bacteria 980
305 Ga0495674_0121246 3300047319 Bacteria 2208
306 Ga0495684_0087961 3300047471 Unclassified 2355
307 Ga0496100_0015179 3300048903 Bacteria 4494
308 Ga0496100_0373419 3300048903 Bacteria 1082
309 Ga0496102_0000641 3300048905 Bacteria 35434
310 Ga0496102_0169224 3300048905 Bacteria 2057
311 Ga0496103_0014547 3300048906 Bacteria 4672
312 Ga0496103_0171931 3300048906 Bacteria 1391
313 Ga0496104_0016683 3300048907 Bacteria 6675
314 Ga0496104_0055599 3300048907 Bacteria 3743
315 Ga0496104_0074825 3300048907 Bacteria 3224
316 Ga0496106_0048604 3300048909 Bacteria 3195
317 Ga0496106_0053161 3300048909 Bacteria 3058
318 Ga0496107_0033033 3300048910 Bacteria 3701
319 Ga0496107_0142251 3300048910 Bacteria 1773
320 Ga0496107_0160165 3300048910 Bacteria 1668
321 Ga0496108_0046247 3300048911 Bacteria 3636
322 Ga0496108_0338393 3300048911 Bacteria 1313
323 Ga0496110_0011617 3300048913 Bacteria 7219
324 Ga0496111_0016848 3300048914 Bacteria 5043
325 Ga0496112_0100618 3300048915 Bacteria 2860
326 Ga0496114_0069907 3300048917 Bacteria 2948
327 Ga0496115_0026250 3300048918 Bacteria 4544
328 Ga0496126_0237370 3300048929 Bacteria 1525
329 Ga0501033_0248528 3300049570 Bacteria 1261
330 Ga0501034_0005190 3300049571 Bacteria 14289
331 Ga0501037_0128510 3300049573 Unclassified 1818
332 Ga0501043_0125329 3300049579 Bacteria 2014
333 Ga0501043_0231844 3300049579 Bacteria 1426
334 Ga0501047_0323226 3300049581 Unclassified 1382
335 Ga0501070_0008900 3300049586 Bacteria 8486
336 Ga0501070_0152089 3300049586 Unclassified 1909
337 Ga0501073_0272437 3300049589 Unclassified 1168
338 Ga0501083_0327013 3300049744 Bacteria 997
339 Ga0501035_0056093 3300049822 Unclassified 3517
340 Ga0501044_0000385 3300049823 Bacteria 54901
341 Ga0501044_0002734 3300049823 Bacteria 20061
342 Ga0501044_0018143 3300049823 Bacteria 7546
343 Ga0501044_0027904 3300049823 Bacteria 5959
344 Ga0501044_0440161 3300049823 Bacteria 1211
345 nmdc:mga05p37_402746_c1 3300050507 Bacteria 1597
346 nmdc:mga05p37_432122_c1 3300050507 Bacteria 1529
347 nmdc:mga0qj67_189244_c1 3300050509 Unclassified 1672
348 nmdc:mga08y16_10478_c1 3300050511 Bacteria 9724
349 nmdc:mga0n895_104478_c1 3300050512 Bacteria 2845
350 nmdc:mga0n895_229763_c1 3300050512 Bacteria 1883
351 nmdc:mga0n895_5686_c1 3300050512 Bacteria 10453
352 nmdc:mga0rr50_233515_c1 3300050513 Bacteria 1522
353 nmdc:mga0rr50_793_c1 3300050513 Bacteria 17040
354 nmdc:mga0a205_207920_c1 3300050515 Bacteria 1846
355 nmdc:mga0a205_6699_c1 3300050515 Bacteria 10422
356 Ga0500590_103774 3300053148 Bacteria 1361
357 Ga0500622_0001188 3300053156 Bacteria 21489
358 Ga0466962_0088684 3300061719 Bacteria 1481
359 2617913507 2617270889 Bacteria 9064343
360 2831433101 2831426010 Bacteria 8662725
361 2848698396 2848694841 Bacteria 9205737
362 2849661557 2849660919 Bacteria 8251853
363 2886630133 2886627955 Bacteria 7618130
364 2886634407 2886627955 Bacteria 7618130
365 2913915378 2913912277 Bacteria 9037797
366 2913942199 2913939268 Bacteria 8559644
367 642602143 642555144 Bacteria 9059191
368 Ga0265338_10110333
369 MRS1b_contig_2134205
370 rootH2_10060361
371 Ga0065712_10090419
372 Ga0065715_10133730
373 Ga0065715_10200326
374 Ga0065715_10258630
375 Ga0070658_10505478
376 Ga0070676_10015069
377 Ga0070683_100086273
378 Ga0070683_100183594
379 Ga0070666_10055277
380 Ga0070682_100020565
381 Ga0068868_100013662
382 Ga0068868_100112442
383 Ga0070660_100027548
384 Ga0070689_100046668
385 Ga0070691_10028477
386 Ga0070661_100021395
387 Ga0070661_100146856
388 Ga0070668_100009924
389 Ga0070671_100147722
390 Ga0070673_100450428
391 Ga0070659_100008550
392 Ga0070659_100054951
393 Ga0070667_100007050
394 Ga0070667_100063024
395 Ga0070709_10202754
396 Ga0070710_10183320
397 Ga0070711_100004405
398 Ga0070711_100043221
399 Ga0070705_100017510
400 Ga0070694_100146856
401 Ga0070708_100000932
402 Ga0070708_100004601
403 Ga0070708_100073162
404 Ga0070708_100353029
405 Ga0070708_100591474
406 Ga0070663_100020796
407 Ga0070662_100005192
408 Ga0068867_100011467
409 Ga0070706_100001716
410 Ga0070706_100043486
411 Ga0070706_100137027
412 Ga0070707_100003339
413 Ga0070707_100077288
414 Ga0070698_100000941
415 Ga0070699_100088665
416 Ga0070679_100123785
417 Ga0070684_100017001
418 Ga0070697_100000739
419 Ga0070697_100026037
420 Ga0070697_100048098
421 Ga0068853_100013101
422 Ga0068853_100096163
423 Ga0070665_100012938
424 Ga0070665_100106732
425 Ga0070665_100349188
426 Ga0068855_100016229
427 Ga0070664_100023284
428 Ga0070664_100169046
429 Ga0068857_100022628
430 Ga0068854_100344847
431 Ga0068856_100011231
432 Ga0068856_100026960
433 Ga0068852_100179605
434 Ga0068852_100534908
435 Ga0068859_100079744
436 Ga0068864_100047773
437 Ga0068861_100186659
438 Ga0068851_10045181
439 Ga0068863_100556601
440 Ga0068860_100002912
441 Ga0068860_100010483
442 Ga0068860_100307155
443 Ga0068862_100024412
444 Ga0070717_10171021
445 Ga0070717_10280524
446 Ga0070716_100160935
447 Ga0070712_100000167
448 Ga0097621_100008525
449 Ga0097621_100018537
450 Ga0097621_100316214
451 Ga0068871_100003384
452 Ga0068871_100007853
453 Ga0075430_100291794
454 Ga0075433_10016444
455 Ga0075434_100000063
456 Ga0075434_100030297
457 Ga0075434_100082184
458 Ga0068865_100012489
459 Ga0075436_100027532
460 Ga0097620_100079747
461 Ga0075435_100001228
462 Ga0075435_100175542
463 Ga0099794_10014729
464 Ga0099794_10111012
465 Ga0105240_10043898
466 Ga0105240_10044179
467 Ga0105240_10055130
468 Ga0105240_10070830
469 Ga0111539_10017480
470 Ga0105245_10003427
471 Ga0105245_10396342
472 Ga0105245_10403191
473 Ga0105247_10019234
474 Ga0114129_10086409
475 Ga0114129_10242904
476 Ga0114129_10379840
477 Ga0105241_10002566
478 Ga0105241_10006823
479 Ga0105242_10025178
480 Ga0105242_10211559
481 Ga0105242_10627391
482 Ga0105248_10006914
483 Ga0105248_10018486
484 Ga0105248_10155391
485 Ga0105248_10236419
486 Ga0105248_10316986
487 Ga0105237_10149998
488 Ga0105237_10242347
489 Ga0105238_10054468
490 Ga0105238_10058134
491 Ga0105238_10459367
492 Ga0105249_10020982
493 Ga0105249_10950254
494 Ga0105239_10000468
495 Ga0105239_10063784
496 Ga0105239_10218945
497 Ga0105239_10249093
498 Ga0157373_10338145
499 Ga0157371_10026459
500 Ga0157371_10136652
501 Ga0157370_10011298
502 Ga0157369_10027935
503 Ga0157374_10027754
504 Ga0157374_10043278
505 Ga0157378_10000399
506 Ga0157378_10005707
507 Ga0157378_10022978
508 Ga0157378_10089861
509 Ga0163162_10002812
510 Ga0163162_10019485
511 Ga0163162_10126002
512 Ga0163162_10150112
513 Ga0157372_10005712
514 Ga0157372_10031591
515 Ga0157372_10049021
516 Ga0157372_10470824
517 Ga0157375_10038024
518 Ga0163163_10068683
519 Ga0163163_10560143
520 Ga0157379_10006256
521 Ga0157376_10012198
522 Ga0182006_1011999
523 Ga0213872_10014684
524 Ga0213874_10039836
525 Ga0213871_10005289
526 Ga0228598_1001020
527 Ga0207656_10090405
528 Ga0207642_10034796
529 Ga0207680_10006123
530 Ga0207680_10064585
531 Ga0207647_10019913
532 Ga0207647_10079010
533 Ga0207699_10156920
534 Ga0207699_10160481
535 Ga0207684_10002108
536 Ga0207684_10023034
537 Ga0207684_10135339
538 Ga0207654_10008450
539 Ga0207695_10059626
540 Ga0207695_10077686
541 Ga0207695_10328228
542 Ga0207671_10149398
543 Ga0207693_10000467
544 Ga0207663_10036270
545 Ga0207663_10124916
546 Ga0207660_10024406
547 Ga0207657_10002394
548 Ga0207657_10004552
549 Ga0207649_10021612
550 Ga0207652_10123248
551 Ga0207652_10195192
552 Ga0207652_10436680
553 Ga0207646_10004471
554 Ga0207646_10240795
555 Ga0207694_10029380
556 Ga0207687_10008053
557 Ga0207687_10119480
558 Ga0207700_10070600
559 Ga0207664_10053564
560 Ga0207690_10086486
561 Ga0207706_10000973
562 Ga0207706_10038786
563 Ga0207686_10063787
564 Ga0207686_10070412
565 Ga0207686_10203333
566 Ga0207670_10253347
567 Ga0207704_10023740
568 Ga0207704_10076375
569 Ga0207665_10011885
570 Ga0207665_10101435
571 Ga0207711_10014317
572 Ga0207711_10107284
573 Ga0207711_10285678
574 Ga0207661_10016360
575 Ga0207661_10188458
576 Ga0207661_10189342
577 Ga0207679_10654833
578 Ga0207667_10014547
579 Ga0207712_10003681
580 Ga0207668_10022548
581 Ga0207640_10005830
582 Ga0207658_10068066
583 Ga0207658_10074100
584 Ga0207658_10160628
585 Ga0207677_10070157
586 Ga0207703_10227887
587 Ga0207678_10002113
588 Ga0207678_10300352
589 Ga0207708_10156258
590 Ga0207702_10006145
591 Ga0207702_10220218
592 Ga0207648_10050734
593 Ga0207674_10040757
594 Ga0207674_10141061
595 Ga0207698_10022003
596 Ga0209588_1005673
597 Ga0209588_1007590
598 Ga0207428_10059270
599 Ga0268266_10029264
600 Ga0268266_10078076
601 Ga0268266_10132703
602 Ga0268265_10110583
603 Ga0268264_10042139
604 Ga0268264_10185582
605 Ga0268264_10279111
606 Ga0265319_1067854
607 Ga0265338_10020998
608 Ga0265762_1000130
609 Ga0265760_10008865
610 Ga0265330_10054052
611 Ga0265332_10000162
612 Ga0265332_10013532
613 Ga0265325_10007497
614 Ga0265325_10009784
615 Ga0265325_10016110
616 Ga0265329_10022854
617 Ga0265340_10003511
618 Ga0265340_10165159
619 Ga0265339_10003417
620 Ga0265339_10032320
621 Ga0265331_10000034
622 Ga0265331_10009215
623 Ga0265331_10020932
624 Ga0265327_10023870
625 Ga0265316_10001333
626 Ga0265316_10010122
627 Ga0265316_10013489
628 Ga0265316_10016481
629 Ga0265316_10028805
630 Ga0265313_10012652
631 Ga0265314_10000883
632 Ga0265314_10000897
633 Ga0265314_10006083
634 Ga0265314_10048966
635 Ga0265314_10081863
636 Ga0265342_10079801
637 Ga0316578_10046179
638 Ga0373932_0013239
639 Ga0373942_0046556
640 Ga0373962_0007833
641 Ga0373931_0122172
642 Ga0373935_0273826
643 Ga0373927_0056773
644 Ga0316582_0068748
645 Ga0373925_0020765
646 Ga0436364_0833529
647 Ga0395901_0228801
648 Ga0395901_0230895
649 Ga0237819_04032
650 Ga0436365_1649783
651 Ga0436365_1865014
652 Ga0436360_0801171
653 Ga0436360_1062696
654 Ga0436360_1141634
655 Ga0436360_1346941
656 Ga0436361_0068400
657 Ga0436361_0619996
658 Ga0466966_0278675
659 Ga0466971_0003554
660 Ga0466959_0028114
661 Ga0451576_0419618
662 Ga0466967_0157976
663 Ga0495629_0025153
664 Ga0495580_0000249
665 Ga0495580_0017662
666 Ga0495580_0071109
667 Ga0495580_0212585
668 Ga0495582_0012561
669 Ga0495652_0357544
670 Ga0495645_0017215
671 Ga0495667_0321107
672 Ga0495674_0121246
673 Ga0495684_0087961
674 Ga0496100_0015179
675 Ga0496100_0373419
676 Ga0496102_0000641
677 Ga0496102_0169224
678 Ga0496103_0014547
679 Ga0496103_0171931
680 Ga0496104_0016683
681 Ga0496104_0055599
682 Ga0496104_0074825
683 Ga0496106_0048604
684 Ga0496106_0053161
685 Ga0496107_0033033
686 Ga0496107_0142251
687 Ga0496107_0160165
688 Ga0496108_0046247
689 Ga0496108_0338393
690 Ga0496110_0011617
691 Ga0496111_0016848
692 Ga0496112_0100618
693 Ga0496114_0069907
694 Ga0496115_0026250
695 Ga0496126_0237370
696 Ga0501033_0248528
697 Ga0501034_0005190
698 Ga0501037_0128510
699 Ga0501043_0125329
700 Ga0501043_0231844
701 Ga0501047_0323226
702 Ga0501070_0008900
703 Ga0501070_0152089
704 Ga0501073_0272437
705 Ga0501083_0327013
706 Ga0501035_0056093
707 Ga0501044_0000385
708 Ga0501044_0002734
709 Ga0501044_0018143
710 Ga0501044_0027904
711 Ga0501044_0440161
712 nmdc:mga05p37_402746_c1
713 nmdc:mga05p37_432122_c1
714 nmdc:mga0qj67_189244_c1
715 nmdc:mga08y16_10478_c1
716 nmdc:mga0n895_104478_c1
717 nmdc:mga0n895_229763_c1
718 nmdc:mga0n895_5686_c1
719 nmdc:mga0rr50_233515_c1
720 nmdc:mga0rr50_793_c1
721 nmdc:mga0a205_207920_c1
722 nmdc:mga0a205_6699_c1
723 Ga0500590_103774
724 Ga0500622_0001188
725 Ga0466962_0088684
726 2617913507
727 2831433101
728 2848698396
729 2849661557
730 2886630133
731 2886634407
732 2913915378
733 2913942199
734 642602143

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01925

TauE

Sulfite exporter TauE/SafE

46

306

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cb2-assembly1.cif.gz_A crystal structure of escherichia coli uppp 0.5426 7 273
6cb2-assembly1.cif.gz_A crystal structure of escherichia coli uppp 0.535 7 273
6fmt-assembly1.cif.gz_A imisx-ep of hg-baca soaking sad 0.5204 7 273
6fmt-assembly1.cif.gz_A imisx-ep of hg-baca soaking sad 0.5125 7 273
6t1z-assembly1.cif.gz_A lmrp from l. lactis, in an outward-open conformation, bound to hoechst 33342 0.4807 39 274
ID Description Score Start End Superfamily
af_Q54E81_92_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4394 43 277 1.20.1250.20
af_P9WG87_21_208_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4356 14 274 1.20.1250.20
af_Q2FXH1_4_180_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4337 11 275 1.20.1250.20
af_P0AEJ0_15_220_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4309 11 275 1.20.1250.20
af_Q54E81_92_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4263 43 277 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A3A5FKD8-F1-model_v4 deleted 0.9746 2 275
AF-A0A3A5FKD8-F1-model_v4 deleted 0.9574 2 275
AF-A0A3D4Y9B0-F1-model_v4 Probable membrane transporter protein 0.9474 98 278 GO:0005886
AF-A0A6I2GVA6-F1-model_v4 Probable membrane transporter protein 0.9424 1 275 GO:0005886
AF-A0A832R109-F1-model_v4 Probable membrane transporter protein 0.9394 5 274 GO:0005886

Map