F424406

General Info

Members Datasets Scaffolds Average Seq Length
367 261 736 323

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_100012888|Ga0307416_1000128884
Length 373
Sequence MYGLYLNYQRVSKRPRAFGSRGSNAGSSIFRQTVCDQCQGFYIDPLSADIMQYRTFGRTQFKVSEIGYGMWGLAGWTGTDTRELDRALDRSVALGCNFYDTAWGYGAGKSEQILGELVKRHPDKTLYHATKIPPKNLQWPSKSHFRLEDCFPYDHIIEYTEKSLKNLDVDCIDLQQFHVWEDSWAQNDEWKRAVEKLKKDGKIRFMGVSVNRWEPDNVLDTLKTGLIDAVQVIYNIFDQAPEDNLFPLCRKLNIGVIARVPFDEGSLTGTLTKQTTFPKDDWRSTYFVPENLNSSVEHADALRPLIPAGMTMPEMALRFILENDAVHTIIPGMRKLRNVEGNMAASDGKRLDAGVVRKLKNHRWDRTPTSWSQ

Samples

Sample ID Description Type Environment
1 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
103 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
104 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
108 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
110 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
158 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
159 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
162 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
163 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
164 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
174 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
175 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
176 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
177 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
178 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
179 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
180 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
181 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
182 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
183 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
184 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
185 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
186 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
187 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
188 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
189 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
190 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
191 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
192 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
193 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
194 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
195 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
196 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
197 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
198 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
199 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
200 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
201 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
202 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
203 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
204 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
205 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
206 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
207 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
208 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
209 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
210 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
211 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
212 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
213 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
214 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
215 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
216 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
217 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
218 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
219 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
226 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
233 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
234 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
236 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
237 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
238 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
239 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
240 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
241 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
242 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
243 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
244 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
245 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
246 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
247 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
248 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
249 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
250 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
251 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
252 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
253 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
254 2511231014 Pseudomonas sp. GM48 Isolate Nodule
255 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
256 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
257 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
258 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
259 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
260 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
261 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.82
Metatranscriptomes 0
Isolates 2.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.08
Nodule 0.27
Rhizoplane 2.72
Rhizosphere 82.02
Stem 0
Stem Tuber 0
Unclassified 8.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307416_100012888 3300032002 Bacteria 5658
2 JGI25154J39366_1000227 3300002738 Bacteria 37673
3 JGI25153J46596_10003831 3300003215 Bacteria 8291
4 rootH1_10042163 3300003316 Bacteria 2483
5 rootH1_10054911 3300003316 Bacteria 39663
6 rootH1_10054911 3300003323 Unclassified 4728
7 rootH2_10011821 3300003320 Bacteria 27973
8 rootL2_10077722 3300003322 Bacteria 6085
9 rootH1_10010049 3300003323 Bacteria 56441
10 rootH1_10013865 3300003323 Bacteria 59066
11 rootH1_10024619 3300003323 Bacteria 6325
12 rootH1_10063766 3300003316 Bacteria 9737
13 rootH1_10063766 3300003323 Bacteria 1469
14 rootH1_10073800 3300003323 Bacteria 3023
15 Ga0055526_1008824 3300003771 Bacteria 4957
16 Ga0055536_1009842 3300003781 Bacteria 3889
17 Ga0055528_1000438 3300003790 Bacteria 33416
18 Ga0055530_10000718 3300003791 Bacteria 27839
19 Ga0055530_10023873 3300003791 Bacteria 1747
20 Ga0055531_10030756 3300003794 Unclassified 1793
21 Ga0065165_1000022 3300005262 Bacteria 253404
22 Ga0065165_1000057 3300005262 Bacteria 185971
23 Ga0065165_1000546 3300005262 Bacteria 56702
24 Ga0065165_1026372 3300005262 Bacteria 1913
25 Ga0065712_10003128 3300005290 Bacteria 6195
26 Ga0065715_10164793 3300005293 Bacteria 1596
27 Ga0065707_10012772 3300005295 Bacteria 2070
28 Ga0070658_10008114 3300005327 Bacteria 8445
29 Ga0070690_100004422 3300005330 Bacteria 7802
30 Ga0070690_100032941 3300005330 Bacteria 3240
31 Ga0070670_100170958 3300005331 Unclassified 1885
32 Ga0068869_100006911 3300005334 Bacteria 7219
33 Ga0070666_10000566 3300005335 Bacteria 22401
34 Ga0068868_100004867 3300005338 Bacteria 9427
35 Ga0068868_100178682 3300005338 Bacteria 1760
36 Ga0070660_100010709 3300005339 Bacteria 6489
37 Ga0070689_100045782 3300005340 Bacteria 3370
38 Ga0070689_100266831 3300005340 Bacteria 1416
39 Ga0070687_100030069 3300005343 Bacteria 2652
40 Ga0070661_100016113 3300005344 Bacteria 5276
41 Ga0070669_100033661 3300005353 Bacteria 3707
42 Ga0070675_100021702 3300005354 Bacteria 5130
43 Ga0070671_100071094 3300005355 Bacteria 2904
44 Ga0070671_100073255 3300005355 Unclassified 2861
45 Ga0070674_100021240 3300005356 Bacteria 4164
46 Ga0070674_100366933 3300005356 Bacteria 1167
47 Ga0070673_100050785 3300005364 Bacteria 3244
48 Ga0070688_100023383 3300005365 Bacteria 3634
49 Ga0070659_100003429 3300005366 Bacteria 11291
50 Ga0070667_100029068 3300005367 Bacteria 4603
51 Ga0070667_100140099 3300005367 Bacteria 2117
52 Ga0070709_10030569 3300005434 Bacteria 3233
53 Ga0070714_100138493 3300005435 Unclassified 2182
54 Ga0070713_100049819 3300005436 Bacteria 3457
55 Ga0070711_100096574 3300005439 Bacteria 2141
56 Ga0070711_100097312 3300005439 Bacteria 2134
57 Ga0070708_100007060 3300005445 Bacteria 8963
58 Ga0070662_100004871 3300005457 Bacteria 8518
59 Ga0070681_10039885 3300005458 Bacteria 4707
60 Ga0068867_100071358 3300005459 Unclassified 2598
61 Ga0070699_100003062 3300005518 Bacteria 14827
62 Ga0070679_100052735 3300005530 Bacteria 4049
63 Ga0070679_100147628 3300005530 Bacteria 2329
64 Ga0068853_100023700 3300005539 Bacteria 5142
65 Ga0070672_100087898 3300005543 Unclassified 2501
66 Ga0070686_100068074 3300005544 Unclassified 2322
67 Ga0070695_100220832 3300005545 Bacteria 1365
68 Ga0070693_100205517 3300005547 Bacteria 1282
69 Ga0070665_100002455 3300005548 Bacteria 20430
70 Ga0068855_100011479 3300005563 Bacteria 10705
71 Ga0070664_100010490 3300005564 Bacteria 7508
72 Ga0070664_100161149 3300005564 Bacteria 1985
73 Ga0068857_100007104 3300005577 Bacteria 9644
74 Ga0068857_100276627 3300005577 Bacteria 1543
75 Ga0068854_100067313 3300005578 Bacteria 2609
76 Ga0068854_100388764 3300005578 Bacteria 1151
77 Ga0068856_100089492 3300005614 Bacteria 3061
78 Ga0070702_100122903 3300005615 Bacteria 1628
79 Ga0068852_100001989 3300005616 Bacteria 13934
80 Ga0068859_100000026 3300005617 Bacteria 188742
81 Ga0068859_100062716 3300005617 Bacteria 3747
82 Ga0068859_100155877 3300005617 Bacteria 2361
83 Ga0068864_100012129 3300005618 Bacteria 7119
84 Ga0068851_10085457 3300005834 Bacteria 1654
85 Ga0068863_100004512 3300005841 Bacteria 13734
86 Ga0068858_100005551 3300005842 Bacteria 12343
87 Ga0068860_100007533 3300005843 Bacteria 10890
88 Ga0068860_100012563 3300005843 Bacteria 8337
89 Ga0068860_100018785 3300005843 Bacteria 6716
90 Ga0068860_100439552 3300005843 Bacteria 1296
91 Ga0068862_100026443 3300005844 Bacteria 4877
92 Ga0081539_10001707 3300005985 Bacteria 35373
93 Ga0075432_10006198 3300006058 Unclassified 4065
94 Ga0070715_10080369 3300006163 Bacteria 1478
95 Ga0070712_100215681 3300006175 Bacteria 1516
96 Ga0097621_100002699 3300006237 Bacteria 12141
97 Ga0097621_100007256 3300006237 Bacteria 7914
98 Ga0068871_100190113 3300006358 Bacteria 1768
99 Ga0068871_100331170 3300006358 Bacteria 1343
100 Ga0068871_100333492 3300006358 Bacteria 1338
101 Ga0075428_100004169 3300006844 Bacteria 15907
102 Ga0075430_100160578 3300006846 Unclassified 1871
103 Ga0075433_10037498 3300006852 Bacteria 4182
104 Ga0075429_100190929 3300006880 Bacteria 1795
105 Ga0068865_100034383 3300006881 Bacteria 3400
106 Ga0068865_100067135 3300006881 Bacteria 2532
107 Ga0068865_100342998 3300006881 Unclassified 1208
108 Ga0097620_100000026 3300006931 Bacteria 188742
109 Ga0097620_100062713 3300006931 Bacteria 3747
110 Ga0097620_100155883 3300006931 Bacteria 2361
111 Ga0075435_100013925 3300007076 Bacteria 5998
112 Ga0099794_10002031 3300007265 Bacteria 7320
113 Ga0105240_10292883 3300009093 Bacteria 1865
114 Ga0111539_10002180 3300009094 Bacteria 26174
115 Ga0111539_10024467 3300009094 Bacteria 7408
116 Ga0111539_10332114 3300009094 Unclassified 1770
117 Ga0105245_10156768 3300009098 Unclassified 2157
118 Ga0114129_10033181 3300009147 Bacteria 7296
119 Ga0114129_10033336 3300009147 Bacteria 7278
120 Ga0114129_10703590 3300009147 Bacteria 1298
121 Ga0105241_10002748 3300009174 Bacteria 13193
122 Ga0105241_10070064 3300009174 Unclassified 2720
123 Ga0105242_10156137 3300009176 Bacteria 1993
124 Ga0105242_10362207 3300009176 Bacteria 1342
125 Ga0105237_10011985 3300009545 Bacteria 9160
126 Ga0105237_10510257 3300009545 Bacteria 1209
127 Ga0105249_10013311 3300009553 Bacteria 7264
128 Ga0105249_10019136 3300009553 Bacteria 6106
129 Ga0105239_10051482 3300010375 Bacteria 4514
130 Ga0105239_10192255 3300010375 Unclassified 2284
131 Ga0105239_10297766 3300010375 Bacteria 1817
132 Ga0105246_10014353 3300011119 Unclassified 4981
133 Ga0105246_10081316 3300011119 Bacteria 2309
134 Ga0157371_10039795 3300013102 Bacteria 3361
135 Ga0157371_10073567 3300013102 Unclassified 2420
136 Ga0157370_10025007 3300013104 Bacteria 5909
137 Ga0157370_10039722 3300013104 Bacteria 4546
138 Ga0157369_10036358 3300013105 Bacteria 5396
139 Ga0157374_10122132 3300013296 Bacteria 2515
140 Ga0157378_10007165 3300013297 Bacteria 9738
141 Ga0157378_10007361 3300013297 Bacteria 9617
142 Ga0157378_10009835 3300013297 Bacteria 8338
143 Ga0157378_10070977 3300013297 Bacteria 3127
144 Ga0157378_10075484 3300013297 Unclassified 3035
145 Ga0157378_10081412 3300013297 Bacteria 2926
146 Ga0157378_10571883 3300013297 Bacteria 1138
147 Ga0163162_10001684 3300013306 Bacteria 20736
148 Ga0163162_10011640 3300013306 Bacteria 8577
149 Ga0163162_10087131 3300013306 Bacteria 3201
150 Ga0163162_10353225 3300013306 Bacteria 1603
151 Ga0157372_10066577 3300013307 Bacteria 4047
152 Ga0157375_10150433 3300013308 Unclassified 2463
153 Ga0157375_10274232 3300013308 Bacteria 1849
154 Ga0157375_10277460 3300013308 Bacteria 1839
155 Ga0163163_10114536 3300014325 Unclassified 2727
156 Ga0163163_10156852 3300014325 Unclassified 2320
157 Ga0157380_10009413 3300014326 Bacteria 6999
158 Ga0157380_10475755 3300014326 Bacteria 1207
159 Ga0157377_10001614 3300014745 Bacteria 9826
160 Ga0157379_10046875 3300014968 Bacteria 3857
161 Ga0157379_10237953 3300014968 Bacteria 1651
162 Ga0157379_10298415 3300014968 Bacteria 1468
163 Ga0157376_10000005 3300014969 Bacteria 443695
164 Ga0157376_10000716 3300014969 Bacteria 21448
165 Ga0157376_10019987 3300014969 Bacteria 5172
166 Ga0157376_10048810 3300014969 Bacteria 3504
167 Ga0209646_1000009 3300025246 Bacteria 652154
168 Ga0209026_1000188 3300025250 Bacteria 90347
169 Ga0209673_1000287 3300025273 Bacteria 94132
170 Ga0209676_1000448 3300025292 Bacteria 69928
171 Ga0209564_1003883 3300025295 Bacteria 9606
172 Ga0209564_1015025 3300025295 Unclassified 3177
173 Ga0209758_1002873 3300025297 Bacteria 16695
174 Ga0209758_1010704 3300025297 Bacteria 5444
175 Ga0209758_1010911 3300025297 Bacteria 5353
176 Ga0209050_1000755 3300025298 Bacteria 46537
177 Ga0209050_1011585 3300025298 Bacteria 4157
178 Ga0209050_1030860 3300025298 Bacteria 1683
179 Ga0207426_1000203 3300025302 Bacteria 142379
180 Ga0207426_1000846 3300025302 Bacteria 32226
181 Ga0207426_1007479 3300025302 Bacteria 4568
182 Ga0209051_1012234 3300025303 Unclassified 4161
183 Ga0209257_1001979 3300025304 Bacteria 22030
184 Ga0207656_10022937 3300025321 Bacteria 2508
185 Ga0207710_10002388 3300025900 Bacteria 8761
186 Ga0207688_10011112 3300025901 Unclassified 4899
187 Ga0207680_10000145 3300025903 Bacteria 33969
188 Ga0207680_10177232 3300025903 Bacteria 1439
189 Ga0207645_10021939 3300025907 Bacteria 4160
190 Ga0207643_10027684 3300025908 Bacteria 3144
191 Ga0207705_10034172 3300025909 Bacteria 3635
192 Ga0207654_10001951 3300025911 Bacteria 10699
193 Ga0207695_10262626 3300025913 Bacteria 1624
194 Ga0207671_10004079 3300025914 Bacteria 14141
195 Ga0207663_10095045 3300025916 Bacteria 1987
196 Ga0207662_10132772 3300025918 Bacteria 1571
197 Ga0207657_10019184 3300025919 Bacteria 6503
198 Ga0207649_10017941 3300025920 Bacteria 4014
199 Ga0207652_10445204 3300025921 Bacteria 1168
200 Ga0207694_10073577 3300025924 Bacteria 2674
201 Ga0207650_10023863 3300025925 Unclassified 4342
202 Ga0207659_10199174 3300025926 Bacteria 1598
203 Ga0207700_10034785 3300025928 Bacteria 3621
204 Ga0207664_10123953 3300025929 Unclassified 2167
205 Ga0207644_10221980 3300025931 Unclassified 1498
206 Ga0207706_10010912 3300025933 Bacteria 8289
207 Ga0207706_10262622 3300025933 Bacteria 1507
208 Ga0207670_10084425 3300025936 Bacteria 2229
209 Ga0207669_10011919 3300025937 Unclassified 4253
210 Ga0207691_10032332 3300025940 Unclassified 4879
211 Ga0207689_10012838 3300025942 Bacteria 7151
212 Ga0207661_10014132 3300025944 Bacteria 5843
213 Ga0207679_10045552 3300025945 Unclassified 3173
214 Ga0207679_10268681 3300025945 Bacteria 1458
215 Ga0207712_10019418 3300025961 Bacteria 4438
216 Ga0207712_10345143 3300025961 Bacteria 1236
217 Ga0207658_10048441 3300025986 Bacteria 3116
218 Ga0207658_10117072 3300025986 Bacteria 2117
219 Ga0207677_10019871 3300026023 Bacteria 4066
220 Ga0207703_10008892 3300026035 Bacteria 7913
221 Ga0207678_10109400 3300026067 Bacteria 2357
222 Ga0207708_10140899 3300026075 Bacteria 1891
223 Ga0207702_10125274 3300026078 Bacteria 2305
224 Ga0207641_10000155 3300026088 Bacteria 97385
225 Ga0207641_10012580 3300026088 Bacteria 6937
226 Ga0207676_10126213 3300026095 Unclassified 2167
227 Ga0207674_10032699 3300026116 Bacteria 5453
228 Ga0207674_10060599 3300026116 Bacteria 3826
229 Ga0207683_10015542 3300026121 Bacteria 6481
230 Ga0207698_10060679 3300026142 Bacteria 2942
231 Ga0207698_10241747 3300026142 Unclassified 1646
232 Ga0209588_1000234 3300027671 Bacteria 14858
233 Ga0207428_10042666 3300027907 Unclassified 3667
234 Ga0268266_10000299 3300028379 Bacteria 79882
235 Ga0268265_10059953 3300028380 Bacteria 2914
236 Ga0268264_10006893 3300028381 Bacteria 9537
237 Ga0268264_10007633 3300028381 Bacteria 9015
238 Ga0268264_10009357 3300028381 Bacteria 8108
239 Ga0268264_10601102 3300028381 Bacteria 1084
240 Ga0307515_10000009 3300028794 Bacteria 653206
241 Ga0307515_10050320 3300028794 Bacteria 6244
242 Ga0265327_10062848 3300031251 Bacteria 1888
243 Ga0307513_10171857 3300031456 Bacteria 2043
244 Ga0307408_100156766 3300031548 Bacteria 1804
245 Ga0307408_100203545 3300031548 Bacteria 1604
246 Ga0316579_10033271 3300031691 Bacteria 2367
247 Ga0316579_10035231 3300031691 Bacteria 2306
248 Ga0307405_10057814 3300031731 Bacteria 2438
249 Ga0316577_10054503 3300031733 Bacteria 2231
250 Ga0307413_10017192 3300031824 Bacteria 3761
251 Ga0307416_100030403 3300032002 Bacteria 4052
252 Ga0307414_10316800 3300032004 Bacteria 1326
253 Ga0307411_10101879 3300032005 Bacteria 2033
254 Ga0316574_0065937 3300035398 Bacteria 2280
255 Ga0373931_0077354 3300035691 Bacteria 1829
256 Ga0373937_0160030 3300036401 Bacteria 2111
257 Ga0316582_0108977 3300036647 Bacteria 1841
258 Ga0316582_0167604 3300036647 Bacteria 1490
259 Ga0373925_0114755 3300037068 Bacteria 2085
260 Ga0395905_0219886 3300037471 Bacteria 1778
261 Ga0316581_0011455 3300037588 Bacteria 2480
262 Ga0439447_000641 3300041407 Bacteria 13009
263 Ga0439466_0000549 3300041411 Bacteria 14176
264 Ga0439465_0012132 3300041413 Bacteria 2697
265 Ga0439432_000133 3300042006 Bacteria 24925
266 Ga0439451_000049 3300042009 Bacteria 23821
267 Ga0439452_000926 3300042010 Bacteria 13282
268 Ga0439456_000420 3300042013 Bacteria 9493
269 Ga0439463_000364 3300042016 Bacteria 12555
270 Ga0450911_000482 3300042115 Bacteria 12722
271 Ga0450919_000010 3300042121 Bacteria 17785
272 Ga0450922_000184 3300042124 Bacteria 6510
273 Ga0450890_000288 3300042127 Bacteria 7393
274 Ga0450903_000276 3300042138 Bacteria 11305
275 Ga0450906_001114 3300042145 Bacteria 5955
276 Ga0450907_000204 3300042146 Bacteria 21393
277 Ga0439446_0000083 3300042156 Bacteria 15643
278 Ga0450908_000120 3300042184 Bacteria 16012
279 Ga0450909_000038 3300042185 Bacteria 10783
280 Ga0439434_0004435 3300042435 Bacteria 4103
281 Ga0439464_0003661 3300042439 Bacteria 3898
282 Ga0439460_0000346 3300042461 Bacteria 9733
283 Ga0451577_0149281 3300042876 Bacteria 2103
284 Ga0466972_0012124 3300044658 Bacteria 4331
285 Ga0453684_0022387 3300044712 Bacteria 9378
286 Ga0453684_0022516 3300044712 Bacteria 9341
287 Ga0453684_0362279 3300044712 Bacteria 1632
288 Ga0453684_0379730 3300044712 Bacteria 1587
289 Ga0453684_0851566 3300044712 Bacteria 980
290 Ga0451576_0015721 3300045051 Bacteria 8377
291 Ga0451576_0104783 3300045051 Bacteria 2942
292 Ga0495592_0244436 3300046454 Bacteria 1189
293 Ga0495603_0018948 3300046455 Bacteria 4166
294 Ga0495603_0061696 3300046455 Bacteria 2214
295 Ga0495629_0056118 3300046459 Bacteria 2754
296 Ga0495638_0000040 3300046460 Bacteria 241883
297 Ga0495641_0114052 3300046461 Bacteria 1205
298 Ga0495580_0001866 3300046472 Bacteria 18532
299 Ga0495580_0014378 3300046472 Bacteria 6003
300 Ga0495580_0016112 3300046472 Bacteria 5618
301 Ga0495580_0348101 3300046472 Bacteria 1004
302 Ga0495582_0001408 3300046473 Bacteria 13557
303 Ga0495585_0001954 3300046492 Bacteria 15390
304 Ga0495594_0011693 3300046499 Bacteria 4563
305 Ga0495618_0105229 3300046514 Bacteria 1807
306 Ga0495628_0039616 3300046516 Bacteria 3768
307 Ga0495630_0032803 3300046517 Bacteria 3871
308 Ga0495640_0015177 3300046533 Bacteria 5802
309 Ga0495586_0049520 3300046535 Bacteria 2272
310 Ga0495645_0010771 3300046543 Bacteria 6423
311 Ga0495613_0032479 3300046689 Bacteria 3878
312 Ga0495581_0041506 3300047315 Bacteria 2662
313 Ga0495674_0055100 3300047319 Bacteria 3488
314 Ga0495684_0203835 3300047471 Bacteria 1457
315 Ga0495614_0057358 3300048089 Bacteria 1672
316 Ga0496100_0095784 3300048903 Bacteria 2035
317 Ga0496104_0168121 3300048907 Bacteria 2103
318 Ga0496104_0583842 3300048907 Bacteria 1028
319 Ga0496105_0085918 3300048908 Bacteria 2600
320 Ga0496106_0152236 3300048909 Bacteria 1825
321 Ga0496107_0063758 3300048910 Bacteria 2671
322 Ga0496114_0030933 3300048917 Bacteria 4404
323 Ga0496115_0015305 3300048918 Bacteria 5817
324 Ga0496115_0080221 3300048918 Bacteria 2657
325 Ga0496115_0101913 3300048918 Bacteria 2354
326 Ga0501033_0050560 3300049570 Bacteria 3083
327 Ga0501034_0001340 3300049571 Bacteria 33293
328 Ga0501034_0002231 3300049571 Bacteria 23870
329 Ga0501034_0120845 3300049571 Bacteria 2606
330 Ga0501036_0059509 3300049572 Bacteria 3237
331 Ga0501037_0053647 3300049573 Bacteria 2949
332 Ga0501043_0011632 3300049579 Bacteria 6888
333 Ga0501043_0032048 3300049579 Bacteria 4131
334 Ga0501043_0117387 3300049579 Bacteria 2088
335 Ga0501046_0109212 3300049580 Bacteria 2115
336 Ga0501257_004249 3300049686 Bacteria 3119
337 Ga0501083_0162851 3300049744 Bacteria 1459
338 Ga0501035_0031413 3300049822 Bacteria 4837
339 Ga0501035_0086517 3300049822 Bacteria 2762
340 Ga0501044_0001323 3300049823 Bacteria 29174
341 nmdc:mga05p37_333763_c1 3300050507 Bacteria 1790
342 nmdc:mga05p37_93931_c1 3300050507 Bacteria 3696
343 nmdc:mga08y16_3426_c1 3300050511 Bacteria 16458
344 nmdc:mga0rr50_23340_c1 3300050513 Bacteria 4264
345 nmdc:mga0a205_67431_c1 3300050515 Bacteria 3457
346 Ga0495601_0184227 3300053077 Bacteria 1365
347 Ga0495612_0096512 3300053078 Bacteria 1256
348 Ga0495619_0181381 3300053085 Bacteria 1457
349 Ga0500578_0111518 3300053086 Bacteria 1724
350 Ga0500583_0071293 3300053092 Bacteria 1662
351 Ga0500562_012397 3300053108 Bacteria 2168
352 Ga0500652_025953 3300053131 Bacteria 2251
353 Ga0500655_001520 3300053133 Bacteria 4389
354 Ga0500604_0000716 3300053151 Bacteria 9075
355 Ga0500616_0000013 3300053153 Bacteria 674172
356 Ga0500616_0010701 3300053153 Bacteria 5473
357 Ga0500622_0000009 3300053156 Bacteria 419980
358 Ga0500622_0000016 3300053156 Bacteria 337983
359 Ga0500627_0008663 3300053158 Bacteria 3627
360 Ga0590071_016001 3300059421 Bacteria 1759
361 Ga0590077_005450 3300059426 Bacteria 2608
362 2511316858 2511231014 Bacteria 6462302
363 2522547883 2522125168 Bacteria 7376607
364 2688068444 2687453257 Bacteria 6784659
365 2889419117 2889415604 Bacteria 8048700
366 2910247927 2910245624 Bacteria 6935613
367 2920110763 2920107658 Bacteria 10042636
368 2929924204 2929921140 Bacteria 8649150
369 8003152548 8003151029 Bacteria 8187759
370 Ga0307416_100012888
371 JGI25154J39366_1000227
372 JGI25153J46596_10003831
373 rootH1_10042163
374 rootH1_10054911
375 rootH2_10011821
376 rootL2_10077722
377 rootH1_10010049
378 rootH1_10013865
379 rootH1_10024619
380 rootH1_10063766
381 rootH1_10073800
382 Ga0055526_1008824
383 Ga0055536_1009842
384 Ga0055528_1000438
385 Ga0055530_10000718
386 Ga0055530_10023873
387 Ga0055531_10030756
388 Ga0065165_1000022
389 Ga0065165_1000057
390 Ga0065165_1000546
391 Ga0065165_1026372
392 Ga0065712_10003128
393 Ga0065715_10164793
394 Ga0065707_10012772
395 Ga0070658_10008114
396 Ga0070690_100004422
397 Ga0070690_100032941
398 Ga0070670_100170958
399 Ga0068869_100006911
400 Ga0070666_10000566
401 Ga0068868_100004867
402 Ga0068868_100178682
403 Ga0070660_100010709
404 Ga0070689_100045782
405 Ga0070689_100266831
406 Ga0070687_100030069
407 Ga0070661_100016113
408 Ga0070669_100033661
409 Ga0070675_100021702
410 Ga0070671_100071094
411 Ga0070671_100073255
412 Ga0070674_100021240
413 Ga0070674_100366933
414 Ga0070673_100050785
415 Ga0070688_100023383
416 Ga0070659_100003429
417 Ga0070667_100029068
418 Ga0070667_100140099
419 Ga0070709_10030569
420 Ga0070714_100138493
421 Ga0070713_100049819
422 Ga0070711_100096574
423 Ga0070711_100097312
424 Ga0070708_100007060
425 Ga0070662_100004871
426 Ga0070681_10039885
427 Ga0068867_100071358
428 Ga0070699_100003062
429 Ga0070679_100052735
430 Ga0070679_100147628
431 Ga0068853_100023700
432 Ga0070672_100087898
433 Ga0070686_100068074
434 Ga0070695_100220832
435 Ga0070693_100205517
436 Ga0070665_100002455
437 Ga0068855_100011479
438 Ga0070664_100010490
439 Ga0070664_100161149
440 Ga0068857_100007104
441 Ga0068857_100276627
442 Ga0068854_100067313
443 Ga0068854_100388764
444 Ga0068856_100089492
445 Ga0070702_100122903
446 Ga0068852_100001989
447 Ga0068859_100000026
448 Ga0068859_100062716
449 Ga0068859_100155877
450 Ga0068864_100012129
451 Ga0068851_10085457
452 Ga0068863_100004512
453 Ga0068858_100005551
454 Ga0068860_100007533
455 Ga0068860_100012563
456 Ga0068860_100018785
457 Ga0068860_100439552
458 Ga0068862_100026443
459 Ga0081539_10001707
460 Ga0075432_10006198
461 Ga0070715_10080369
462 Ga0070712_100215681
463 Ga0097621_100002699
464 Ga0097621_100007256
465 Ga0068871_100190113
466 Ga0068871_100331170
467 Ga0068871_100333492
468 Ga0075428_100004169
469 Ga0075430_100160578
470 Ga0075433_10037498
471 Ga0075429_100190929
472 Ga0068865_100034383
473 Ga0068865_100067135
474 Ga0068865_100342998
475 Ga0097620_100000026
476 Ga0097620_100062713
477 Ga0097620_100155883
478 Ga0075435_100013925
479 Ga0099794_10002031
480 Ga0105240_10292883
481 Ga0111539_10002180
482 Ga0111539_10024467
483 Ga0111539_10332114
484 Ga0105245_10156768
485 Ga0114129_10033181
486 Ga0114129_10033336
487 Ga0114129_10703590
488 Ga0105241_10002748
489 Ga0105241_10070064
490 Ga0105242_10156137
491 Ga0105242_10362207
492 Ga0105237_10011985
493 Ga0105237_10510257
494 Ga0105249_10013311
495 Ga0105249_10019136
496 Ga0105239_10051482
497 Ga0105239_10192255
498 Ga0105239_10297766
499 Ga0105246_10014353
500 Ga0105246_10081316
501 Ga0157371_10039795
502 Ga0157371_10073567
503 Ga0157370_10025007
504 Ga0157370_10039722
505 Ga0157369_10036358
506 Ga0157374_10122132
507 Ga0157378_10007165
508 Ga0157378_10007361
509 Ga0157378_10009835
510 Ga0157378_10070977
511 Ga0157378_10075484
512 Ga0157378_10081412
513 Ga0157378_10571883
514 Ga0163162_10001684
515 Ga0163162_10011640
516 Ga0163162_10087131
517 Ga0163162_10353225
518 Ga0157372_10066577
519 Ga0157375_10150433
520 Ga0157375_10274232
521 Ga0157375_10277460
522 Ga0163163_10114536
523 Ga0163163_10156852
524 Ga0157380_10009413
525 Ga0157380_10475755
526 Ga0157377_10001614
527 Ga0157379_10046875
528 Ga0157379_10237953
529 Ga0157379_10298415
530 Ga0157376_10000005
531 Ga0157376_10000716
532 Ga0157376_10019987
533 Ga0157376_10048810
534 Ga0209646_1000009
535 Ga0209026_1000188
536 Ga0209673_1000287
537 Ga0209676_1000448
538 Ga0209564_1003883
539 Ga0209564_1015025
540 Ga0209758_1002873
541 Ga0209758_1010704
542 Ga0209758_1010911
543 Ga0209050_1000755
544 Ga0209050_1011585
545 Ga0209050_1030860
546 Ga0207426_1000203
547 Ga0207426_1000846
548 Ga0207426_1007479
549 Ga0209051_1012234
550 Ga0209257_1001979
551 Ga0207656_10022937
552 Ga0207710_10002388
553 Ga0207688_10011112
554 Ga0207680_10000145
555 Ga0207680_10177232
556 Ga0207645_10021939
557 Ga0207643_10027684
558 Ga0207705_10034172
559 Ga0207654_10001951
560 Ga0207695_10262626
561 Ga0207671_10004079
562 Ga0207663_10095045
563 Ga0207662_10132772
564 Ga0207657_10019184
565 Ga0207649_10017941
566 Ga0207652_10445204
567 Ga0207694_10073577
568 Ga0207650_10023863
569 Ga0207659_10199174
570 Ga0207700_10034785
571 Ga0207664_10123953
572 Ga0207644_10221980
573 Ga0207706_10010912
574 Ga0207706_10262622
575 Ga0207670_10084425
576 Ga0207669_10011919
577 Ga0207691_10032332
578 Ga0207689_10012838
579 Ga0207661_10014132
580 Ga0207679_10045552
581 Ga0207679_10268681
582 Ga0207712_10019418
583 Ga0207712_10345143
584 Ga0207658_10048441
585 Ga0207658_10117072
586 Ga0207677_10019871
587 Ga0207703_10008892
588 Ga0207678_10109400
589 Ga0207708_10140899
590 Ga0207702_10125274
591 Ga0207641_10000155
592 Ga0207641_10012580
593 Ga0207676_10126213
594 Ga0207674_10032699
595 Ga0207674_10060599
596 Ga0207683_10015542
597 Ga0207698_10060679
598 Ga0207698_10241747
599 Ga0209588_1000234
600 Ga0207428_10042666
601 Ga0268266_10000299
602 Ga0268265_10059953
603 Ga0268264_10006893
604 Ga0268264_10007633
605 Ga0268264_10009357
606 Ga0268264_10601102
607 Ga0307515_10000009
608 Ga0307515_10050320
609 Ga0265327_10062848
610 Ga0307513_10171857
611 Ga0307408_100156766
612 Ga0307408_100203545
613 Ga0316579_10033271
614 Ga0316579_10035231
615 Ga0307405_10057814
616 Ga0316577_10054503
617 Ga0307413_10017192
618 Ga0307416_100030403
619 Ga0307414_10316800
620 Ga0307411_10101879
621 Ga0316574_0065937
622 Ga0373931_0077354
623 Ga0373937_0160030
624 Ga0316582_0108977
625 Ga0316582_0167604
626 Ga0373925_0114755
627 Ga0395905_0219886
628 Ga0316581_0011455
629 Ga0439447_000641
630 Ga0439466_0000549
631 Ga0439465_0012132
632 Ga0439432_000133
633 Ga0439451_000049
634 Ga0439452_000926
635 Ga0439456_000420
636 Ga0439463_000364
637 Ga0450911_000482
638 Ga0450919_000010
639 Ga0450922_000184
640 Ga0450890_000288
641 Ga0450903_000276
642 Ga0450906_001114
643 Ga0450907_000204
644 Ga0439446_0000083
645 Ga0450908_000120
646 Ga0450909_000038
647 Ga0439434_0004435
648 Ga0439464_0003661
649 Ga0439460_0000346
650 Ga0451577_0149281
651 Ga0466972_0012124
652 Ga0453684_0022387
653 Ga0453684_0022516
654 Ga0453684_0362279
655 Ga0453684_0379730
656 Ga0453684_0851566
657 Ga0451576_0015721
658 Ga0451576_0104783
659 Ga0495592_0244436
660 Ga0495603_0018948
661 Ga0495603_0061696
662 Ga0495629_0056118
663 Ga0495638_0000040
664 Ga0495641_0114052
665 Ga0495580_0001866
666 Ga0495580_0014378
667 Ga0495580_0016112
668 Ga0495580_0348101
669 Ga0495582_0001408
670 Ga0495585_0001954
671 Ga0495594_0011693
672 Ga0495618_0105229
673 Ga0495628_0039616
674 Ga0495630_0032803
675 Ga0495640_0015177
676 Ga0495586_0049520
677 Ga0495645_0010771
678 Ga0495613_0032479
679 Ga0495581_0041506
680 Ga0495674_0055100
681 Ga0495684_0203835
682 Ga0495614_0057358
683 Ga0496100_0095784
684 Ga0496104_0168121
685 Ga0496104_0583842
686 Ga0496105_0085918
687 Ga0496106_0152236
688 Ga0496107_0063758
689 Ga0496114_0030933
690 Ga0496115_0015305
691 Ga0496115_0080221
692 Ga0496115_0101913
693 Ga0501033_0050560
694 Ga0501034_0001340
695 Ga0501034_0002231
696 Ga0501034_0120845
697 Ga0501036_0059509
698 Ga0501037_0053647
699 Ga0501043_0011632
700 Ga0501043_0032048
701 Ga0501043_0117387
702 Ga0501046_0109212
703 Ga0501257_004249
704 Ga0501083_0162851
705 Ga0501035_0031413
706 Ga0501035_0086517
707 Ga0501044_0001323
708 nmdc:mga05p37_333763_c1
709 nmdc:mga05p37_93931_c1
710 nmdc:mga08y16_3426_c1
711 nmdc:mga0rr50_23340_c1
712 nmdc:mga0a205_67431_c1
713 Ga0495601_0184227
714 Ga0495612_0096512
715 Ga0495619_0181381
716 Ga0500578_0111518
717 Ga0500583_0071293
718 Ga0500562_012397
719 Ga0500652_025953
720 Ga0500655_001520
721 Ga0500604_0000716
722 Ga0500616_0000013
723 Ga0500616_0010701
724 Ga0500622_0000009
725 Ga0500622_0000016
726 Ga0500627_0008663
727 Ga0590071_016001
728 Ga0590077_005450
729 2511316858
730 2522547883
731 2688068444
732 2889419117
733 2910247927
734 2920110763
735 2929924204
736 8003152548

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

65

363

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xap-assembly1.cif.gz_A crystal structure of aldo-keto reductase from sinorhizobium meliloti 1021 0.8489 4 313
6ow0-assembly2.cif.gz_B crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with nad+ and peg 0.8457 1 306
3v0t-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.8413 1 305
1lqa-assembly1.cif.gz_A tas protein from escherichia coli in complex with nadph 0.839 1 306
7utf-assembly1.cif.gz_A structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.8386 1 306
ID Description Score Start End Superfamily
1ynpB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8532 1 307 3.20.20.100
af_A0A0R0FWW7_5_106_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8519 3 82 3.20.20.100
af_O14295_4_331_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8506 9 306 3.20.20.100
4xapA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8489 4 313 3.20.20.100
1ynpB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8449 1 307 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A0F9IUQ6-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9925 52 206
AF-A0A1H7IDF7-F1-model_v4 Predicted oxidoreductase 0.9868 1 317 GO:0016491
AF-A0A6L9J5N2-F1-model_v4 Aldo/keto reductase 0.9859 1 276
AF-A0A3A0CEY4-F1-model_v4 Aldo/keto reductase 0.984 29 317
AF-A0A1H7IDF7-F1-model_v4 Predicted oxidoreductase 0.9837 1 317 GO:0016491

Map