F424476

General Info

Members Datasets Scaffolds Average Seq Length
367 239 734 107

Family's Representative Sequence

Representative Sequence 3300047319|Ga0495674_0025641|Ga0495674_0025641_4546_4941
Length 131
Sequence METRVRQRSLVRLSHPANQPTDLSQMSWTLLSIAGIFEIAFAFGMKWSEGFTRLMPALFTVGTGLSSVFLLSLSLRTLPVGTGYAVWTGIGAAGTAILGMAVLGDSAAPMRLLCIALILAGVIGLKLVSVT

Samples

Sample ID Description Type Environment
1 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
7 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
26 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
29 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
30 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
47 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
48 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
51 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
54 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
55 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
57 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
58 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
60 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
61 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
65 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
91 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
92 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
93 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
103 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
104 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
105 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
106 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
107 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
108 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
109 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
110 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
111 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
112 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
113 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
114 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
115 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
116 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
117 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
118 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
119 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
120 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
121 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
122 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
123 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
124 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
125 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
126 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
127 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
128 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
129 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
130 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
131 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
132 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
133 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
134 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
135 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
136 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
137 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
138 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
139 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
140 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
141 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
142 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
143 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
144 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
145 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
146 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
147 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
148 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
149 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
150 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
151 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
152 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
153 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
154 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
155 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
156 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
157 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
158 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
159 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
160 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
161 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
162 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
163 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
164 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
165 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
166 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
167 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
168 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
169 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
170 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
171 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
172 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
173 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
188 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
189 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
190 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
191 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
192 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
193 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
194 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
195 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
196 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
197 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
198 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
199 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
200 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
202 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
203 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
206 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
207 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
208 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
209 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
210 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
211 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
212 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
213 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
214 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
215 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
216 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
217 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
218 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
219 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
220 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
221 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
222 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
223 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
224 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
225 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
226 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
227 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
228 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
229 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
230 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
231 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
232 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
233 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
234 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
235 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
236 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
237 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
238 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
239 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0
Isolates 0.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.89
Nodule 0
Rhizoplane 7.63
Rhizosphere 61.31
Stem 0
Stem Tuber 0
Unclassified 2.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495674_0025641 3300047319 Bacteria 5402
2 JGI25156J39149_1000059 3300002705 Bacteria 86130
3 JGI25162J39368_1003795 3300002737 Bacteria 4014
4 JGI25154J39366_1000056 3300002738 Bacteria 114494
5 JGI25157J39369_1000123 3300002741 Bacteria 65925
6 Ga0055532_1000059 3300003758 Bacteria 152948
7 Ga0055535_1007894 3300003761 Bacteria 1976
8 Ga0070658_11688798 3300005327 Bacteria 548
9 Ga0070677_10140089 3300005333 Bacteria 1114
10 Ga0070666_10416434 3300005335 Bacteria 967
11 Ga0070669_100006637 3300005353 Bacteria 8333
12 Ga0070673_100196587 3300005364 Bacteria 1735
13 Ga0070688_100313013 3300005365 Bacteria 1138
14 Ga0070713_100122648 3300005436 Unclassified 2281
15 Ga0070708_101255612 3300005445 Bacteria 692
16 Ga0070678_100064287 3300005456 Bacteria 2719
17 Ga0070678_100525036 3300005456 Bacteria 1048
18 Ga0070681_10142853 3300005458 Bacteria 2323
19 Ga0070681_10564363 3300005458 Bacteria 1052
20 Ga0070672_100046116 3300005543 Bacteria 3376
21 Ga0070665_100026867 3300005548 Bacteria 5798
22 Ga0070665_100429420 3300005548 Bacteria 1330
23 Ga0068854_100376333 3300005578 Bacteria 1169
24 Ga0068856_100195235 3300005614 Bacteria 2038
25 Ga0068852_100003034 3300005616 Bacteria 11676
26 Ga0075365_10465322 3300006038 Bacteria 893
27 Ga0075364_11093129 3300006051 Bacteria 541
28 Ga0075366_10256276 3300006195 Bacteria 1067
29 Ga0075370_10070891 3300006353 Bacteria 1993
30 Ga0075431_101253467 3300006847 Bacteria 703
31 Ga0068865_101338468 3300006881 Bacteria 638
32 Ga0105251_10115770 3300009011 Bacteria 1219
33 Ga0105244_10031275 3300009036 Bacteria 2825
34 Ga0105241_12527907 3300009174 Bacteria 515
35 Ga0105242_10767245 3300009176 Bacteria 951
36 Ga0105248_10147355 3300009177 Bacteria 2656
37 Ga0105248_10709749 3300009177 Bacteria 1135
38 Ga0105248_11413818 3300009177 Bacteria 787
39 Ga0105237_11152234 3300009545 Bacteria 782
40 Ga0105238_10645242 3300009551 Bacteria 1068
41 Ga0105249_11272528 3300009553 Bacteria 807
42 Ga0105246_10026587 3300011119 Bacteria 3783
43 Ga0157373_10021917 3300013100 Bacteria 4635
44 Ga0157373_10259846 3300013100 Bacteria 1229
45 Ga0157371_10050816 3300013102 Bacteria 2947
46 Ga0157370_10007879 3300013104 Bacteria 11545
47 Ga0157370_10140666 3300013104 Bacteria 2249
48 Ga0163162_12840895 3300013306 Bacteria 557
49 Ga0163163_11990155 3300014325 Bacteria 641
50 Ga0157380_10207229 3300014326 Bacteria 1744
51 Ga0182008_10002182 3300014497 Bacteria 12444
52 Ga0182008_10011027 3300014497 Bacteria 4819
53 Ga0182008_10014203 3300014497 Bacteria 4175
54 Ga0157376_11647084 3300014969 Bacteria 676
55 Ga0182006_1021732 3300015261 Bacteria 2672
56 Ga0182006_1113811 3300015261 Bacteria 947
57 Ga0182007_10007776 3300015262 Bacteria 4457
58 Ga0182007_10110633 3300015262 Bacteria 914
59 Ga0182005_1219690 3300015265 Unclassified 578
60 Ga0163161_10000042 3300017792 Bacteria 135368
61 Ga0163161_10411449 3300017792 Bacteria 1086
62 Ga0209435_100032 3300025206 Bacteria 153068
63 Ga0209672_100149 3300025228 Bacteria 62756
64 Ga0209147_100109 3300025229 Bacteria 153068
65 Ga0207427_100581 3300025231 Bacteria 18457
66 Ga0209437_100180 3300025233 Bacteria 133661
67 Ga0209437_100195 3300025233 Bacteria 121761
68 Ga0209258_100190 3300025242 Bacteria 126878
69 Ga0209646_1000113 3300025246 Bacteria 153068
70 Ga0209026_1000102 3300025250 Bacteria 153068
71 Ga0209026_1003397 3300025250 Bacteria 5251
72 Ga0209026_1019151 3300025250 Bacteria 1075
73 Ga0209148_1015251 3300025254 Bacteria 1345
74 Ga0209759_1000104 3300025256 Bacteria 153068
75 Ga0209759_1002408 3300025256 Bacteria 8234
76 Ga0209233_1014480 3300025261 Bacteria 2220
77 Ga0209455_1006419 3300025272 Bacteria 3473
78 Ga0209455_1006830 3300025272 Bacteria 3318
79 Ga0209675_1003885 3300025291 Bacteria 6875
80 Ga0209676_1015207 3300025292 Bacteria 2844
81 Ga0209025_1000038 3300025294 Bacteria 380508
82 Ga0209025_1026751 3300025294 Bacteria 2884
83 Ga0209050_1011411 3300025298 Bacteria 4217
84 Ga0207697_10292549 3300025315 Bacteria 722
85 Ga0207655_1112114 3300025728 Bacteria 919
86 Ga0207713_1056631 3300025735 Bacteria 1521
87 Ga0207680_10532183 3300025903 Bacteria 838
88 Ga0207645_10794264 3300025907 Bacteria 644
89 Ga0207695_10001990 3300025913 Bacteria 31545
90 Ga0207671_10173282 3300025914 Bacteria 1676
91 Ga0207671_10856954 3300025914 Bacteria 719
92 Ga0207660_10737014 3300025917 Bacteria 804
93 Ga0207681_10028100 3300025923 Bacteria 3642
94 Ga0207694_10039780 3300025924 Bacteria 3619
95 Ga0207694_10201679 3300025924 Bacteria 1619
96 Ga0207686_11555479 3300025934 Unclassified 546
97 Ga0207691_10100234 3300025940 Bacteria 2585
98 Ga0207711_10093121 3300025941 Bacteria 2654
99 Ga0207651_10710630 3300025960 Bacteria 886
100 Ga0207668_10293729 3300025972 Bacteria 1338
101 Ga0207639_10469720 3300026041 Bacteria 1145
102 Ga0207702_10140665 3300026078 Bacteria 2183
103 Ga0207641_10868404 3300026088 Bacteria 895
104 Ga0207648_10145852 3300026089 Bacteria 2088
105 Ga0207674_10452385 3300026116 Bacteria 1241
106 Ga0207675_100426195 3300026118 Bacteria 1311
107 Ga0207683_10085964 3300026121 Bacteria 2796
108 Ga0207683_10297487 3300026121 Bacteria 1476
109 Ga0207698_10011175 3300026142 Bacteria 5808
110 Ga0207698_12295653 3300026142 Bacteria 552
111 Ga0268266_10000987 3300028379 Bacteria 35837
112 Ga0268266_10378708 3300028379 Bacteria 1334
113 Ga0307517_10319860 3300028786 Bacteria 859
114 Ga0307515_10129647 3300028794 Bacteria 2788
115 Ga0307515_10489808 3300028794 Bacteria 841
116 Ga0307515_10885275 3300028794 Bacteria 522
117 Ga0307513_10007102 3300031456 Bacteria 14562
118 Ga0307513_10180628 3300031456 Bacteria 1974
119 Ga0307513_10382169 3300031456 Bacteria 1147
120 Ga0307513_10476285 3300031456 Bacteria 969
121 Ga0307509_10524128 3300031507 Bacteria 866
122 Ga0307408_100192582 3300031548 Bacteria 1644
123 Ga0307408_100911252 3300031548 Bacteria 805
124 Ga0307516_10284838 3300031730 Bacteria 1333
125 Ga0307412_10167310 3300031911 Bacteria 1640
126 Ga0307416_100078275 3300032002 Bacteria 2781
127 Ga0307416_102037680 3300032002 Bacteria 676
128 Ga0307510_10616380 3300033180 Bacteria 539
129 Ga0395900_0091438 3300037418 Bacteria 3127
130 Ga0395898_0065185 3300037466 Bacteria 3532
131 Ga0395901_0421801 3300038443 Bacteria 1368
132 Ga0439466_0064979 3300041411 Bacteria 1170
133 Ga0451789_0293198 3300041443 Bacteria 3518
134 Ga0451793_0629014 3300041452 Bacteria 2668
135 Ga0451797_0348275 3300041453 Bacteria 539
136 Ga0451795_0338133 3300041456 Bacteria 1234
137 Ga0451798_0786215 3300041458 Bacteria 2701
138 Ga0451800_0034565 3300041459 Bacteria 2569
139 Ga0451802_1220744 3300041460 Bacteria 1566
140 Ga0451855_0663656 3300041511 Bacteria 840
141 Ga0451853_1118044 3300041512 Bacteria 626
142 Ga0450908_000020 3300042184 Bacteria 37390
143 Ga0495603_0001298 3300046455 Bacteria 14539
144 Ga0495603_0006630 3300046455 Bacteria 6946
145 Ga0495629_0007166 3300046459 Bacteria 8213
146 Ga0495638_0000009 3300046460 Bacteria 525345
147 Ga0495638_0021911 3300046460 Bacteria 4200
148 Ga0495638_0077334 3300046460 Bacteria 2026
149 Ga0495653_0000048 3300046463 Bacteria 109560
150 Ga0495653_0812851 3300046463 Bacteria 561
151 Ga0495650_0005519 3300046471 Bacteria 8174
152 Ga0495650_0013906 3300046471 Bacteria 4226
153 Ga0495650_0192980 3300046471 Unclassified 711
154 Ga0495650_0244862 3300046471 Bacteria 611
155 Ga0495580_0000009 3300046472 Bacteria 101827
156 Ga0495580_0005458 3300046472 Bacteria 10510
157 Ga0495580_0008411 3300046472 Bacteria 8209
158 Ga0495580_0063214 3300046472 Bacteria 2596
159 Ga0495582_0005110 3300046473 Bacteria 7350
160 Ga0495582_0042725 3300046473 Bacteria 2496
161 Ga0495605_0002377 3300046474 Bacteria 11681
162 Ga0495605_0005217 3300046474 Bacteria 7575
163 Ga0495605_0009645 3300046474 Bacteria 5423
164 Ga0495639_0023844 3300046475 Bacteria 2691
165 Ga0495584_0153630 3300046491 Bacteria 1169
166 Ga0495594_0310811 3300046499 Bacteria 898
167 Ga0495594_0699102 3300046499 Bacteria 573
168 Ga0495596_0060926 3300046500 Bacteria 1470
169 Ga0495596_0213496 3300046500 Bacteria 749
170 Ga0495583_0004359 3300046506 Bacteria 10200
171 Ga0495583_0263226 3300046506 Bacteria 689
172 Ga0495610_0005285 3300046512 Bacteria 9234
173 Ga0495610_0199806 3300046512 Bacteria 819
174 Ga0495616_0004030 3300046513 Bacteria 9331
175 Ga0495618_0783205 3300046514 Bacteria 556
176 Ga0495620_0028033 3300046515 Bacteria 2625
177 Ga0495620_0105108 3300046515 Unclassified 1123
178 Ga0495620_0152932 3300046515 Bacteria 899
179 Ga0495620_0187106 3300046515 Bacteria 799
180 Ga0495628_0010561 3300046516 Bacteria 7837
181 Ga0495630_0005008 3300046517 Bacteria 9319
182 Ga0495631_0000034 3300046518 Bacteria 84600
183 Ga0495631_0004507 3300046518 Bacteria 7402
184 Ga0495637_0087133 3300046520 Bacteria 1237
185 Ga0495643_0208460 3300046522 Bacteria 934
186 Ga0495644_0051156 3300046523 Bacteria 1551
187 Ga0495648_0020158 3300046524 Bacteria 4662
188 Ga0495648_0048986 3300046524 Bacteria 2594
189 Ga0495648_0110287 3300046524 Bacteria 1498
190 Ga0495648_0366981 3300046524 Bacteria 653
191 Ga0495666_0477409 3300046526 Bacteria 558
192 Ga0495642_0002122 3300046528 Bacteria 8196
193 Ga0495642_0138592 3300046528 Bacteria 1049
194 Ga0495642_0180792 3300046528 Bacteria 918
195 Ga0495652_0749715 3300046529 Bacteria 653
196 Ga0495654_0009859 3300046530 Bacteria 5219
197 Ga0495654_0244887 3300046530 Bacteria 749
198 Ga0495665_0051252 3300046531 Bacteria 2186
199 Ga0495665_0081792 3300046531 Bacteria 1698
200 Ga0495665_0146513 3300046531 Bacteria 1233
201 Ga0495640_0635631 3300046533 Bacteria 643
202 Ga0495621_0000487 3300046539 Bacteria 9778
203 Ga0495645_0006296 3300046543 Bacteria 8231
204 Ga0495622_0000004 3300046557 Bacteria 258984
205 Ga0495622_0017785 3300046557 Bacteria 3309
206 Ga0495622_0066853 3300046557 Bacteria 1661
207 Ga0495633_0006367 3300046558 Bacteria 7011
208 Ga0495667_0056510 3300046559 Bacteria 2581
209 Ga0495668_0029656 3300046616 Bacteria 3090
210 Ga0495668_0345041 3300046616 Bacteria 817
211 Ga0495611_0270887 3300046648 Bacteria 785
212 Ga0495625_0000606 3300046660 Bacteria 52107
213 Ga0495625_0011706 3300046660 Bacteria 7132
214 Ga0495625_0014791 3300046660 Bacteria 6211
215 Ga0495625_0036359 3300046660 Bacteria 3620
216 Ga0495625_0453172 3300046660 Bacteria 792
217 Ga0495625_0549201 3300046660 Bacteria 700
218 Ga0495625_0647100 3300046660 Bacteria 630
219 Ga0495661_0021357 3300046665 Bacteria 4222
220 Ga0495661_0034312 3300046665 Bacteria 3193
221 Ga0495588_0011576 3300046674 Bacteria 4143
222 Ga0495588_0074947 3300046674 Bacteria 1762
223 Ga0495646_0002123 3300046680 Bacteria 12033
224 Ga0495669_0017744 3300046684 Bacteria 3056
225 Ga0495669_0062506 3300046684 Bacteria 1687
226 Ga0495669_0259414 3300046684 Bacteria 835
227 Ga0495613_0048455 3300046689 Bacteria 3138
228 Ga0495613_0135205 3300046689 Bacteria 1764
229 Ga0495624_0001218 3300046690 Bacteria 20272
230 Ga0495624_0003518 3300046690 Bacteria 11613
231 Ga0495671_0017049 3300046692 Bacteria 3869
232 Ga0495671_0079482 3300046692 Bacteria 1607
233 Ga0495671_0086016 3300046692 Bacteria 1540
234 Ga0495671_0122103 3300046692 Bacteria 1271
235 Ga0495671_0231644 3300046692 Bacteria 893
236 Ga0495649_0046686 3300046694 Bacteria 2358
237 Ga0495649_0277016 3300046694 Bacteria 857
238 Ga0495589_0086291 3300046794 Bacteria 1524
239 Ga0495589_0257682 3300046794 Bacteria 814
240 Ga0495660_0157439 3300046810 Bacteria 1117
241 Ga0495660_0467318 3300046810 Bacteria 543
242 Ga0495581_0002591 3300047315 Bacteria 10274
243 Ga0495674_0002157 3300047319 Bacteria 19320
244 Ga0495674_0005831 3300047319 Bacteria 11813
245 Ga0495674_0006867 3300047319 Bacteria 10892
246 Ga0495672_0000346 3300047320 Bacteria 59410
247 Ga0495672_0016459 3300047320 Bacteria 4981
248 Ga0495672_0131535 3300047320 Bacteria 1316
249 Ga0495672_0145159 3300047320 Bacteria 1235
250 Ga0495676_0053231 3300047321 Bacteria 3227
251 Ga0495680_0258381 3300047322 Bacteria 1232
252 Ga0495683_0134088 3300047323 Bacteria 1165
253 Ga0495683_0371603 3300047323 Bacteria 600
254 Ga0495675_0019756 3300047444 Bacteria 4281
255 Ga0495679_000038 3300047446 Bacteria 157311
256 Ga0495673_0000096 3300047469 Bacteria 182792
257 Ga0495673_0018481 3300047469 Bacteria 3512
258 Ga0495673_0030438 3300047469 Bacteria 2534
259 Ga0495681_0046105 3300047470 Bacteria 2081
260 Ga0495686_0000171 3300047472 Bacteria 123194
261 Ga0495686_0090099 3300047472 Bacteria 1863
262 Ga0495686_0097114 3300047472 Bacteria 1782
263 Ga0495686_0268695 3300047472 Bacteria 952
264 Ga0495593_0054924 3300047673 Bacteria 2098
265 Ga0495602_0094941 3300048088 Bacteria 2463
266 Ga0495626_0102965 3300048091 Bacteria 1243
267 Ga0496100_0072993 3300048903 Bacteria 2295
268 Ga0496100_0083249 3300048903 Bacteria 2165
269 Ga0496100_1194525 3300048903 Unclassified 600
270 Ga0496101_0019818 3300048904 Bacteria 4599
271 Ga0496101_0037949 3300048904 Bacteria 3419
272 Ga0496102_0193043 3300048905 Bacteria 1919
273 Ga0496103_0617054 3300048906 Bacteria 690
274 Ga0496104_0055503 3300048907 Bacteria 3746
275 Ga0496104_0092704 3300048907 Bacteria 2888
276 Ga0496105_0018141 3300048908 Bacteria 5650
277 Ga0496105_0151992 3300048908 Bacteria 1902
278 Ga0496106_0055937 3300048909 Bacteria 2983
279 Ga0496110_0025509 3300048913 Bacteria 5052
280 Ga0496111_1205088 3300048914 Bacteria 536
281 Ga0496112_0028589 3300048915 Bacteria 5383
282 Ga0496113_0000910 3300048916 Bacteria 15618
283 Ga0496114_0037251 3300048917 Bacteria 4023
284 Ga0496114_0654513 3300048917 Bacteria 924
285 Ga0496115_0005763 3300048918 Bacteria 9020
286 Ga0496115_0104761 3300048918 Bacteria 2321
287 Ga0496115_1447790 3300048918 Bacteria 505
288 Ga0496116_0084581 3300048919 Bacteria 1953
289 Ga0496117_0066746 3300048920 Bacteria 2438
290 Ga0496117_0249188 3300048920 Bacteria 970
291 Ga0496117_0620832 3300048920 Bacteria 502
292 Ga0496118_0016273 3300048921 Bacteria 6830
293 Ga0496118_0129718 3300048921 Bacteria 1622
294 Ga0496119_0114110 3300048922 Bacteria 1495
295 Ga0496120_0419462 3300048923 Bacteria 588
296 Ga0496121_0029227 3300048924 Bacteria 5105
297 Ga0496121_0032127 3300048924 Bacteria 4778
298 Ga0496121_0075659 3300048924 Bacteria 2688
299 Ga0496121_0080934 3300048924 Bacteria 2572
300 Ga0496121_0309342 3300048924 Bacteria 1069
301 Ga0496121_0642102 3300048924 Bacteria 648
302 Ga0496121_0655398 3300048924 Unclassified 639
303 Ga0496121_0850521 3300048924 Bacteria 530
304 Ga0496122_0258194 3300048925 Bacteria 969
305 Ga0496123_0057017 3300048926 Bacteria 2547
306 Ga0496123_0059325 3300048926 Bacteria 2475
307 Ga0496124_0570867 3300048927 Bacteria 742
308 Ga0496125_0000947 3300048928 Bacteria 45544
309 Ga0496125_0021636 3300048928 Bacteria 5993
310 Ga0496125_0172242 3300048928 Bacteria 1453
311 Ga0496126_0040616 3300048929 Bacteria 4312
312 Ga0496126_0074369 3300048929 Bacteria 3018
313 Ga0496126_0099695 3300048929 Bacteria 2544
314 Ga0496126_0129639 3300048929 Bacteria 2180
315 Ga0496126_0136154 3300048929 Bacteria 2119
316 Ga0496126_0144494 3300048929 Bacteria 2045
317 Ga0495678_143459 3300049459 Bacteria 779
318 Ga0495682_0007841 3300049460 Bacteria 4223
319 Ga0501039_0418313 3300049575 Unclassified 1053
320 Ga0501076_1270415 3300049592 Bacteria 606
321 Ga0501077_0446861 3300049593 Bacteria 828
322 Ga0501261_049019 3300049690 Bacteria 687
323 Ga0501044_0919576 3300049823 Unclassified 749
324 nmdc:mga03n38_378226_c1 3300050490 Bacteria 775
325 nmdc:mga0yw44_551984_c1 3300050492 Bacteria 782
326 nmdc:mga0k408_161338_c1 3300050493 Bacteria 1336
327 nmdc:mga07m45_66148_c1 3300050496 Bacteria 2053
328 Ga0500635_0116399 3300053080 Bacteria 997
329 Ga0495655_0336616 3300053083 Bacteria 526
330 Ga0500644_0186661 3300053088 Bacteria 851
331 Ga0500646_0003831 3300053090 Bacteria 3842
332 Ga0500651_0439149 3300053093 Bacteria 728
333 Ga0500566_0156032 3300053094 Bacteria 1195
334 Ga0500650_0041973 3300053098 Bacteria 2113
335 Ga0500562_001659 3300053108 Bacteria 5536
336 Ga0500562_005265 3300053108 Bacteria 3252
337 Ga0500562_079611 3300053108 Bacteria 886
338 Ga0500562_104100 3300053108 Bacteria 773
339 Ga0500569_059096 3300053109 Bacteria 1179
340 Ga0500572_181343 3300053111 Bacteria 690
341 Ga0500595_007507 3300053119 Bacteria 4523
342 Ga0500595_013335 3300053119 Bacteria 3151
343 Ga0500595_028382 3300053119 Bacteria 1908
344 Ga0500623_178941 3300053127 Bacteria 821
345 Ga0500642_0001960 3300053130 Bacteria 5967
346 Ga0500652_000268 3300053131 Bacteria 19453
347 Ga0500655_002666 3300053133 Bacteria 3235
348 Ga0500658_0000554 3300053134 Bacteria 15719
349 Ga0500568_0002458 3300053139 Bacteria 10893
350 Ga0500568_0117838 3300053139 Bacteria 990
351 Ga0500577_0025248 3300053142 Bacteria 2008
352 Ga0500579_159514 3300053143 Bacteria 956
353 Ga0500586_000969 3300053145 Bacteria 5914
354 Ga0500604_0002818 3300053151 Bacteria 4719
355 Ga0500616_0000093 3300053153 Bacteria 183114
356 Ga0500616_0023743 3300053153 Bacteria 3413
357 Ga0500616_0091885 3300053153 Bacteria 1501
358 Ga0500622_0000139 3300053156 Bacteria 77751
359 Ga0500627_0307486 3300053158 Bacteria 691
360 Ga0500627_0381247 3300053158 Bacteria 604
361 Ga0500638_178037 3300053162 Bacteria 920
362 Ga0500636_0397269 3300053177 Bacteria 641
363 Ga0500637_0044706 3300053178 Bacteria 2510
364 Ga0500645_008145 3300053730 Bacteria 3602
365 Ga0530510_0186284 3300061734 Bacteria 1540
366 2563059751 2562617112 Bacteria 10918404
367 2713480541 2711768613 Bacteria 11048459
368 Ga0495674_0025641
369 JGI25156J39149_1000059
370 JGI25162J39368_1003795
371 JGI25154J39366_1000056
372 JGI25157J39369_1000123
373 Ga0055532_1000059
374 Ga0055535_1007894
375 Ga0070658_11688798
376 Ga0070677_10140089
377 Ga0070666_10416434
378 Ga0070669_100006637
379 Ga0070673_100196587
380 Ga0070688_100313013
381 Ga0070713_100122648
382 Ga0070708_101255612
383 Ga0070678_100064287
384 Ga0070678_100525036
385 Ga0070681_10142853
386 Ga0070681_10564363
387 Ga0070672_100046116
388 Ga0070665_100026867
389 Ga0070665_100429420
390 Ga0068854_100376333
391 Ga0068856_100195235
392 Ga0068852_100003034
393 Ga0075365_10465322
394 Ga0075364_11093129
395 Ga0075366_10256276
396 Ga0075370_10070891
397 Ga0075431_101253467
398 Ga0068865_101338468
399 Ga0105251_10115770
400 Ga0105244_10031275
401 Ga0105241_12527907
402 Ga0105242_10767245
403 Ga0105248_10147355
404 Ga0105248_10709749
405 Ga0105248_11413818
406 Ga0105237_11152234
407 Ga0105238_10645242
408 Ga0105249_11272528
409 Ga0105246_10026587
410 Ga0157373_10021917
411 Ga0157373_10259846
412 Ga0157371_10050816
413 Ga0157370_10007879
414 Ga0157370_10140666
415 Ga0163162_12840895
416 Ga0163163_11990155
417 Ga0157380_10207229
418 Ga0182008_10002182
419 Ga0182008_10011027
420 Ga0182008_10014203
421 Ga0157376_11647084
422 Ga0182006_1021732
423 Ga0182006_1113811
424 Ga0182007_10007776
425 Ga0182007_10110633
426 Ga0182005_1219690
427 Ga0163161_10000042
428 Ga0163161_10411449
429 Ga0209435_100032
430 Ga0209672_100149
431 Ga0209147_100109
432 Ga0207427_100581
433 Ga0209437_100180
434 Ga0209437_100195
435 Ga0209258_100190
436 Ga0209646_1000113
437 Ga0209026_1000102
438 Ga0209026_1003397
439 Ga0209026_1019151
440 Ga0209148_1015251
441 Ga0209759_1000104
442 Ga0209759_1002408
443 Ga0209233_1014480
444 Ga0209455_1006419
445 Ga0209455_1006830
446 Ga0209675_1003885
447 Ga0209676_1015207
448 Ga0209025_1000038
449 Ga0209025_1026751
450 Ga0209050_1011411
451 Ga0207697_10292549
452 Ga0207655_1112114
453 Ga0207713_1056631
454 Ga0207680_10532183
455 Ga0207645_10794264
456 Ga0207695_10001990
457 Ga0207671_10173282
458 Ga0207671_10856954
459 Ga0207660_10737014
460 Ga0207681_10028100
461 Ga0207694_10039780
462 Ga0207694_10201679
463 Ga0207686_11555479
464 Ga0207691_10100234
465 Ga0207711_10093121
466 Ga0207651_10710630
467 Ga0207668_10293729
468 Ga0207639_10469720
469 Ga0207702_10140665
470 Ga0207641_10868404
471 Ga0207648_10145852
472 Ga0207674_10452385
473 Ga0207675_100426195
474 Ga0207683_10085964
475 Ga0207683_10297487
476 Ga0207698_10011175
477 Ga0207698_12295653
478 Ga0268266_10000987
479 Ga0268266_10378708
480 Ga0307517_10319860
481 Ga0307515_10129647
482 Ga0307515_10489808
483 Ga0307515_10885275
484 Ga0307513_10007102
485 Ga0307513_10180628
486 Ga0307513_10382169
487 Ga0307513_10476285
488 Ga0307509_10524128
489 Ga0307408_100192582
490 Ga0307408_100911252
491 Ga0307516_10284838
492 Ga0307412_10167310
493 Ga0307416_100078275
494 Ga0307416_102037680
495 Ga0307510_10616380
496 Ga0395900_0091438
497 Ga0395898_0065185
498 Ga0395901_0421801
499 Ga0439466_0064979
500 Ga0451789_0293198
501 Ga0451793_0629014
502 Ga0451797_0348275
503 Ga0451795_0338133
504 Ga0451798_0786215
505 Ga0451800_0034565
506 Ga0451802_1220744
507 Ga0451855_0663656
508 Ga0451853_1118044
509 Ga0450908_000020
510 Ga0495603_0001298
511 Ga0495603_0006630
512 Ga0495629_0007166
513 Ga0495638_0000009
514 Ga0495638_0021911
515 Ga0495638_0077334
516 Ga0495653_0000048
517 Ga0495653_0812851
518 Ga0495650_0005519
519 Ga0495650_0013906
520 Ga0495650_0192980
521 Ga0495650_0244862
522 Ga0495580_0000009
523 Ga0495580_0005458
524 Ga0495580_0008411
525 Ga0495580_0063214
526 Ga0495582_0005110
527 Ga0495582_0042725
528 Ga0495605_0002377
529 Ga0495605_0005217
530 Ga0495605_0009645
531 Ga0495639_0023844
532 Ga0495584_0153630
533 Ga0495594_0310811
534 Ga0495594_0699102
535 Ga0495596_0060926
536 Ga0495596_0213496
537 Ga0495583_0004359
538 Ga0495583_0263226
539 Ga0495610_0005285
540 Ga0495610_0199806
541 Ga0495616_0004030
542 Ga0495618_0783205
543 Ga0495620_0028033
544 Ga0495620_0105108
545 Ga0495620_0152932
546 Ga0495620_0187106
547 Ga0495628_0010561
548 Ga0495630_0005008
549 Ga0495631_0000034
550 Ga0495631_0004507
551 Ga0495637_0087133
552 Ga0495643_0208460
553 Ga0495644_0051156
554 Ga0495648_0020158
555 Ga0495648_0048986
556 Ga0495648_0110287
557 Ga0495648_0366981
558 Ga0495666_0477409
559 Ga0495642_0002122
560 Ga0495642_0138592
561 Ga0495642_0180792
562 Ga0495652_0749715
563 Ga0495654_0009859
564 Ga0495654_0244887
565 Ga0495665_0051252
566 Ga0495665_0081792
567 Ga0495665_0146513
568 Ga0495640_0635631
569 Ga0495621_0000487
570 Ga0495645_0006296
571 Ga0495622_0000004
572 Ga0495622_0017785
573 Ga0495622_0066853
574 Ga0495633_0006367
575 Ga0495667_0056510
576 Ga0495668_0029656
577 Ga0495668_0345041
578 Ga0495611_0270887
579 Ga0495625_0000606
580 Ga0495625_0011706
581 Ga0495625_0014791
582 Ga0495625_0036359
583 Ga0495625_0453172
584 Ga0495625_0549201
585 Ga0495625_0647100
586 Ga0495661_0021357
587 Ga0495661_0034312
588 Ga0495588_0011576
589 Ga0495588_0074947
590 Ga0495646_0002123
591 Ga0495669_0017744
592 Ga0495669_0062506
593 Ga0495669_0259414
594 Ga0495613_0048455
595 Ga0495613_0135205
596 Ga0495624_0001218
597 Ga0495624_0003518
598 Ga0495671_0017049
599 Ga0495671_0079482
600 Ga0495671_0086016
601 Ga0495671_0122103
602 Ga0495671_0231644
603 Ga0495649_0046686
604 Ga0495649_0277016
605 Ga0495589_0086291
606 Ga0495589_0257682
607 Ga0495660_0157439
608 Ga0495660_0467318
609 Ga0495581_0002591
610 Ga0495674_0002157
611 Ga0495674_0005831
612 Ga0495674_0006867
613 Ga0495672_0000346
614 Ga0495672_0016459
615 Ga0495672_0131535
616 Ga0495672_0145159
617 Ga0495676_0053231
618 Ga0495680_0258381
619 Ga0495683_0134088
620 Ga0495683_0371603
621 Ga0495675_0019756
622 Ga0495679_000038
623 Ga0495673_0000096
624 Ga0495673_0018481
625 Ga0495673_0030438
626 Ga0495681_0046105
627 Ga0495686_0000171
628 Ga0495686_0090099
629 Ga0495686_0097114
630 Ga0495686_0268695
631 Ga0495593_0054924
632 Ga0495602_0094941
633 Ga0495626_0102965
634 Ga0496100_0072993
635 Ga0496100_0083249
636 Ga0496100_1194525
637 Ga0496101_0019818
638 Ga0496101_0037949
639 Ga0496102_0193043
640 Ga0496103_0617054
641 Ga0496104_0055503
642 Ga0496104_0092704
643 Ga0496105_0018141
644 Ga0496105_0151992
645 Ga0496106_0055937
646 Ga0496110_0025509
647 Ga0496111_1205088
648 Ga0496112_0028589
649 Ga0496113_0000910
650 Ga0496114_0037251
651 Ga0496114_0654513
652 Ga0496115_0005763
653 Ga0496115_0104761
654 Ga0496115_1447790
655 Ga0496116_0084581
656 Ga0496117_0066746
657 Ga0496117_0249188
658 Ga0496117_0620832
659 Ga0496118_0016273
660 Ga0496118_0129718
661 Ga0496119_0114110
662 Ga0496120_0419462
663 Ga0496121_0029227
664 Ga0496121_0032127
665 Ga0496121_0075659
666 Ga0496121_0080934
667 Ga0496121_0309342
668 Ga0496121_0642102
669 Ga0496121_0655398
670 Ga0496121_0850521
671 Ga0496122_0258194
672 Ga0496123_0057017
673 Ga0496123_0059325
674 Ga0496124_0570867
675 Ga0496125_0000947
676 Ga0496125_0021636
677 Ga0496125_0172242
678 Ga0496126_0040616
679 Ga0496126_0074369
680 Ga0496126_0099695
681 Ga0496126_0129639
682 Ga0496126_0136154
683 Ga0496126_0144494
684 Ga0495678_143459
685 Ga0495682_0007841
686 Ga0501039_0418313
687 Ga0501076_1270415
688 Ga0501077_0446861
689 Ga0501261_049019
690 Ga0501044_0919576
691 nmdc:mga03n38_378226_c1
692 nmdc:mga0yw44_551984_c1
693 nmdc:mga0k408_161338_c1
694 nmdc:mga07m45_66148_c1
695 Ga0500635_0116399
696 Ga0495655_0336616
697 Ga0500644_0186661
698 Ga0500646_0003831
699 Ga0500651_0439149
700 Ga0500566_0156032
701 Ga0500650_0041973
702 Ga0500562_001659
703 Ga0500562_005265
704 Ga0500562_079611
705 Ga0500562_104100
706 Ga0500569_059096
707 Ga0500572_181343
708 Ga0500595_007507
709 Ga0500595_013335
710 Ga0500595_028382
711 Ga0500623_178941
712 Ga0500642_0001960
713 Ga0500652_000268
714 Ga0500655_002666
715 Ga0500658_0000554
716 Ga0500568_0002458
717 Ga0500568_0117838
718 Ga0500577_0025248
719 Ga0500579_159514
720 Ga0500586_000969
721 Ga0500604_0002818
722 Ga0500616_0000093
723 Ga0500616_0023743
724 Ga0500616_0091885
725 Ga0500622_0000139
726 Ga0500627_0307486
727 Ga0500627_0381247
728 Ga0500638_178037
729 Ga0500636_0397269
730 Ga0500637_0044706
731 Ga0500645_008145
732 Ga0530510_0186284
733 2563059751
734 2713480541

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00893

Multi_Drug_Res

Small Multidrug Resistance protein

26

118

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8tgy-assembly1.cif.gz_E crystal structure of gdx-clo from small multidrug resistance family of transporters in complex with guanylurea 0.9329 1 106
8tgy-assembly1.cif.gz_E crystal structure of gdx-clo from small multidrug resistance family of transporters in complex with guanylurea 0.9245 1 106
7ssu-assembly1.cif.gz_B structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium 0.8832 1 98
7mgx-assembly1.cif.gz_B structure of emre-d3 mutant in complex with monobody l10 and methyl viologen 0.8714 1 98
7mgx-assembly2.cif.gz_F structure of emre-d3 mutant in complex with monobody l10 and methyl viologen 0.8585 1 98
ID Description Score Start End Superfamily
af_P69937_1_105_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.989 1 104 1.10.3730.20
af_P69937_1_105_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.9705 1 104 1.10.3730.20
af_P9WGF1_2_106_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.9104 3 103 1.10.3730.20
af_Q4DEW8_2_121_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8781 5 105 1.10.3730.20
af_P69212_3_109_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8767 1 101 1.10.3730.20
ID Description Score Start End GO Terms
AF-A0A2E3Q1A7-F1-model_v4 QacE family quaternary ammonium compound efflux SMR transporter 0.9965 1 102 GO:0005886
GO:0022857
AF-A0A4R7PG08-F1-model_v4 deleted 0.9964 1 103
AF-C6B3X2-F1-model_v4 Guanidinium exporter 0.995 1 106 GO:0005886
GO:0022857
AF-A0A3P5WN29-F1-model_v4 Quaternary ammonium compound-resistance protein SugE 0.9944 2 102 GO:0005886
GO:0022857
AF-A0A1M4DVB0-F1-model_v4 Quaternary ammonium compound-resistance protein SugE 0.9931 1 104 GO:0005886
GO:0022857

Map