F424496

General Info

Members Datasets Scaffolds Average Seq Length
367 245 734 329

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0010531|Ga0501032_0010531_334_1482
Length 382
Sequence MFAWRLLYAGRELFAALQCPGYRLTGLSAAALLNQKSDESISASIGGWLPVHSNQGVSSPLGRALLRIFSPAGQRGRLSILIYHRVLPQVDPLFPEAGDAESFDRQMGLLADCFKVIPLADAVQGLRSRNLPSRAACVTFDDGYADNAEIALPILKKHAIPATFFVSSGVLDGGRMWNDTVIELIRGAPGDLLDLRTLDLGSFPIGTIIQRRDAIDKLIRELKHLPPESRRSRVEQMRSVILADPPDNLMMTSEQVRLLHRAGMEIGGHTVLHPILASTEKSAARAEIANGKEMLEGIIRAPVRFFAYPNGKPERDYLPEHVAMVRELGFEAAVSTAHGAARPGDDIYQLPRFTPWDRGGQARFVFRMIQNMLRNTATVSPQ

Samples

Sample ID Description Type Environment
1 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
6 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
77 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
78 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
82 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
118 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
119 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
120 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
130 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
135 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
136 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
137 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
138 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
139 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
140 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
141 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
142 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
143 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
144 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
145 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
146 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
147 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
148 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
149 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
150 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
151 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
152 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
153 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
154 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
155 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
156 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
157 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
158 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
159 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
160 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
161 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
162 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
163 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
164 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
165 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
166 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
169 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
170 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
171 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
172 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
173 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
174 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
175 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
176 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
177 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
178 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
179 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
180 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
181 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
182 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
183 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
184 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
185 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
186 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
187 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
188 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
189 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
190 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
191 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
192 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
204 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
205 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
206 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
218 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
219 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
220 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
221 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
222 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
226 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
227 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
228 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
229 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
230 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
231 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
232 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
233 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
234 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
235 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
236 2643221638 Duganella sp. Root336D2 Isolate Unclassified
237 2643221645 Massilia sp. Root351 Isolate Unclassified
238 2643221664 Massilia sp. Root418 Isolate Unclassified
239 2738541280 Massilia sp. GV090 Isolate Unclassified
240 2738541300 Massilia sp. GV016 Isolate Unclassified
241 2738543018 Massilia sp. GV045 Isolate Unclassified
242 2738543030 Massilia sp. GV097 Isolate Unclassified
243 2904424332 Duganella sp. 1411 Isolate Rhizosphere
244 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
245 639633007 Azoarcus olearius BH72 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.73
Metatranscriptomes 0
Isolates 3.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.72
Nodule 0.54
Rhizoplane 3.81
Rhizosphere 78.75
Stem 0
Stem Tuber 0
Unclassified 5.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501032_0010531 3300049569 Bacteria 6668
2 JGI25158J39367_1000916 3300002739 Bacteria 5525
3 JGI25159J45721_1001405 3300002987 Bacteria 10000
4 rootH1_10057277 3300003323 Bacteria 2914
5 JGI25161J50226_1000475 3300003374 Bacteria 18171
6 Ga0055525_1000011 3300003759 Bacteria 503124
7 Ga0055526_1001131 3300003771 Bacteria 19366
8 Ga0055537_1000065 3300003773 Bacteria 77086
9 Ga0055537_1002202 3300003773 Bacteria 6763
10 Ga0055537_1005843 3300003773 Bacteria 3222
11 Ga0055524_1000017 3300003775 Bacteria 235608
12 Ga0055524_1001292 3300003775 Bacteria 14689
13 Ga0055524_1008702 3300003775 Bacteria 4196
14 Ga0055534_1000357 3300003784 Bacteria 28958
15 Ga0055528_1000565 3300003790 Bacteria 28147
16 Ga0055530_10001057 3300003791 Bacteria 21831
17 Ga0055530_10001628 3300003791 Bacteria 16077
18 Ga0055543_1000510 3300004625 Bacteria 22238
19 Ga0065165_1000045 3300005262 Bacteria 198887
20 Ga0065165_1033223 3300005262 Bacteria 1607
21 Ga0065707_10000966 3300005295 Bacteria 9652
22 Ga0070676_10055569 3300005328 Bacteria 2337
23 Ga0070683_100061181 3300005329 Bacteria 3501
24 Ga0070670_100013310 3300005331 Bacteria 7046
25 Ga0070670_100027999 3300005331 Bacteria 4850
26 Ga0070670_100105497 3300005331 Unclassified 2428
27 Ga0070677_10009314 3300005333 Bacteria 3327
28 Ga0068869_100010140 3300005334 Bacteria 6133
29 Ga0070666_10023902 3300005335 Bacteria 3979
30 Ga0070666_10025742 3300005335 Bacteria 3838
31 Ga0068868_100023008 3300005338 Bacteria 4712
32 Ga0070689_100005474 3300005340 Bacteria 8678
33 Ga0070689_100035809 3300005340 Bacteria 3793
34 Ga0070687_100015516 3300005343 Bacteria 3448
35 Ga0070687_100146934 3300005343 Bacteria 1379
36 Ga0070661_100004060 3300005344 Bacteria 10080
37 Ga0070668_100003031 3300005347 Bacteria 12429
38 Ga0070668_100026244 3300005347 Bacteria 4419
39 Ga0070668_100068288 3300005347 Unclassified 2763
40 Ga0070669_100041521 3300005353 Bacteria 3345
41 Ga0070675_100052769 3300005354 Bacteria 3343
42 Ga0070671_100001343 3300005355 Bacteria 18414
43 Ga0070674_100003397 3300005356 Bacteria 8925
44 Ga0070674_100025073 3300005356 Bacteria 3877
45 Ga0070673_100015395 3300005364 Bacteria 5371
46 Ga0070659_100197032 3300005366 Bacteria 1657
47 Ga0070667_100022333 3300005367 Bacteria 5248
48 Ga0070714_100002274 3300005435 Bacteria 14121
49 Ga0070663_100058683 3300005455 Bacteria 2764
50 Ga0070685_10028890 3300005466 Bacteria 3076
51 Ga0070684_100132730 3300005535 Bacteria 2247
52 Ga0070672_100026370 3300005543 Unclassified 4323
53 Ga0070686_100023021 3300005544 Bacteria 3719
54 Ga0070665_100007632 3300005548 Bacteria 10997
55 Ga0068855_100014444 3300005563 Bacteria 9507
56 Ga0068855_100042549 3300005563 Bacteria 5381
57 Ga0070664_100032848 3300005564 Bacteria 4342
58 Ga0068857_100345968 3300005577 Unclassified 1376
59 Ga0068854_100234722 3300005578 Bacteria 1458
60 Ga0068859_100003219 3300005617 Bacteria 16624
61 Ga0068864_100012060 3300005618 Bacteria 7139
62 Ga0068870_10009876 3300005840 Bacteria 4358
63 Ga0068858_100002941 3300005842 Bacteria 17131
64 Ga0068860_100025938 3300005843 Bacteria 5655
65 Ga0068862_100013870 3300005844 Bacteria 6680
66 Ga0075366_10035158 3300006195 Bacteria 2954
67 Ga0068871_100147409 3300006358 Bacteria 2005
68 Ga0068871_100170627 3300006358 Bacteria 1864
69 Ga0075428_100442851 3300006844 Bacteria 1392
70 Ga0075430_100076671 3300006846 Unclassified 2802
71 Ga0075431_100252518 3300006847 Bacteria 1791
72 Ga0075429_100090842 3300006880 Bacteria 2663
73 Ga0097620_100003219 3300006931 Bacteria 16624
74 Ga0099826_10000062 3300006948 Bacteria 62228
75 Ga0105240_10004096 3300009093 Bacteria 22384
76 Ga0105240_10260330 3300009093 Bacteria 2001
77 Ga0111539_10063657 3300009094 Bacteria 4364
78 Ga0105248_10030731 3300009177 Bacteria 6000
79 Ga0105248_10037560 3300009177 Bacteria 5419
80 Ga0105237_10014590 3300009545 Bacteria 8211
81 Ga0099796_10007477 3300010159 Unclassified 2859
82 Ga0157370_10001007 3300013104 Bacteria 35559
83 Ga0157370_10004833 3300013104 Bacteria 15319
84 Ga0157370_10019726 3300013104 Bacteria 6749
85 Ga0157370_10024313 3300013104 Bacteria 6000
86 Ga0157370_10045777 3300013104 Bacteria 4197
87 Ga0157369_10010568 3300013105 Bacteria 10505
88 Ga0157369_10096245 3300013105 Bacteria 3159
89 Ga0157374_10005460 3300013296 Bacteria 10676
90 Ga0157378_10000769 3300013297 Bacteria 29750
91 Ga0157378_10093598 3300013297 Bacteria 2736
92 Ga0157372_10026314 3300013307 Bacteria 6330
93 Ga0157372_10285152 3300013307 Bacteria 1920
94 Ga0157372_10345769 3300013307 Bacteria 1733
95 Ga0157375_10035852 3300013308 Unclassified 4739
96 Ga0163163_10000859 3300014325 Bacteria 25868
97 Ga0157380_10119576 3300014326 Viruses 2229
98 Ga0157377_10010846 3300014745 Bacteria 4525
99 Ga0157379_10027795 3300014968 Bacteria 5035
100 Ga0157379_10098033 3300014968 Bacteria 2632
101 Ga0157376_10004366 3300014969 Bacteria 9833
102 Ga0157376_10023034 3300014969 Bacteria 4867
103 Ga0163161_10067747 3300017792 Bacteria 2607
104 Ga0163161_10263535 3300017792 Unclassified 1346
105 Ga0213872_10000014 3300021361 Bacteria 181546
106 Ga0213872_10000029 3300021361 Bacteria 145850
107 Ga0209436_100078 3300025208 Bacteria 49369
108 Ga0209563_100005 3300025230 Bacteria 1774893
109 Ga0209565_1000032 3300025263 Bacteria 316777
110 Ga0209565_1000669 3300025263 Bacteria 21683
111 Ga0209565_1001928 3300025263 Bacteria 8170
112 Ga0209565_1002472 3300025263 Bacteria 6619
113 Ga0209673_1000029 3300025273 Bacteria 351978
114 Ga0209130_1000043 3300025284 Bacteria 254257
115 Ga0209130_1000721 3300025284 Bacteria 29292
116 Ga0209675_1000019 3300025291 Bacteria 351950
117 Ga0209675_1000519 3300025291 Bacteria 28456
118 Ga0209564_1000067 3300025295 Bacteria 311242
119 Ga0209564_1000115 3300025295 Bacteria 208988
120 Ga0209564_1012651 3300025295 Bacteria 3658
121 Ga0209050_1000123 3300025298 Bacteria 195061
122 Ga0209050_1000573 3300025298 Bacteria 59710
123 Ga0209256_1000018 3300025299 Bacteria 568467
124 Ga0209256_1000058 3300025299 Bacteria 272934
125 Ga0209256_1002889 3300025299 Bacteria 13022
126 Ga0209256_1009436 3300025299 Bacteria 4281
127 Ga0209257_1002125 3300025304 Bacteria 20691
128 Ga0207682_10000823 3300025893 Bacteria 14337
129 Ga0207682_10055985 3300025893 Bacteria 1641
130 Ga0207680_10003024 3300025903 Bacteria 7884
131 Ga0207680_10015112 3300025903 Bacteria 4020
132 Ga0207680_10126584 3300025903 Unclassified 1678
133 Ga0207645_10004599 3300025907 Bacteria 10171
134 Ga0207643_10064034 3300025908 Bacteria 2104
135 Ga0207695_10072748 3300025913 Bacteria 3505
136 Ga0207657_10270889 3300025919 Bacteria 1350
137 Ga0207650_10001146 3300025925 Bacteria 19485
138 Ga0207650_10048274 3300025925 Bacteria 3139
139 Ga0207650_10225383 3300025925 Unclassified 1510
140 Ga0207659_10001022 3300025926 Bacteria 16630
141 Ga0207659_10037476 3300025926 Bacteria 3367
142 Ga0207644_10003987 3300025931 Bacteria 9589
143 Ga0207644_10006994 3300025931 Bacteria 7346
144 Ga0207706_10206626 3300025933 Bacteria 1722
145 Ga0207706_10283907 3300025933 Bacteria 1443
146 Ga0207670_10008469 3300025936 Bacteria 5812
147 Ga0207669_10092436 3300025937 Bacteria 1974
148 Ga0207691_10009678 3300025940 Bacteria 9246
149 Ga0207691_10012747 3300025940 Bacteria 8050
150 Ga0207691_10035538 3300025940 Unclassified 4623
151 Ga0207711_10047594 3300025941 Bacteria 3667
152 Ga0207689_10025813 3300025942 Bacteria 4922
153 Ga0207661_10057217 3300025944 Bacteria 3134
154 Ga0207679_10027838 3300025945 Bacteria 3914
155 Ga0207667_10200642 3300025949 Unclassified 2046
156 Ga0207667_10209424 3300025949 Bacteria 1998
157 Ga0207651_10023034 3300025960 Bacteria 3822
158 Ga0207651_10040200 3300025960 Bacteria 3091
159 Ga0207668_10008726 3300025972 Bacteria 6056
160 Ga0207668_10040214 3300025972 Bacteria 3153
161 Ga0207668_10080711 3300025972 Bacteria 2357
162 Ga0207668_10452771 3300025972 Bacteria 1096
163 Ga0207640_10017385 3300025981 Bacteria 4207
164 Ga0207658_10132524 3300025986 Bacteria 2004
165 Ga0207703_10037061 3300026035 Bacteria 3885
166 Ga0207648_10012088 3300026089 Bacteria 8097
167 Ga0207675_100018481 3300026118 Bacteria 6501
168 Ga0207683_10007974 3300026121 Bacteria 9060
169 Ga0207683_10015817 3300026121 Bacteria 6423
170 Ga0207698_10054262 3300026142 Unclassified 3083
171 Ga0209282_1000122 3300027666 Bacteria 49327
172 Ga0268265_10029005 3300028380 Bacteria 3968
173 Ga0268265_10142929 3300028380 Unclassified 2006
174 Ga0268264_10256705 3300028381 Bacteria 1626
175 Ga0265327_10031781 3300031251 Bacteria 2962
176 Ga0265316_10044625 3300031344 Bacteria 3524
177 Ga0265316_10069270 3300031344 Bacteria 2723
178 Ga0307513_10045415 3300031456 Bacteria 4802
179 Ga0307509_10000110 3300031507 Bacteria 117351
180 Ga0307509_10062510 3300031507 Bacteria 3926
181 Ga0307408_100001430 3300031548 Bacteria 17754
182 Ga0307408_100030724 3300031548 Bacteria 3733
183 Ga0307408_100047166 3300031548 Bacteria 3084
184 Ga0307405_10134250 3300031731 Bacteria 1715
185 Ga0307413_10051085 3300031824 Bacteria 2489
186 Ga0307518_10001265 3300031838 Bacteria 18999
187 Ga0307406_10012792 3300031901 Bacteria 4790
188 Ga0307407_10015820 3300031903 Bacteria 3741
189 Ga0307409_100005064 3300031995 Bacteria 7513
190 Ga0307416_100464629 3300032002 Bacteria 1321
191 Ga0307510_10279638 3300033180 Bacteria 1140
192 Ga0373956_0078744 3300035119 Unclassified 1510
193 Ga0373937_0083385 3300036401 Unclassified 2957
194 Ga0395899_0194904 3300037312 Bacteria 1416
195 Ga0395905_0014617 3300037471 Bacteria 7488
196 Ga0436361_0156472 3300039447 Bacteria 142079
197 Ga0436361_0455955 3300039447 Bacteria 2803
198 Ga0436361_1127912 3300039447 Bacteria 46645
199 Ga0451807_1658384 3300041486 Bacteria 1119
200 Ga0451577_0000128 3300042876 Bacteria 167957
201 Ga0451577_0000882 3300042876 Bacteria 44503
202 Ga0451577_0085125 3300042876 Bacteria 2821
203 Ga0453684_0000625 3300044712 Bacteria 128854
204 Ga0453684_0087886 3300044712 Bacteria 3850
205 Ga0453684_0281121 3300044712 Bacteria 1898
206 Ga0466968_0010478 3300044735 Bacteria 3595
207 Ga0451576_0001736 3300045051 Bacteria 35844
208 Ga0451576_0066580 3300045051 Unclassified 3750
209 Ga0451576_0216364 3300045051 Bacteria 2001
210 Ga0495617_001315 3300046452 Bacteria 11051
211 Ga0495627_000015 3300046453 Bacteria 320787
212 Ga0495592_0001218 3300046454 Bacteria 17862
213 Ga0495590_0003744 3300046457 Bacteria 6190
214 Ga0495638_0000817 3300046460 Bacteria 32810
215 Ga0495638_0003897 3300046460 Bacteria 11547
216 Ga0495651_0032516 3300046462 Bacteria 4068
217 Ga0495580_0027561 3300046472 Bacteria 4132
218 Ga0495582_0000844 3300046473 Bacteria 16950
219 Ga0495605_0006865 3300046474 Bacteria 6501
220 Ga0495584_0001216 3300046491 Bacteria 15722
221 Ga0495584_0036155 3300046491 Bacteria 2495
222 Ga0495585_0003869 3300046492 Bacteria 9953
223 Ga0495585_0012160 3300046492 Bacteria 5076
224 Ga0495585_0055145 3300046492 Bacteria 2197
225 Ga0495585_0111897 3300046492 Bacteria 1451
226 Ga0495594_0019622 3300046499 Bacteria 3594
227 Ga0495596_0001788 3300046500 Bacteria 11983
228 Ga0495596_0047579 3300046500 Bacteria 1682
229 Ga0495607_0086431 3300046501 Bacteria 1709
230 Ga0495607_0157320 3300046501 Bacteria 1157
231 Ga0495583_0000285 3300046506 Bacteria 80736
232 Ga0495606_0021388 3300046507 Bacteria 4739
233 Ga0495606_0031174 3300046507 Bacteria 3711
234 Ga0495610_0004446 3300046512 Bacteria 10363
235 Ga0495610_0013765 3300046512 Bacteria 4787
236 Ga0495616_0002592 3300046513 Bacteria 11893
237 Ga0495616_0004950 3300046513 Bacteria 8317
238 Ga0495616_0046539 3300046513 Bacteria 2188
239 Ga0495628_0008341 3300046516 Bacteria 8897
240 Ga0495630_0048097 3300046517 Bacteria 3192
241 Ga0495632_0168055 3300046519 Bacteria 1008
242 Ga0495643_0024960 3300046522 Bacteria 3386
243 Ga0495643_0038346 3300046522 Bacteria 2624
244 Ga0495644_0001279 3300046523 Bacteria 10310
245 Ga0495644_0001566 3300046523 Bacteria 9320
246 Ga0495644_0019061 3300046523 Bacteria 2619
247 Ga0495648_0001777 3300046524 Bacteria 20744
248 Ga0495666_0051648 3300046526 Bacteria 1974
249 Ga0495642_0009893 3300046528 Bacteria 3653
250 Ga0495652_0033326 3300046529 Bacteria 4497
251 Ga0495652_0127736 3300046529 Bacteria 2017
252 Ga0495587_0120014 3300046536 Bacteria 1506
253 Ga0495609_0000596 3300046538 Bacteria 28283
254 Ga0495609_0003314 3300046538 Bacteria 9288
255 Ga0495609_0010790 3300046538 Bacteria 4369
256 Ga0495609_0048045 3300046538 Bacteria 1908
257 Ga0495609_0074679 3300046538 Bacteria 1486
258 Ga0495597_0002533 3300046542 Bacteria 11463
259 Ga0495597_0039367 3300046542 Bacteria 2117
260 Ga0495633_0005686 3300046558 Bacteria 7546
261 Ga0495633_0081753 3300046558 Bacteria 1503
262 Ga0495656_0030787 3300046615 Bacteria 2171
263 Ga0495611_0096282 3300046648 Bacteria 1370
264 Ga0495625_0006166 3300046660 Bacteria 10740
265 Ga0495625_0023919 3300046660 Bacteria 4659
266 Ga0495625_0040496 3300046660 Bacteria 3397
267 Ga0495625_0074582 3300046660 Bacteria 2376
268 Ga0495625_0124420 3300046660 Bacteria 1751
269 Ga0495625_0230241 3300046660 Bacteria 1210
270 Ga0495659_0000036 3300046664 Bacteria 63309
271 Ga0495659_0000844 3300046664 Bacteria 10887
272 Ga0495659_0103389 3300046664 Bacteria 1106
273 Ga0495661_0043433 3300046665 Bacteria 2763
274 Ga0495599_0001349 3300046678 Bacteria 14010
275 Ga0495623_0016748 3300046679 Bacteria 4735
276 Ga0495671_0000150 3300046692 Bacteria 60850
277 Ga0495671_0044159 3300046692 Bacteria 2235
278 Ga0495649_0015747 3300046694 Bacteria 4299
279 Ga0495649_0021620 3300046694 Bacteria 3604
280 Ga0495600_0082039 3300046809 Bacteria 2104
281 Ga0495660_0000401 3300046810 Bacteria 37333
282 Ga0495660_0002379 3300046810 Bacteria 12007
283 Ga0495660_0007677 3300046810 Bacteria 6336
284 Ga0495604_0011524 3300047317 Bacteria 7024
285 Ga0495636_0012934 3300047318 Unclassified 3308
286 Ga0495636_0018789 3300047318 Bacteria 2774
287 Ga0495636_0099531 3300047318 Unclassified 1270
288 Ga0495672_0000136 3300047320 Bacteria 108633
289 Ga0495672_0008243 3300047320 Bacteria 7722
290 Ga0495672_0009143 3300047320 Bacteria 7221
291 Ga0495683_0000969 3300047323 Bacteria 20094
292 Ga0495687_000042 3300047443 Bacteria 218868
293 Ga0495675_0002220 3300047444 Bacteria 11587
294 Ga0495677_0002095 3300047445 Bacteria 7936
295 Ga0495677_0092780 3300047445 Bacteria 1138
296 Ga0495685_000341 3300047447 Bacteria 14973
297 Ga0495673_0029161 3300047469 Bacteria 2607
298 Ga0495686_0001988 3300047472 Bacteria 20289
299 Ga0495626_0002433 3300048091 Bacteria 12924
300 Ga0496102_0000024 3300048905 Bacteria 227873
301 Ga0496102_0033172 3300048905 Bacteria 4639
302 Ga0496103_0009555 3300048906 Bacteria 5741
303 Ga0496103_0141265 3300048906 Bacteria 1540
304 Ga0496104_0063666 3300048907 Bacteria 3498
305 Ga0496105_0005222 3300048908 Bacteria 9842
306 Ga0496106_0101843 3300048909 Bacteria 2227
307 Ga0496107_0036570 3300048910 Bacteria 3522
308 Ga0496108_0009325 3300048911 Bacteria 7946
309 Ga0496109_0035828 3300048912 Bacteria 4479
310 Ga0496110_0290849 3300048913 Bacteria 1488
311 Ga0496114_0041412 3300048917 Bacteria 3817
312 Ga0496114_0046597 3300048917 Bacteria 3603
313 Ga0496116_0035468 3300048919 Bacteria 3503
314 Ga0496125_0013587 3300048928 Bacteria 7996
315 Ga0495682_0006938 3300049460 Bacteria 4544
316 Ga0501031_0129949 3300049568 Bacteria 1645
317 Ga0501033_0007508 3300049570 Bacteria 8484
318 Ga0501033_0040255 3300049570 Bacteria 3489
319 Ga0501036_0003891 3300049572 Bacteria 11982
320 Ga0501038_0003789 3300049574 Bacteria 14071
321 Ga0501038_0006630 3300049574 Bacteria 10708
322 Ga0501038_0026813 3300049574 Bacteria 5130
323 Ga0501038_0142025 3300049574 Unclassified 1963
324 Ga0501039_0048885 3300049575 Bacteria 3269
325 Ga0501040_0004967 3300049576 Bacteria 8605
326 Ga0501042_0001994 3300049578 Bacteria 12323
327 Ga0501043_0016704 3300049579 Bacteria 5751
328 Ga0501043_0050542 3300049579 Bacteria 3267
329 Ga0501046_0002429 3300049580 Bacteria 17465
330 Ga0501046_0036703 3300049580 Bacteria 3942
331 Ga0501047_0021305 3300049581 Bacteria 6222
332 Ga0501048_0010948 3300049582 Bacteria 6766
333 Ga0501072_0109309 3300049588 Bacteria 2200
334 Ga0501238_005837 3300049671 Bacteria 1574
335 Ga0501249_025311 3300049679 Bacteria 1310
336 Ga0501081_0155785 3300049743 Bacteria 1644
337 Ga0501269_000083 3300049766 Bacteria 29209
338 Ga0501279_001538 3300049775 Bacteria 3034
339 Ga0501279_002470 3300049775 Bacteria 2425
340 Ga0501035_0000444 3300049822 Bacteria 46207
341 Ga0501044_0002682 3300049823 Bacteria 20239
342 Ga0501044_0008233 3300049823 Bacteria 11438
343 Ga0501044_0151218 3300049823 Bacteria 2303
344 Ga0501044_0175544 3300049823 Bacteria 2112
345 Ga0501044_0201369 3300049823 Bacteria 1949
346 Ga0501045_0369729 3300049824 Unclassified 1067
347 nmdc:mga0k408_72816_c1 3300050493 Bacteria 2007
348 nmdc:mga09592_2905_c1 3300050508 Bacteria 13894
349 nmdc:mga0qj67_8243_c1 3300050509 Bacteria 7724
350 nmdc:mga0qj67_96859_c1 3300050509 Unclassified 2375
351 nmdc:mga06r32_182241_c1 3300050510 Bacteria 2086
352 nmdc:mga08y16_134519_c1 3300050511 Bacteria 2569
353 Ga0500562_003355 3300053108 Bacteria 4006
354 Ga0500590_002282 3300053148 Bacteria 8423
355 Ga0501082_0084153 3300060353 Bacteria 2744
356 2574429319 2574179768 Bacteria 4907129
357 2643792800 2643221554 Bacteria 6603920
358 2644212415 2643221638 Bacteria 6579467
359 2644254986 2643221645 Bacteria 7207331
360 2644359228 2643221664 Bacteria 7272945
361 2738738343 2738541280 Bacteria 6630198
362 2738842845 2738541300 Bacteria 6675882
363 2739273592 2738543018 Bacteria 6718814
364 2739342636 2738543030 Bacteria 6719714
365 2904424629 2904424332 Bacteria 7633521
366 2989395335 2989392574 Bacteria 4554005
367 639788428 639633007 Bacteria 4376040
368 Ga0501032_0010531
369 JGI25158J39367_1000916
370 JGI25159J45721_1001405
371 rootH1_10057277
372 JGI25161J50226_1000475
373 Ga0055525_1000011
374 Ga0055526_1001131
375 Ga0055537_1000065
376 Ga0055537_1002202
377 Ga0055537_1005843
378 Ga0055524_1000017
379 Ga0055524_1001292
380 Ga0055524_1008702
381 Ga0055534_1000357
382 Ga0055528_1000565
383 Ga0055530_10001057
384 Ga0055530_10001628
385 Ga0055543_1000510
386 Ga0065165_1000045
387 Ga0065165_1033223
388 Ga0065707_10000966
389 Ga0070676_10055569
390 Ga0070683_100061181
391 Ga0070670_100013310
392 Ga0070670_100027999
393 Ga0070670_100105497
394 Ga0070677_10009314
395 Ga0068869_100010140
396 Ga0070666_10023902
397 Ga0070666_10025742
398 Ga0068868_100023008
399 Ga0070689_100005474
400 Ga0070689_100035809
401 Ga0070687_100015516
402 Ga0070687_100146934
403 Ga0070661_100004060
404 Ga0070668_100003031
405 Ga0070668_100026244
406 Ga0070668_100068288
407 Ga0070669_100041521
408 Ga0070675_100052769
409 Ga0070671_100001343
410 Ga0070674_100003397
411 Ga0070674_100025073
412 Ga0070673_100015395
413 Ga0070659_100197032
414 Ga0070667_100022333
415 Ga0070714_100002274
416 Ga0070663_100058683
417 Ga0070685_10028890
418 Ga0070684_100132730
419 Ga0070672_100026370
420 Ga0070686_100023021
421 Ga0070665_100007632
422 Ga0068855_100014444
423 Ga0068855_100042549
424 Ga0070664_100032848
425 Ga0068857_100345968
426 Ga0068854_100234722
427 Ga0068859_100003219
428 Ga0068864_100012060
429 Ga0068870_10009876
430 Ga0068858_100002941
431 Ga0068860_100025938
432 Ga0068862_100013870
433 Ga0075366_10035158
434 Ga0068871_100147409
435 Ga0068871_100170627
436 Ga0075428_100442851
437 Ga0075430_100076671
438 Ga0075431_100252518
439 Ga0075429_100090842
440 Ga0097620_100003219
441 Ga0099826_10000062
442 Ga0105240_10004096
443 Ga0105240_10260330
444 Ga0111539_10063657
445 Ga0105248_10030731
446 Ga0105248_10037560
447 Ga0105237_10014590
448 Ga0099796_10007477
449 Ga0157370_10001007
450 Ga0157370_10004833
451 Ga0157370_10019726
452 Ga0157370_10024313
453 Ga0157370_10045777
454 Ga0157369_10010568
455 Ga0157369_10096245
456 Ga0157374_10005460
457 Ga0157378_10000769
458 Ga0157378_10093598
459 Ga0157372_10026314
460 Ga0157372_10285152
461 Ga0157372_10345769
462 Ga0157375_10035852
463 Ga0163163_10000859
464 Ga0157380_10119576
465 Ga0157377_10010846
466 Ga0157379_10027795
467 Ga0157379_10098033
468 Ga0157376_10004366
469 Ga0157376_10023034
470 Ga0163161_10067747
471 Ga0163161_10263535
472 Ga0213872_10000014
473 Ga0213872_10000029
474 Ga0209436_100078
475 Ga0209563_100005
476 Ga0209565_1000032
477 Ga0209565_1000669
478 Ga0209565_1001928
479 Ga0209565_1002472
480 Ga0209673_1000029
481 Ga0209130_1000043
482 Ga0209130_1000721
483 Ga0209675_1000019
484 Ga0209675_1000519
485 Ga0209564_1000067
486 Ga0209564_1000115
487 Ga0209564_1012651
488 Ga0209050_1000123
489 Ga0209050_1000573
490 Ga0209256_1000018
491 Ga0209256_1000058
492 Ga0209256_1002889
493 Ga0209256_1009436
494 Ga0209257_1002125
495 Ga0207682_10000823
496 Ga0207682_10055985
497 Ga0207680_10003024
498 Ga0207680_10015112
499 Ga0207680_10126584
500 Ga0207645_10004599
501 Ga0207643_10064034
502 Ga0207695_10072748
503 Ga0207657_10270889
504 Ga0207650_10001146
505 Ga0207650_10048274
506 Ga0207650_10225383
507 Ga0207659_10001022
508 Ga0207659_10037476
509 Ga0207644_10003987
510 Ga0207644_10006994
511 Ga0207706_10206626
512 Ga0207706_10283907
513 Ga0207670_10008469
514 Ga0207669_10092436
515 Ga0207691_10009678
516 Ga0207691_10012747
517 Ga0207691_10035538
518 Ga0207711_10047594
519 Ga0207689_10025813
520 Ga0207661_10057217
521 Ga0207679_10027838
522 Ga0207667_10200642
523 Ga0207667_10209424
524 Ga0207651_10023034
525 Ga0207651_10040200
526 Ga0207668_10008726
527 Ga0207668_10040214
528 Ga0207668_10080711
529 Ga0207668_10452771
530 Ga0207640_10017385
531 Ga0207658_10132524
532 Ga0207703_10037061
533 Ga0207648_10012088
534 Ga0207675_100018481
535 Ga0207683_10007974
536 Ga0207683_10015817
537 Ga0207698_10054262
538 Ga0209282_1000122
539 Ga0268265_10029005
540 Ga0268265_10142929
541 Ga0268264_10256705
542 Ga0265327_10031781
543 Ga0265316_10044625
544 Ga0265316_10069270
545 Ga0307513_10045415
546 Ga0307509_10000110
547 Ga0307509_10062510
548 Ga0307408_100001430
549 Ga0307408_100030724
550 Ga0307408_100047166
551 Ga0307405_10134250
552 Ga0307413_10051085
553 Ga0307518_10001265
554 Ga0307406_10012792
555 Ga0307407_10015820
556 Ga0307409_100005064
557 Ga0307416_100464629
558 Ga0307510_10279638
559 Ga0373956_0078744
560 Ga0373937_0083385
561 Ga0395899_0194904
562 Ga0395905_0014617
563 Ga0436361_0156472
564 Ga0436361_0455955
565 Ga0436361_1127912
566 Ga0451807_1658384
567 Ga0451577_0000128
568 Ga0451577_0000882
569 Ga0451577_0085125
570 Ga0453684_0000625
571 Ga0453684_0087886
572 Ga0453684_0281121
573 Ga0466968_0010478
574 Ga0451576_0001736
575 Ga0451576_0066580
576 Ga0451576_0216364
577 Ga0495617_001315
578 Ga0495627_000015
579 Ga0495592_0001218
580 Ga0495590_0003744
581 Ga0495638_0000817
582 Ga0495638_0003897
583 Ga0495651_0032516
584 Ga0495580_0027561
585 Ga0495582_0000844
586 Ga0495605_0006865
587 Ga0495584_0001216
588 Ga0495584_0036155
589 Ga0495585_0003869
590 Ga0495585_0012160
591 Ga0495585_0055145
592 Ga0495585_0111897
593 Ga0495594_0019622
594 Ga0495596_0001788
595 Ga0495596_0047579
596 Ga0495607_0086431
597 Ga0495607_0157320
598 Ga0495583_0000285
599 Ga0495606_0021388
600 Ga0495606_0031174
601 Ga0495610_0004446
602 Ga0495610_0013765
603 Ga0495616_0002592
604 Ga0495616_0004950
605 Ga0495616_0046539
606 Ga0495628_0008341
607 Ga0495630_0048097
608 Ga0495632_0168055
609 Ga0495643_0024960
610 Ga0495643_0038346
611 Ga0495644_0001279
612 Ga0495644_0001566
613 Ga0495644_0019061
614 Ga0495648_0001777
615 Ga0495666_0051648
616 Ga0495642_0009893
617 Ga0495652_0033326
618 Ga0495652_0127736
619 Ga0495587_0120014
620 Ga0495609_0000596
621 Ga0495609_0003314
622 Ga0495609_0010790
623 Ga0495609_0048045
624 Ga0495609_0074679
625 Ga0495597_0002533
626 Ga0495597_0039367
627 Ga0495633_0005686
628 Ga0495633_0081753
629 Ga0495656_0030787
630 Ga0495611_0096282
631 Ga0495625_0006166
632 Ga0495625_0023919
633 Ga0495625_0040496
634 Ga0495625_0074582
635 Ga0495625_0124420
636 Ga0495625_0230241
637 Ga0495659_0000036
638 Ga0495659_0000844
639 Ga0495659_0103389
640 Ga0495661_0043433
641 Ga0495599_0001349
642 Ga0495623_0016748
643 Ga0495671_0000150
644 Ga0495671_0044159
645 Ga0495649_0015747
646 Ga0495649_0021620
647 Ga0495600_0082039
648 Ga0495660_0000401
649 Ga0495660_0002379
650 Ga0495660_0007677
651 Ga0495604_0011524
652 Ga0495636_0012934
653 Ga0495636_0018789
654 Ga0495636_0099531
655 Ga0495672_0000136
656 Ga0495672_0008243
657 Ga0495672_0009143
658 Ga0495683_0000969
659 Ga0495687_000042
660 Ga0495675_0002220
661 Ga0495677_0002095
662 Ga0495677_0092780
663 Ga0495685_000341
664 Ga0495673_0029161
665 Ga0495686_0001988
666 Ga0495626_0002433
667 Ga0496102_0000024
668 Ga0496102_0033172
669 Ga0496103_0009555
670 Ga0496103_0141265
671 Ga0496104_0063666
672 Ga0496105_0005222
673 Ga0496106_0101843
674 Ga0496107_0036570
675 Ga0496108_0009325
676 Ga0496109_0035828
677 Ga0496110_0290849
678 Ga0496114_0041412
679 Ga0496114_0046597
680 Ga0496116_0035468
681 Ga0496125_0013587
682 Ga0495682_0006938
683 Ga0501031_0129949
684 Ga0501033_0007508
685 Ga0501033_0040255
686 Ga0501036_0003891
687 Ga0501038_0003789
688 Ga0501038_0006630
689 Ga0501038_0026813
690 Ga0501038_0142025
691 Ga0501039_0048885
692 Ga0501040_0004967
693 Ga0501042_0001994
694 Ga0501043_0016704
695 Ga0501043_0050542
696 Ga0501046_0002429
697 Ga0501046_0036703
698 Ga0501047_0021305
699 Ga0501048_0010948
700 Ga0501072_0109309
701 Ga0501238_005837
702 Ga0501249_025311
703 Ga0501081_0155785
704 Ga0501269_000083
705 Ga0501279_001538
706 Ga0501279_002470
707 Ga0501035_0000444
708 Ga0501044_0002682
709 Ga0501044_0008233
710 Ga0501044_0151218
711 Ga0501044_0175544
712 Ga0501044_0201369
713 Ga0501045_0369729
714 nmdc:mga0k408_72816_c1
715 nmdc:mga09592_2905_c1
716 nmdc:mga0qj67_8243_c1
717 nmdc:mga0qj67_96859_c1
718 nmdc:mga06r32_182241_c1
719 nmdc:mga08y16_134519_c1
720 Ga0500562_003355
721 Ga0500590_002282
722 Ga0501082_0084153
723 2574429319
724 2643792800
725 2644212415
726 2644254986
727 2644359228
728 2738738343
729 2738842845
730 2739273592
731 2739342636
732 2904424629
733 2989395335
734 639788428

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01522

Polysacc_deac_1

Polysaccharide deacetylase

128

186

0.89

PF01522

Polysacc_deac_1

Polysaccharide deacetylase

192

333

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3s6o-assembly1.cif.gz_D crystal structure of a polysaccharide deacetylase family protein from burkholderia pseudomallei 0.8772 198 279
6dq3-assembly2.cif.gz_B streptococcus pyogenes deacetylase ppld in complex with acetate 0.8674 24 318
7y51-assembly1.cif.gz_A-2 acetylxylan esterase from caldanaerobacter subterraneus subsp. tengcongensis tte0866 delta100 mutant 0.8582 82 275
7bly-assembly1.cif.gz_A structure of the chitin deacetylase angcda from aspergillus niger 0.8464 82 281
6dq3-assembly2.cif.gz_B streptococcus pyogenes deacetylase ppld in complex with acetate 0.8458 24 318
ID Description Score Start End Superfamily
2c1iA03 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8399 82 279 3.20.20.370
2c79A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8378 82 280 3.20.20.370
af_Q9VPI3_1693_1928_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8206 198 287 3.20.20.370
af_Q06702_109_291_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8111 84 278 3.20.20.370
4v33B02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8109 24 312 3.20.20.370
ID Description Score Start End GO Terms
AF-A0A2W4M3V9-F1-model_v4 Carbohydrate esterase family protein 0.97 40 315 GO:0005975
GO:0016810
AF-A0A1Y6CWX2-F1-model_v4 Polysaccharide deacetylase 0.9698 3 318 GO:0005975
GO:0016810
AF-Q47DD2-F1-model_v4 Glycosyl transferase, family 2:Polysaccharide deacetylase 0.9664 7 316 GO:0005975
GO:0016740
GO:0016810
AF-A0A6P1DZS2-F1-model_v4 Polysaccharide deacetylase family protein 0.9658 7 316 GO:0005975
GO:0016810
AF-A0A2M8BMG9-F1-model_v4 Carbohydrate esterase family protein 0.9658 8 272 GO:0005975
GO:0016810

Map