F424501

General Info

Members Datasets Scaffolds Average Seq Length
367 274 734 146

Family's Representative Sequence

Representative Sequence 3300049578|Ga0501042_0765967|Ga0501042_0765967_213_650
Length 128
Sequence MSKIVIRGRKVVGGVAEGEAIVTRDTISGWGGIDSSTGTIIERRHELVGRSFKDKVLVFPGAKAPKAMLFNRMTTKAALGAVVTRVPAMSDFDKDPLSLIETGDWVKVDADRGFVEVTKRTAAKTAAE

Samples

Sample ID Description Type Environment
1 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
2 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
48 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
49 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
62 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
63 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
64 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
65 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
66 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
67 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
108 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
109 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
110 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
111 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
113 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
114 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
115 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
116 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
117 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
118 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
121 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
122 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
123 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
124 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
125 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
128 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
133 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
134 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
135 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
137 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
138 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
139 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
140 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
145 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
146 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
147 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
148 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
149 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
155 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
156 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
157 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
158 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
159 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
160 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
161 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
162 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
163 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
164 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
165 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
166 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
167 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
168 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
169 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
170 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
171 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
172 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
173 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
174 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
175 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
176 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
177 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
178 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
179 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
180 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
181 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
182 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
183 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
184 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
185 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
193 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
194 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
195 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
196 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
197 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
198 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
199 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
202 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
203 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
204 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
205 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
206 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
207 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
208 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
209 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
210 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
211 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
212 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
213 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
214 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
215 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
216 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
217 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
218 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
219 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
220 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
221 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
222 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
223 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
224 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
225 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
226 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
227 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
228 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
229 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
230 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
231 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
232 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
233 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
234 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
235 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
236 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
237 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
238 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
239 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
240 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
241 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
242 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
243 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
244 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
245 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
246 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
247 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
248 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
249 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
250 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
251 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
252 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
253 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
254 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
255 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
256 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
257 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
258 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
259 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
260 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
261 2738543012 Acidovorax sp. CF301 Isolate Unclassified
262 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
263 2842677519 Variovorax sp. R-72495 Isolate Unclassified
264 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
265 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
266 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
267 2904456579 Variovorax sp. 2002 Isolate Unclassified
268 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
269 2929520902 Variovorax beijingensis 502 Isolate Unclassified
270 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
271 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
272 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
273 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
274 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.1
Metatranscriptomes 0.82
Isolates 4.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.8
Nodule 0.82
Rhizoplane 2.72
Rhizosphere 64.03
Stem 0
Stem Tuber 0
Unclassified 3.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501042_0765967 3300049578 Bacteria 702
2 JGI25150J39212_1026539 3300002774 Bacteria 836
3 JGI25406J46586_10008608 3300003203 Bacteria 4610
4 Ga0006562J51391_1047699 3300003578 Bacteria 1344
5 Ga0006562J51391_1139346 3300003578 Bacteria 830
6 Ga0055536_1014732 3300003781 Bacteria 2720
7 Ga0055536_1023670 3300003781 Bacteria 1800
8 Ga0055536_1034167 3300003781 Bacteria 1288
9 Ga0055534_1015437 3300003784 Bacteria 1399
10 Ga0055530_10018305 3300003791 Bacteria 2165
11 Ga0055530_10021511 3300003791 Bacteria 1899
12 Ga0055540_1011050 3300003792 Bacteria 2948
13 Ga0055540_1019835 3300003792 Bacteria 1800
14 Ga0055531_10027189 3300003794 Bacteria 2015
15 Ga0055531_10028921 3300003794 Bacteria 1899
16 Ga0065714_10018308 3300005288 Bacteria 2677
17 Ga0065714_10257930 3300005288 Bacteria 762
18 Ga0065704_10250226 3300005289 Bacteria 991
19 Ga0070661_100146176 3300005344 Bacteria 1785
20 Ga0070669_100031772 3300005353 Bacteria 3813
21 Ga0070671_100240927 3300005355 Bacteria 1535
22 Ga0070673_100639688 3300005364 Bacteria 973
23 Ga0070667_100627942 3300005367 Unclassified 991
24 Ga0070667_100745585 3300005367 Bacteria 908
25 Ga0070714_101181191 3300005435 Bacteria 746
26 Ga0070713_100217046 3300005436 Bacteria 1734
27 Ga0070713_100500871 3300005436 Unclassified 1146
28 Ga0070713_100750218 3300005436 Bacteria 934
29 Ga0070711_100144207 3300005439 Bacteria 1789
30 Ga0070700_101329309 3300005441 Bacteria 605
31 Ga0070678_100247230 3300005456 Bacteria 1494
32 Ga0070662_101040388 3300005457 Bacteria 702
33 Ga0070681_10073952 3300005458 Bacteria 3370
34 Ga0068867_100077446 3300005459 Unclassified 2499
35 Ga0068867_101078933 3300005459 Bacteria 732
36 Ga0068853_101449844 3300005539 Bacteria 664
37 Ga0070693_100377657 3300005547 Bacteria 977
38 Ga0068855_100283533 3300005563 Bacteria 1839
39 Ga0068857_100582382 3300005577 Bacteria 1056
40 Ga0068864_100821846 3300005618 Bacteria 914
41 Ga0068866_10666860 3300005718 Bacteria 710
42 Ga0068861_100836971 3300005719 Bacteria 866
43 Ga0068860_100155085 3300005843 Bacteria 2206
44 Ga0068860_100683750 3300005843 Bacteria 1035
45 Ga0068860_101098557 3300005843 Bacteria 815
46 Ga0068860_101193047 3300005843 Bacteria 781
47 Ga0068862_100100286 3300005844 Bacteria 2532
48 Ga0081455_10059471 3300005937 Bacteria 3227
49 Ga0081539_10000060 3300005985 Bacteria 252799
50 Ga0075365_10014428 3300006038 Bacteria 4753
51 Ga0075363_100006229 3300006048 Bacteria 5398
52 Ga0075364_10008295 3300006051 Bacteria 6204
53 Ga0075432_10038622 3300006058 Bacteria 1663
54 Ga0070712_100257866 3300006175 Bacteria 1396
55 Ga0075362_10037847 3300006177 Bacteria 2117
56 Ga0075366_10004335 3300006195 Bacteria 7607
57 Ga0075366_10306447 3300006195 Bacteria 972
58 Ga0097621_100352303 3300006237 Bacteria 1309
59 Ga0097621_100392925 3300006237 Bacteria 1241
60 Ga0097621_101078349 3300006237 Bacteria 753
61 Ga0075370_10075361 3300006353 Bacteria 1934
62 Ga0068871_100023501 3300006358 Bacteria 4770
63 Ga0068865_100086516 3300006881 Unclassified 2263
64 Ga0099826_10103373 3300006948 Bacteria 1713
65 Ga0099826_10454525 3300006948 Bacteria 609
66 Ga0099794_10022642 3300007265 Bacteria 2866
67 Ga0105244_10015092 3300009036 Bacteria 4440
68 Ga0105245_10008306 3300009098 Bacteria 9072
69 Ga0105243_10083741 3300009148 Bacteria 2610
70 Ga0105243_10778368 3300009148 Bacteria 941
71 Ga0105241_10294309 3300009174 Bacteria 1391
72 Ga0105242_10124364 3300009176 Bacteria 2218
73 Ga0105242_12047321 3300009176 Bacteria 615
74 Ga0105248_10309421 3300009177 Bacteria 1779
75 Ga0105238_10328377 3300009551 Bacteria 1516
76 Ga0105239_10810554 3300010375 Bacteria 1073
77 Ga0105246_10662451 3300011119 Bacteria 910
78 Ga0105246_10708535 3300011119 Bacteria 883
79 Ga0157378_10081766 3300013297 Bacteria 2920
80 Ga0182008_10007741 3300014497 Bacteria 5914
81 Ga0182008_10014712 3300014497 Bacteria 4092
82 Ga0182008_10032500 3300014497 Bacteria 2621
83 Ga0182008_10155176 3300014497 Bacteria 1149
84 Ga0157376_10355826 3300014969 Bacteria 1403
85 Ga0182006_1004380 3300015261 Bacteria 6979
86 Ga0182006_1104159 3300015261 Bacteria 1003
87 Ga0182007_10000510 3300015262 Bacteria 22940
88 Ga0182007_10007384 3300015262 Bacteria 4612
89 Ga0182007_10150136 3300015262 Bacteria 792
90 Ga0182005_1028904 3300015265 Bacteria 1512
91 Ga0213874_10137551 3300021377 Bacteria 844
92 Ga0207425_1006015 3300025245 Bacteria 3376
93 Ga0209129_1007557 3300025258 Bacteria 3207
94 Ga0209565_1000110 3300025263 Bacteria 119879
95 Ga0209565_1002636 3300025263 Bacteria 6319
96 Ga0209130_1022547 3300025284 Bacteria 1403
97 Ga0209676_1000005 3300025292 Bacteria 1076001
98 Ga0209676_1013718 3300025292 Bacteria 3097
99 Ga0209025_1024611 3300025294 Bacteria 3099
100 Ga0209758_1018430 3300025297 Bacteria 3420
101 Ga0209050_1000007 3300025298 Bacteria 1187891
102 Ga0209050_1025065 3300025298 Bacteria 2040
103 Ga0209051_1000009 3300025303 Bacteria 706778
104 Ga0209051_1000073 3300025303 Bacteria 208874
105 Ga0209257_1000011 3300025304 Bacteria 1112630
106 Ga0209257_1082771 3300025304 Bacteria 819
107 Ga0207655_1034185 3300025728 Bacteria 2289
108 Ga0207682_10381773 3300025893 Bacteria 665
109 Ga0207692_10157879 3300025898 Bacteria 1305
110 Ga0207642_10744773 3300025899 Bacteria 620
111 Ga0207707_10239946 3300025912 Bacteria 1576
112 Ga0207707_11051750 3300025912 Bacteria 666
113 Ga0207663_10137283 3300025916 Bacteria 1699
114 Ga0207649_10189404 3300025920 Bacteria 1446
115 Ga0207681_10006240 3300025923 Bacteria 7311
116 Ga0207694_10157698 3300025924 Bacteria 1832
117 Ga0207687_10142292 3300025927 Bacteria 1821
118 Ga0207700_10147777 3300025928 Unclassified 1939
119 Ga0207700_11415103 3300025928 Bacteria 618
120 Ga0207664_10713681 3300025929 Bacteria 902
121 Ga0207706_10553934 3300025933 Bacteria 990
122 Ga0207686_10179630 3300025934 Unclassified 1500
123 Ga0207686_10232867 3300025934 Bacteria 1336
124 Ga0207709_10003250 3300025935 Bacteria 9745
125 Ga0207709_10049742 3300025935 Bacteria 2560
126 Ga0207670_10119813 3300025936 Unclassified 1911
127 Ga0207704_10062520 3300025938 Unclassified 2315
128 Ga0207665_10259484 3300025939 Bacteria 1287
129 Ga0207711_10043441 3300025941 Bacteria 3834
130 Ga0207651_10522233 3300025960 Bacteria 1029
131 Ga0207658_10212269 3300025986 Bacteria 1623
132 Ga0207677_10908095 3300026023 Unclassified 794
133 Ga0207708_11197361 3300026075 Bacteria 664
134 Ga0207702_10643110 3300026078 Bacteria 1043
135 Ga0207648_10125269 3300026089 Unclassified 2260
136 Ga0207648_10206578 3300026089 Bacteria 1743
137 Ga0207675_100379808 3300026118 Bacteria 1389
138 Ga0207683_10267901 3300026121 Bacteria 1560
139 Ga0207683_11262309 3300026121 Bacteria 684
140 Ga0207683_11442669 3300026121 Unclassified 636
141 Ga0209588_1009423 3300027671 Bacteria 2920
142 Ga0268266_10504926 3300028379 Bacteria 1155
143 Ga0268265_10065397 3300028380 Bacteria 2806
144 Ga0307515_10083521 3300028794 Bacteria 4116
145 Ga0265338_10043516 3300028800 Bacteria 4163
146 Ga0265338_10060195 3300028800 Bacteria 3339
147 Ga0314311_1204397 3300030733 Bacteria 7417
148 Ga0316178_1168557 3300030735 Bacteria 933
149 Ga0316180_1181635 3300030736 Bacteria 1403
150 Ga0316182_1019910 3300030745 Bacteria 1527
151 Ga0316182_1282414 3300030745 Bacteria 1321
152 Ga0265762_1013322 3300030760 Bacteria 1479
153 Ga0265330_10004015 3300031235 Bacteria 7553
154 Ga0265332_10055742 3300031238 Bacteria 1694
155 Ga0265328_10079901 3300031239 Bacteria 1205
156 Ga0265340_10004850 3300031247 Bacteria 7481
157 Ga0265339_10090824 3300031249 Bacteria 1601
158 Ga0265339_10144060 3300031249 Bacteria 1210
159 Ga0265339_10171963 3300031249 Bacteria 1084
160 Ga0265327_10005249 3300031251 Bacteria 10918
161 Ga0265316_10126686 3300031344 Bacteria 1925
162 Ga0307408_100000117 3300031548 Bacteria 87442
163 Ga0307408_100045984 3300031548 Bacteria 3120
164 Ga0307408_100505218 3300031548 Bacteria 1059
165 Ga0307408_100734060 3300031548 Bacteria 890
166 Ga0307408_102177655 3300031548 Bacteria 535
167 Ga0265313_10308850 3300031595 Unclassified 634
168 Ga0307508_10000632 3300031616 Bacteria 42326
169 Ga0307514_10003619 3300031649 Bacteria 14675
170 Ga0307514_10025438 3300031649 Bacteria 4788
171 Ga0307514_10317529 3300031649 Bacteria 858
172 Ga0265314_10035180 3300031711 Bacteria 3653
173 Ga0265314_10315400 3300031711 Bacteria 872
174 Ga0265342_10076851 3300031712 Bacteria 1935
175 Ga0265342_10217314 3300031712 Bacteria 1031
176 Ga0316576_10304619 3300031727 Bacteria 1190
177 Ga0307405_10046543 3300031731 Bacteria 2666
178 Ga0307405_10429181 3300031731 Bacteria 1042
179 Ga0307405_11801395 3300031731 Bacteria 544
180 Ga0316577_10107204 3300031733 Bacteria 1567
181 Ga0307406_10002353 3300031901 Bacteria 10276
182 Ga0307406_10013646 3300031901 Bacteria 4657
183 Ga0307412_10011615 3300031911 Bacteria 5106
184 Ga0307414_10478875 3300032004 Bacteria 1097
185 Ga0307414_10861282 3300032004 Bacteria 829
186 Ga0307411_10127184 3300032005 Bacteria 1855
187 Ga0307411_10880936 3300032005 Bacteria 794
188 Ga0307507_10010342 3300033179 Bacteria 12082
189 Ga0307510_10400406 3300033180 Bacteria 816
190 Ga0373944_0236041 3300035089 Bacteria 671
191 Ga0373936_0018530 3300035113 Bacteria 2690
192 Ga0373945_0422805 3300035116 Bacteria 586
193 Ga0373946_0146147 3300035171 Bacteria 1100
194 Ga0373946_0483198 3300035171 Bacteria 634
195 Ga0373927_0198835 3300035695 Bacteria 1316
196 Ga0373933_0159479 3300035724 Bacteria 1432
197 Ga0373947_0126673 3300035725 Bacteria 1627
198 Ga0373937_0186054 3300036401 Bacteria 1951
199 Ga0373937_0249014 3300036401 Bacteria 1675
200 Ga0373937_0650937 3300036401 Unclassified 999
201 Ga0373937_1318702 3300036401 Bacteria 670
202 Ga0316582_0359152 3300036647 Bacteria 1002
203 Ga0373925_0004682 3300037068 Bacteria 10324
204 Ga0373925_0224702 3300037068 Bacteria 1500
205 Ga0373925_0226033 3300037068 Bacteria 1495
206 Ga0436363_0306332 3300039450 Bacteria 582
207 Ga0436363_1382048 3300039450 Bacteria 818
208 Ga0451807_2318664 3300041486 Bacteria 916
209 Ga0439462_0031357 3300042015 Bacteria 1407
210 Ga0450898_114189 3300042134 Bacteria 573
211 Ga0451577_0220891 3300042876 Bacteria 1713
212 Ga0466960_0012203 3300044901 Bacteria 3619
213 Ga0466959_0292005 3300045049 Bacteria 1117
214 Ga0451576_0032181 3300045051 Bacteria 5588
215 Ga0495592_0063487 3300046454 Bacteria 2709
216 Ga0495592_0091556 3300046454 Bacteria 2181
217 Ga0495629_0249542 3300046459 Bacteria 1221
218 Ga0495638_0077373 3300046460 Bacteria 2026
219 Ga0495638_0136638 3300046460 Bacteria 1435
220 Ga0495638_0241147 3300046460 Bacteria 1001
221 Ga0495651_0014143 3300046462 Bacteria 6169
222 Ga0495651_0290415 3300046462 Bacteria 1101
223 Ga0495610_0018080 3300046512 Bacteria 3993
224 Ga0495616_0000830 3300046513 Bacteria 22548
225 Ga0495628_0085089 3300046516 Bacteria 2453
226 Ga0495630_0245465 3300046517 Bacteria 1368
227 Ga0495631_0000596 3300046518 Bacteria 23935
228 Ga0495632_0065104 3300046519 Bacteria 1761
229 Ga0495632_0283137 3300046519 Bacteria 738
230 Ga0495663_0062244 3300046525 Bacteria 1175
231 Ga0495652_0066427 3300046529 Bacteria 3027
232 Ga0495654_0101598 3300046530 Bacteria 1323
233 Ga0495587_0391413 3300046536 Bacteria 773
234 Ga0495598_0067237 3300046537 Bacteria 1120
235 Ga0495598_0447248 3300046537 Bacteria 511
236 Ga0495667_0023131 3300046559 Bacteria 4188
237 Ga0495668_0115361 3300046616 Bacteria 1469
238 Ga0495668_0330240 3300046616 Bacteria 836
239 Ga0495611_0436968 3300046648 Bacteria 597
240 Ga0495625_0053337 3300046660 Bacteria 2892
241 Ga0495635_0063267 3300046663 Bacteria 2541
242 Ga0495659_0133437 3300046664 Bacteria 986
243 Ga0495588_0033852 3300046674 Bacteria 2583
244 Ga0495588_0333635 3300046674 Bacteria 797
245 Ga0495599_0277183 3300046678 Bacteria 1016
246 Ga0495647_0184117 3300046681 Bacteria 910
247 Ga0495658_0365245 3300046683 Bacteria 918
248 Ga0495671_0431929 3300046692 Bacteria 630
249 Ga0495604_0052065 3300047317 Bacteria 3172
250 Ga0495674_0089951 3300047319 Bacteria 2624
251 Ga0495676_0026708 3300047321 Bacteria 4965
252 Ga0495676_0378770 3300047321 Bacteria 942
253 Ga0495676_0554020 3300047321 Bacteria 751
254 Ga0495680_0180053 3300047322 Bacteria 1526
255 Ga0495684_0088244 3300047471 Bacteria 2350
256 Ga0495593_0004798 3300047673 Bacteria 8021
257 Ga0495602_0130641 3300048088 Bacteria 2004
258 Ga0495602_0171940 3300048088 Bacteria 1681
259 Ga0496100_0071447 3300048903 Bacteria 2317
260 Ga0496102_0001139 3300048905 Bacteria 24366
261 Ga0496102_0585392 3300048905 Bacteria 1039
262 Ga0496104_0001280 3300048907 Bacteria 21673
263 Ga0496105_0021361 3300048908 Bacteria 5238
264 Ga0496105_0455811 3300048908 Bacteria 1009
265 Ga0496107_0028833 3300048910 Bacteria 3947
266 Ga0496114_0003605 3300048917 Bacteria 11898
267 Ga0496115_0020738 3300048918 Bacteria 5070
268 Ga0496117_0105942 3300048920 Bacteria 1766
269 Ga0496118_0137799 3300048921 Bacteria 1554
270 Ga0496118_0383504 3300048921 Bacteria 736
271 Ga0496118_0395841 3300048921 Bacteria 719
272 Ga0496120_0264182 3300048923 Bacteria 802
273 Ga0496122_0114441 3300048925 Bacteria 1760
274 Ga0496123_0251116 3300048926 Bacteria 872
275 Ga0496125_0376030 3300048928 Bacteria 839
276 Ga0496125_0429261 3300048928 Bacteria 763
277 Ga0496126_0774921 3300048929 Bacteria 738
278 Ga0501040_0244424 3300049576 Bacteria 1280
279 Ga0501041_0537916 3300049577 Bacteria 744
280 Ga0501068_0220003 3300049584 Bacteria 1207
281 Ga0501071_0189128 3300049587 Bacteria 1544
282 Ga0501072_1208411 3300049588 Bacteria 587
283 Ga0501075_0172725 3300049591 Bacteria 1649
284 Ga0501076_0054215 3300049592 Bacteria 3177
285 Ga0501081_0001008 3300049743 Bacteria 16795
286 Ga0501241_013963 3300049758 Bacteria 1459
287 Ga0501241_025948 3300049758 Bacteria 1092
288 Ga0501262_001252 3300049759 Bacteria 2856
289 Ga0501279_002899 3300049775 Bacteria 2233
290 nmdc:mga03683_1683_c2 3300050489 Bacteria 3157
291 nmdc:mga03n38_5603_c1 3300050490 Bacteria 4291
292 nmdc:mga00v17_1025473_c1 3300050491 Bacteria 519
293 nmdc:mga00v17_2606_c1 3300050491 Bacteria 9245
294 nmdc:mga0yw44_45129_c1 3300050492 Bacteria 2641
295 nmdc:mga06z11_57352_c1 3300050494 Bacteria 2017
296 nmdc:mga07m45_302078_c1 3300050496 Bacteria 931
297 Ga0495595_0007789 3300053084 Bacteria 4387
298 Ga0495619_0548051 3300053085 Bacteria 793
299 Ga0500643_011351 3300053087 Bacteria 3254
300 Ga0500643_043031 3300053087 Bacteria 1318
301 Ga0500644_0232726 3300053088 Bacteria 772
302 Ga0500647_0092428 3300053091 Bacteria 1447
303 Ga0500583_0000281 3300053092 Bacteria 17754
304 Ga0500651_0000038 3300053093 Bacteria 101707
305 Ga0500566_0000002 3300053094 Bacteria 221889
306 Ga0500640_002385 3300053095 Bacteria 6196
307 Ga0500641_0080126 3300053096 Bacteria 1385
308 Ga0500650_0153785 3300053098 Bacteria 1063
309 Ga0500650_0159851 3300053098 Bacteria 1039
310 Ga0500556_0000807 3300053104 Bacteria 18249
311 Ga0500560_062045 3300053107 Bacteria 1220
312 Ga0500562_035402 3300053108 Bacteria 1322
313 Ga0500571_000091 3300053110 Bacteria 29044
314 Ga0500572_000086 3300053111 Bacteria 29559
315 Ga0500572_227753 3300053111 Bacteria 609
316 Ga0500591_006721 3300053115 Bacteria 5256
317 Ga0500594_0002185 3300053118 Bacteria 4239
318 Ga0500597_042110 3300053120 Bacteria 1924
319 Ga0500608_000680 3300053122 Bacteria 12452
320 Ga0500608_055885 3300053122 Bacteria 1892
321 Ga0500608_116722 3300053122 Bacteria 1216
322 Ga0500614_002154 3300053123 Bacteria 4486
323 Ga0500642_0000001 3300053130 Bacteria 1468402
324 Ga0500642_0019447 3300053130 Bacteria 2649
325 Ga0500642_0189561 3300053130 Bacteria 960
326 Ga0500655_000463 3300053133 Bacteria 8303
327 Ga0500658_0000321 3300053134 Bacteria 21148
328 Ga0500658_0003455 3300053134 Bacteria 5965
329 Ga0500559_0000096 3300053136 Bacteria 70572
330 Ga0500559_0015965 3300053136 Bacteria 3170
331 Ga0500561_0036863 3300053137 Bacteria 1270
332 Ga0500564_013125 3300053138 Bacteria 3701
333 Ga0500574_002585 3300053141 Bacteria 3013
334 Ga0500590_026109 3300053148 Bacteria 3031
335 Ga0500603_000087 3300053150 Bacteria 21809
336 Ga0500616_0000016 3300053153 Bacteria 627087
337 Ga0500616_0027015 3300053153 Bacteria 3172
338 Ga0500624_067897 3300053157 Bacteria 692
339 Ga0500630_001748 3300053159 Bacteria 10397
340 Ga0500634_0045095 3300053161 Bacteria 2386
341 Ga0500638_012602 3300053162 Bacteria 3794
342 Ga0500638_217492 3300053162 Bacteria 795
343 Ga0500639_000002 3300053163 Bacteria 233548
344 Ga0500636_0129380 3300053177 Bacteria 1408
345 Ga0500576_144164 3300053725 Bacteria 900
346 Ga0500645_000500 3300053730 Bacteria 26445
347 Ga0500565_006038 3300053734 Bacteria 1095
348 Ga0500596_000071 3300053735 Bacteria 13715
349 Ga0500601_000618 3300053737 Bacteria 5035
350 Ga0501084_0018846 3300054114 Bacteria 5746
351 Ga0501082_0011411 3300060353 Bacteria 7645
352 Ga0501082_1854644 3300060353 Bacteria 526
353 2513229794 2513020051 Bacteria 6053213
354 2739244266 2738543012 Bacteria 7115078
355 2838056737 2838054893 Bacteria 7451788
356 2842680074 2842677519 Bacteria 5615038
357 2889790995 2889790730 Bacteria 5689708
358 2889915385 2889914905 Bacteria 5702301
359 2904454614 2904449895 Bacteria 6927402
360 2904460463 2904456579 Bacteria 6819253
361 2928085169 2928084124 Bacteria 7159212
362 2929524667 2929520902 Bacteria 6765052
363 2945912775 2945909444 Bacteria 7065066
364 2945947079 2945945610 Bacteria 5951079
365 2945976775 2945972063 Bacteria 6086495
366 2945984957 2945984333 Bacteria 7358892
367 8006987705 8006984368 Bacteria 9651211
368 Ga0501042_0765967
369 JGI25150J39212_1026539
370 JGI25406J46586_10008608
371 Ga0006562J51391_1047699
372 Ga0006562J51391_1139346
373 Ga0055536_1014732
374 Ga0055536_1023670
375 Ga0055536_1034167
376 Ga0055534_1015437
377 Ga0055530_10018305
378 Ga0055530_10021511
379 Ga0055540_1011050
380 Ga0055540_1019835
381 Ga0055531_10027189
382 Ga0055531_10028921
383 Ga0065714_10018308
384 Ga0065714_10257930
385 Ga0065704_10250226
386 Ga0070661_100146176
387 Ga0070669_100031772
388 Ga0070671_100240927
389 Ga0070673_100639688
390 Ga0070667_100627942
391 Ga0070667_100745585
392 Ga0070714_101181191
393 Ga0070713_100217046
394 Ga0070713_100500871
395 Ga0070713_100750218
396 Ga0070711_100144207
397 Ga0070700_101329309
398 Ga0070678_100247230
399 Ga0070662_101040388
400 Ga0070681_10073952
401 Ga0068867_100077446
402 Ga0068867_101078933
403 Ga0068853_101449844
404 Ga0070693_100377657
405 Ga0068855_100283533
406 Ga0068857_100582382
407 Ga0068864_100821846
408 Ga0068866_10666860
409 Ga0068861_100836971
410 Ga0068860_100155085
411 Ga0068860_100683750
412 Ga0068860_101098557
413 Ga0068860_101193047
414 Ga0068862_100100286
415 Ga0081455_10059471
416 Ga0081539_10000060
417 Ga0075365_10014428
418 Ga0075363_100006229
419 Ga0075364_10008295
420 Ga0075432_10038622
421 Ga0070712_100257866
422 Ga0075362_10037847
423 Ga0075366_10004335
424 Ga0075366_10306447
425 Ga0097621_100352303
426 Ga0097621_100392925
427 Ga0097621_101078349
428 Ga0075370_10075361
429 Ga0068871_100023501
430 Ga0068865_100086516
431 Ga0099826_10103373
432 Ga0099826_10454525
433 Ga0099794_10022642
434 Ga0105244_10015092
435 Ga0105245_10008306
436 Ga0105243_10083741
437 Ga0105243_10778368
438 Ga0105241_10294309
439 Ga0105242_10124364
440 Ga0105242_12047321
441 Ga0105248_10309421
442 Ga0105238_10328377
443 Ga0105239_10810554
444 Ga0105246_10662451
445 Ga0105246_10708535
446 Ga0157378_10081766
447 Ga0182008_10007741
448 Ga0182008_10014712
449 Ga0182008_10032500
450 Ga0182008_10155176
451 Ga0157376_10355826
452 Ga0182006_1004380
453 Ga0182006_1104159
454 Ga0182007_10000510
455 Ga0182007_10007384
456 Ga0182007_10150136
457 Ga0182005_1028904
458 Ga0213874_10137551
459 Ga0207425_1006015
460 Ga0209129_1007557
461 Ga0209565_1000110
462 Ga0209565_1002636
463 Ga0209130_1022547
464 Ga0209676_1000005
465 Ga0209676_1013718
466 Ga0209025_1024611
467 Ga0209758_1018430
468 Ga0209050_1000007
469 Ga0209050_1025065
470 Ga0209051_1000009
471 Ga0209051_1000073
472 Ga0209257_1000011
473 Ga0209257_1082771
474 Ga0207655_1034185
475 Ga0207682_10381773
476 Ga0207692_10157879
477 Ga0207642_10744773
478 Ga0207707_10239946
479 Ga0207707_11051750
480 Ga0207663_10137283
481 Ga0207649_10189404
482 Ga0207681_10006240
483 Ga0207694_10157698
484 Ga0207687_10142292
485 Ga0207700_10147777
486 Ga0207700_11415103
487 Ga0207664_10713681
488 Ga0207706_10553934
489 Ga0207686_10179630
490 Ga0207686_10232867
491 Ga0207709_10003250
492 Ga0207709_10049742
493 Ga0207670_10119813
494 Ga0207704_10062520
495 Ga0207665_10259484
496 Ga0207711_10043441
497 Ga0207651_10522233
498 Ga0207658_10212269
499 Ga0207677_10908095
500 Ga0207708_11197361
501 Ga0207702_10643110
502 Ga0207648_10125269
503 Ga0207648_10206578
504 Ga0207675_100379808
505 Ga0207683_10267901
506 Ga0207683_11262309
507 Ga0207683_11442669
508 Ga0209588_1009423
509 Ga0268266_10504926
510 Ga0268265_10065397
511 Ga0307515_10083521
512 Ga0265338_10043516
513 Ga0265338_10060195
514 Ga0314311_1204397
515 Ga0316178_1168557
516 Ga0316180_1181635
517 Ga0316182_1019910
518 Ga0316182_1282414
519 Ga0265762_1013322
520 Ga0265330_10004015
521 Ga0265332_10055742
522 Ga0265328_10079901
523 Ga0265340_10004850
524 Ga0265339_10090824
525 Ga0265339_10144060
526 Ga0265339_10171963
527 Ga0265327_10005249
528 Ga0265316_10126686
529 Ga0307408_100000117
530 Ga0307408_100045984
531 Ga0307408_100505218
532 Ga0307408_100734060
533 Ga0307408_102177655
534 Ga0265313_10308850
535 Ga0307508_10000632
536 Ga0307514_10003619
537 Ga0307514_10025438
538 Ga0307514_10317529
539 Ga0265314_10035180
540 Ga0265314_10315400
541 Ga0265342_10076851
542 Ga0265342_10217314
543 Ga0316576_10304619
544 Ga0307405_10046543
545 Ga0307405_10429181
546 Ga0307405_11801395
547 Ga0316577_10107204
548 Ga0307406_10002353
549 Ga0307406_10013646
550 Ga0307412_10011615
551 Ga0307414_10478875
552 Ga0307414_10861282
553 Ga0307411_10127184
554 Ga0307411_10880936
555 Ga0307507_10010342
556 Ga0307510_10400406
557 Ga0373944_0236041
558 Ga0373936_0018530
559 Ga0373945_0422805
560 Ga0373946_0146147
561 Ga0373946_0483198
562 Ga0373927_0198835
563 Ga0373933_0159479
564 Ga0373947_0126673
565 Ga0373937_0186054
566 Ga0373937_0249014
567 Ga0373937_0650937
568 Ga0373937_1318702
569 Ga0316582_0359152
570 Ga0373925_0004682
571 Ga0373925_0224702
572 Ga0373925_0226033
573 Ga0436363_0306332
574 Ga0436363_1382048
575 Ga0451807_2318664
576 Ga0439462_0031357
577 Ga0450898_114189
578 Ga0451577_0220891
579 Ga0466960_0012203
580 Ga0466959_0292005
581 Ga0451576_0032181
582 Ga0495592_0063487
583 Ga0495592_0091556
584 Ga0495629_0249542
585 Ga0495638_0077373
586 Ga0495638_0136638
587 Ga0495638_0241147
588 Ga0495651_0014143
589 Ga0495651_0290415
590 Ga0495610_0018080
591 Ga0495616_0000830
592 Ga0495628_0085089
593 Ga0495630_0245465
594 Ga0495631_0000596
595 Ga0495632_0065104
596 Ga0495632_0283137
597 Ga0495663_0062244
598 Ga0495652_0066427
599 Ga0495654_0101598
600 Ga0495587_0391413
601 Ga0495598_0067237
602 Ga0495598_0447248
603 Ga0495667_0023131
604 Ga0495668_0115361
605 Ga0495668_0330240
606 Ga0495611_0436968
607 Ga0495625_0053337
608 Ga0495635_0063267
609 Ga0495659_0133437
610 Ga0495588_0033852
611 Ga0495588_0333635
612 Ga0495599_0277183
613 Ga0495647_0184117
614 Ga0495658_0365245
615 Ga0495671_0431929
616 Ga0495604_0052065
617 Ga0495674_0089951
618 Ga0495676_0026708
619 Ga0495676_0378770
620 Ga0495676_0554020
621 Ga0495680_0180053
622 Ga0495684_0088244
623 Ga0495593_0004798
624 Ga0495602_0130641
625 Ga0495602_0171940
626 Ga0496100_0071447
627 Ga0496102_0001139
628 Ga0496102_0585392
629 Ga0496104_0001280
630 Ga0496105_0021361
631 Ga0496105_0455811
632 Ga0496107_0028833
633 Ga0496114_0003605
634 Ga0496115_0020738
635 Ga0496117_0105942
636 Ga0496118_0137799
637 Ga0496118_0383504
638 Ga0496118_0395841
639 Ga0496120_0264182
640 Ga0496122_0114441
641 Ga0496123_0251116
642 Ga0496125_0376030
643 Ga0496125_0429261
644 Ga0496126_0774921
645 Ga0501040_0244424
646 Ga0501041_0537916
647 Ga0501068_0220003
648 Ga0501071_0189128
649 Ga0501072_1208411
650 Ga0501075_0172725
651 Ga0501076_0054215
652 Ga0501081_0001008
653 Ga0501241_013963
654 Ga0501241_025948
655 Ga0501262_001252
656 Ga0501279_002899
657 nmdc:mga03683_1683_c2
658 nmdc:mga03n38_5603_c1
659 nmdc:mga00v17_1025473_c1
660 nmdc:mga00v17_2606_c1
661 nmdc:mga0yw44_45129_c1
662 nmdc:mga06z11_57352_c1
663 nmdc:mga07m45_302078_c1
664 Ga0495595_0007789
665 Ga0495619_0548051
666 Ga0500643_011351
667 Ga0500643_043031
668 Ga0500644_0232726
669 Ga0500647_0092428
670 Ga0500583_0000281
671 Ga0500651_0000038
672 Ga0500566_0000002
673 Ga0500640_002385
674 Ga0500641_0080126
675 Ga0500650_0153785
676 Ga0500650_0159851
677 Ga0500556_0000807
678 Ga0500560_062045
679 Ga0500562_035402
680 Ga0500571_000091
681 Ga0500572_000086
682 Ga0500572_227753
683 Ga0500591_006721
684 Ga0500594_0002185
685 Ga0500597_042110
686 Ga0500608_000680
687 Ga0500608_055885
688 Ga0500608_116722
689 Ga0500614_002154
690 Ga0500642_0000001
691 Ga0500642_0019447
692 Ga0500642_0189561
693 Ga0500655_000463
694 Ga0500658_0000321
695 Ga0500658_0003455
696 Ga0500559_0000096
697 Ga0500559_0015965
698 Ga0500561_0036863
699 Ga0500564_013125
700 Ga0500574_002585
701 Ga0500590_026109
702 Ga0500603_000087
703 Ga0500616_0000016
704 Ga0500616_0027015
705 Ga0500624_067897
706 Ga0500630_001748
707 Ga0500634_0045095
708 Ga0500638_012602
709 Ga0500638_217492
710 Ga0500639_000002
711 Ga0500636_0129380
712 Ga0500576_144164
713 Ga0500645_000500
714 Ga0500565_006038
715 Ga0500596_000071
716 Ga0500601_000618
717 Ga0501084_0018846
718 Ga0501082_0011411
719 Ga0501082_1854644
720 2513229794
721 2739244266
722 2838056737
723 2842680074
724 2889790995
725 2889915385
726 2904454614
727 2904460463
728 2928085169
729 2929524667
730 2945912775
731 2945947079
732 2945976775
733 2945984957
734 8006987705

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01989

AcnX_swivel_put

Aconitase X swivel domain

27

64

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cns-assembly1.cif.gz_B crystal structure of thermococcus kodakaraensis aconitase x (holo-form) 0.9526 14 146
7cns-assembly1.cif.gz_B crystal structure of thermococcus kodakaraensis aconitase x (holo-form) 0.9387 14 146
2hi6-assembly1.cif.gz_A solution nmr structure of upf0107 protein af_0055, northeast structural genomics consortium target gr101 0.9042 14 146
2hi6-assembly1.cif.gz_A solution nmr structure of upf0107 protein af_0055, northeast structural genomics consortium target gr101 0.8979 14 146
7d2r-assembly1.cif.gz_A crystal structure of agrobacterium tumefaciens aconitase x mutant - s449c/c510v 0.8608 18 136
ID Description Score Start End Superfamily
af_Q58802_1_129_3.50.30.10 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Phosphohistidine domain 0.9306 14 147 3.50.30.10
af_Q58802_1_129_3.50.30.10 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Phosphohistidine domain 0.9238 14 147 3.50.30.10
2hi6A00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Phosphohistidine domain 0.9042 14 146 3.50.30.10
2hi6A00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Phosphohistidine domain 0.8979 14 146 3.50.30.10
af_Q22649_1125_1231_3.50.30.10 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Phosphohistidine domain 0.748 14 146 3.50.30.10
ID Description Score Start End GO Terms
AF-A0A1F4B339-F1-model_v4 Phosphomevalonate dehydratase small subunit-like domain-containing protein 0.9977 12 149 GO:0016829
AF-A0A1F3X863-F1-model_v4 Phosphomevalonate dehydratase small subunit-like domain-containing protein 0.9951 26 148 GO:0016829
AF-A0A3D5E003-F1-model_v4 Phosphomevalonate dehydratase small subunit-like domain-containing protein 0.9948 14 148 GO:0016829
AF-A0A7Y0FAQ1-F1-model_v4 deleted 0.9932 14 148
AF-A0A3N5GBA3-F1-model_v4 DUF126 domain-containing protein 0.991 10 149 GO:0016829

Map