F424537

General Info

Members Datasets Scaffolds Average Seq Length
367 262 357 189

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221733|2644732383
Length 227
Sequence VYGDAVIQMRAVIAIAAKQSGGMERYETGLLRCDRXDGSRGFKRTFDMSATVIAVSSALGHRFSKPNQASIRLLKGLGVEGDAHCGETVKHRSRVKVDPTQPNLRQVHLIHAELLEELAGAGFDVAPGQMGENVLTRGLDLLGLPVGARLRLGNDAVVEITGLRNPCSQIEAFKPGLLKAVLGRDEQGNIVRKAGIMGIVLEGGEIRAGDAVAVTLPAEPHRALERV

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
3 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
4 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
5 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
6 2643221733 Bosea sp. Root381 Isolate Unclassified
7 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
8 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
9 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
10 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
11 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
12 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
13 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
74 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
77 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
78 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
81 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
82 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
83 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
85 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
86 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
123 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
124 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
125 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
126 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
135 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
136 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
137 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
138 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
139 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
140 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
146 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
147 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
148 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
149 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
150 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
151 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
152 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
153 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
154 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
155 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
156 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
157 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
158 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
159 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
160 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
161 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
162 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
163 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
164 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
165 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
168 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
169 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
170 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
171 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
172 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
173 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
174 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
175 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
176 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
177 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
178 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
179 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
180 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
181 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
182 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
183 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
184 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
185 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
186 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
187 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
188 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
189 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
190 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
191 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
192 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
193 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
194 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
195 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
196 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
197 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
198 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
199 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
200 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
201 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
202 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
203 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
204 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
205 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
206 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
207 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
208 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
209 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
210 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
223 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
224 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
225 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
226 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
227 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
228 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
229 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
230 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
231 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
238 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
239 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
240 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
241 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
243 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
244 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
245 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
246 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
247 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
248 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
249 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
250 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
251 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
252 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
253 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
254 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
255 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
256 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
257 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
258 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
259 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
260 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
261 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
262 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.28
Metatranscriptomes 0
Isolates 2.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.54
Nodule 0.82
Rhizoplane 5.72
Rhizosphere 76.84
Stem 0
Stem Tuber 0
Unclassified 10.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000006 3300002704 Bacteria 244109
2 JGI25156J39149_1000019 3300002705 Bacteria 160845
3 JGI25157J39369_1000024 3300002741 Bacteria 160844
4 JGI25165J46597_1001097 3300003214 Bacteria 17272
5 JGI25165J46597_1003042 3300003214 Bacteria 4575
6 rootH1_10125188 3300003316 Bacteria 1196
7 rootH2_10130526 3300003320 Bacteria 2846
8 rootL2_10042672 3300003322 Bacteria 2277
9 rootH1_10079566 3300003323 Bacteria 1823
10 Ga0058692_1011392 3300003856 Bacteria 2151
11 Ga0070683_100015107 3300005329 Bacteria 6776
12 Ga0070683_100157249 3300005329 Bacteria 2156
13 Ga0068869_100006341 3300005334 Bacteria 7492
14 Ga0070666_10275135 3300005335 Bacteria 1196
15 Ga0070680_100005989 3300005336 Bacteria 9223
16 Ga0068868_100034192 3300005338 Bacteria 3924
17 Ga0070660_100348199 3300005339 Bacteria 1220
18 Ga0070689_100089681 3300005340 Bacteria 2422
19 Ga0070661_100009004 3300005344 Bacteria 6907
20 Ga0070692_10040330 3300005345 Bacteria 2388
21 Ga0070671_100090836 3300005355 Bacteria 2557
22 Ga0070671_100239111 3300005355 Bacteria 1541
23 Ga0070673_100166202 3300005364 Bacteria 1880
24 Ga0070659_100008872 3300005366 Bacteria 7367
25 Ga0070667_100090077 3300005367 Bacteria 2636
26 Ga0070667_100333955 3300005367 Bacteria 1370
27 Ga0070714_100213154 3300005435 Bacteria 1771
28 Ga0070662_100072704 3300005457 Bacteria 2540
29 Ga0070662_100198413 3300005457 Bacteria 1591
30 Ga0070662_101092708 3300005457 Bacteria 684
31 Ga0070681_10038057 3300005458 Bacteria 4823
32 Ga0070681_10871988 3300005458 Bacteria 818
33 Ga0068867_100551042 3300005459 Bacteria 999
34 Ga0068867_100997779 3300005459 Bacteria 759
35 Ga0070679_100004096 3300005530 Bacteria 13442
36 Ga0070684_100097708 3300005535 Bacteria 2619
37 Ga0070686_100673821 3300005544 Bacteria 822
38 Ga0070665_100143999 3300005548 Bacteria 2387
39 Ga0068855_100079030 3300005563 Bacteria 3816
40 Ga0068855_100195100 3300005563 Bacteria 2281
41 Ga0068855_100226718 3300005563 Bacteria 2094
42 Ga0070664_100160376 3300005564 Bacteria 1990
43 Ga0070664_100223071 3300005564 Bacteria 1687
44 Ga0068857_100161957 3300005577 Bacteria 2030
45 Ga0068857_101011880 3300005577 Bacteria 800
46 Ga0068856_100184080 3300005614 Bacteria 2102
47 Ga0068856_100214340 3300005614 Bacteria 1941
48 Ga0068856_100417639 3300005614 Bacteria 1361
49 Ga0070702_100019899 3300005615 Bacteria 3508
50 Ga0068852_100190874 3300005616 Bacteria 1933
51 Ga0068852_100361966 3300005616 Bacteria 1419
52 Ga0068859_100018627 3300005617 Bacteria 6979
53 Ga0068864_100005418 3300005618 Bacteria 10458
54 Ga0068864_100062692 3300005618 Bacteria 3221
55 Ga0068864_100313757 3300005618 Bacteria 1471
56 Ga0068863_100016669 3300005841 Bacteria 7050
57 Ga0068863_100119026 3300005841 Bacteria 2517
58 Ga0068863_100318476 3300005841 Bacteria 1510
59 Ga0068860_100171975 3300005843 Bacteria 2093
60 Ga0068862_100075554 3300005844 Bacteria 2914
61 Ga0097621_100024128 3300006237 Bacteria 4745
62 Ga0097621_100546023 3300006237 Bacteria 1054
63 Ga0075429_100469167 3300006880 Bacteria 1103
64 Ga0097620_100018627 3300006931 Bacteria 6979
65 Ga0105240_10000027 3300009093 Bacteria 348486
66 Ga0105240_10764179 3300009093 Bacteria 1050
67 Ga0105240_11604873 3300009093 Bacteria 680
68 Ga0111539_10282844 3300009094 Bacteria 1930
69 Ga0105248_10128314 3300009177 Bacteria 2861
70 Ga0105248_10169367 3300009177 Bacteria 2462
71 Ga0105248_10388649 3300009177 Bacteria 1571
72 Ga0105237_10491467 3300009545 Bacteria 1234
73 Ga0105238_10136688 3300009551 Unclassified 2429
74 Ga0105238_10698323 3300009551 Bacteria 1026
75 Ga0105239_10723862 3300010375 Bacteria 1138
76 Ga0105239_11342377 3300010375 Bacteria 825
77 Ga0105246_10021809 3300011119 Bacteria 4126
78 Ga0157373_10081641 3300013100 Bacteria 2279
79 Ga0157371_10076249 3300013102 Bacteria 2374
80 Ga0157370_10000048 3300013104 Bacteria 124683
81 Ga0157370_10117772 3300013104 Bacteria 2481
82 Ga0157370_10340796 3300013104 Bacteria 1382
83 Ga0157369_10083198 3300013105 Bacteria 3423
84 Ga0157369_10110669 3300013105 Bacteria 2920
85 Ga0157369_10112114 3300013105 Bacteria 2898
86 Ga0157369_10663046 3300013105 Unclassified 1075
87 Ga0157374_10096938 3300013296 Bacteria 2821
88 Ga0157374_10167237 3300013296 Bacteria 2144
89 Ga0157378_10316778 3300013297 Bacteria 1514
90 Ga0163162_10173933 3300013306 Bacteria 2278
91 Ga0157372_10003544 3300013307 Bacteria 16820
92 Ga0157372_10084349 3300013307 Bacteria 3601
93 Ga0157372_10154321 3300013307 Bacteria 2652
94 Ga0157375_10159115 3300013308 Bacteria 2400
95 Ga0157375_10279872 3300013308 Bacteria 1831
96 Ga0157375_10809082 3300013308 Bacteria 1085
97 Ga0157375_11046953 3300013308 Bacteria 954
98 Ga0163163_10495109 3300014325 Bacteria 1284
99 Ga0157377_10033840 3300014745 Bacteria 2792
100 Ga0182007_10023024 3300015262 Bacteria 2194
101 Ga0182005_1006318 3300015265 Bacteria 3636
102 Ga0163161_10735241 3300017792 Bacteria 824
103 Ga0213876_10001701 3300021384 Bacteria 13382
104 Ga0209435_100011 3300025206 Bacteria 413027
105 Ga0209760_106126 3300025207 Bacteria 968
106 Ga0209672_104893 3300025228 Bacteria 2392
107 Ga0209437_100036 3300025233 Bacteria 469153
108 Ga0209437_100086 3300025233 Bacteria 254578
109 Ga0209646_1000024 3300025246 Bacteria 413027
110 Ga0209646_1019449 3300025246 Bacteria 987
111 Ga0209026_1000030 3300025250 Bacteria 329811
112 Ga0209677_100177 3300025253 Bacteria 54158
113 Ga0209759_1000011 3300025256 Bacteria 413027
114 Ga0209233_1000056 3300025261 Bacteria 438104
115 Ga0209233_1000110 3300025261 Bacteria 260825
116 Ga0209233_1000298 3300025261 Bacteria 61008
117 Ga0209675_1044533 3300025291 Bacteria 949
118 Ga0209675_1047889 3300025291 Bacteria 896
119 Ga0209676_1035749 3300025292 Bacteria 1453
120 Ga0207705_10003524 3300025909 Bacteria 11923
121 Ga0207654_10022668 3300025911 Bacteria 3353
122 Ga0207654_10094204 3300025911 Bacteria 1832
123 Ga0207695_10000024 3300025913 Bacteria 632311
124 Ga0207693_10170898 3300025915 Bacteria 1712
125 Ga0207662_10318610 3300025918 Bacteria 1038
126 Ga0207657_10244869 3300025919 Bacteria 1430
127 Ga0207657_10309970 3300025919 Bacteria 1249
128 Ga0207649_10202127 3300025920 Bacteria 1404
129 Ga0207652_10006926 3300025921 Bacteria 9129
130 Ga0207694_10086727 3300025924 Unclassified 2465
131 Ga0207687_10077516 3300025927 Bacteria 2390
132 Ga0207644_10022185 3300025931 Bacteria 4335
133 Ga0207644_10073724 3300025931 Bacteria 2504
134 Ga0207644_10179503 3300025931 Bacteria 1658
135 Ga0207690_10081971 3300025932 Bacteria 2255
136 Ga0207706_10033159 3300025933 Bacteria 4597
137 Ga0207706_10108878 3300025933 Bacteria 2438
138 Ga0207709_10004993 3300025935 Bacteria 7587
139 Ga0207670_10053382 3300025936 Bacteria 2723
140 Ga0207711_10232042 3300025941 Bacteria 1690
141 Ga0207689_10006155 3300025942 Bacteria 10620
142 Ga0207661_10112988 3300025944 Bacteria 2300
143 Ga0207661_10251200 3300025944 Bacteria 1572
144 Ga0207679_10058158 3300025945 Bacteria 2863
145 Ga0207679_10187525 3300025945 Bacteria 1716
146 Ga0207679_10244209 3300025945 Bacteria 1523
147 Ga0207667_10094475 3300025949 Bacteria 3087
148 Ga0207667_10224186 3300025949 Bacteria 1926
149 Ga0207667_11297134 3300025949 Unclassified 705
150 Ga0207651_10047557 3300025960 Bacteria 2894
151 Ga0207658_10713309 3300025986 Bacteria 907
152 Ga0207677_10011766 3300026023 Bacteria 5002
153 Ga0207677_10199291 3300026023 Bacteria 1590
154 Ga0207677_10415432 3300026023 Bacteria 1144
155 Ga0207708_10003588 3300026075 Bacteria 11446
156 Ga0207702_10178165 3300026078 Bacteria 1955
157 Ga0207702_10218104 3300026078 Bacteria 1777
158 Ga0207702_10224161 3300026078 Bacteria 1753
159 Ga0207702_10537658 3300026078 Bacteria 1142
160 Ga0207641_10027166 3300026088 Bacteria 4726
161 Ga0207641_10027696 3300026088 Bacteria 4682
162 Ga0207648_10000194 3300026089 Bacteria 64010
163 Ga0207648_10809458 3300026089 Bacteria 872
164 Ga0207676_10016624 3300026095 Bacteria 5328
165 Ga0207676_10030643 3300026095 Bacteria 4040
166 Ga0207676_10252694 3300026095 Bacteria 1587
167 Ga0207674_10641502 3300026116 Bacteria 1025
168 Ga0207674_10987531 3300026116 Bacteria 811
169 Ga0207698_10460070 3300026142 Bacteria 1230
170 Ga0209371_1006088 3300027312 Bacteria 4581
171 Ga0268266_10113919 3300028379 Bacteria 2399
172 Ga0268265_10162346 3300028380 Bacteria 1900
173 Ga0268264_10358130 3300028381 Bacteria 1391
174 Ga0307517_10105413 3300028786 Bacteria 2188
175 Ga0268256_1003713 3300030500 Bacteria 6721
176 Ga0307513_10002258 3300031456 Bacteria 26916
177 Ga0307513_10005650 3300031456 Bacteria 16477
178 Ga0307508_10219087 3300031616 Bacteria 1503
179 Ga0265342_10034614 3300031712 Bacteria 3098
180 Ga0307405_10410213 3300031731 Bacteria 1063
181 Ga0307413_10239692 3300031824 Bacteria 1338
182 Ga0307413_10310133 3300031824 Bacteria 1200
183 Ga0307407_10009873 3300031903 Bacteria 4469
184 Ga0307412_11064418 3300031911 Bacteria 718
185 Ga0307409_100029175 3300031995 Bacteria 3944
186 Ga0307409_100062079 3300031995 Bacteria 2924
187 Ga0307416_100047637 3300032002 Bacteria 3394
188 Ga0307416_100256532 3300032002 Bacteria 1706
189 Ga0307416_101994024 3300032002 Bacteria 683
190 Ga0307414_10096216 3300032004 Bacteria 2215
191 Ga0316583_10052470 3300032133 Bacteria 1435
192 Ga0373954_0067534 3300035118 Bacteria 1694
193 Ga0373956_0042646 3300035119 Bacteria 2018
194 Ga0373955_0125895 3300035172 Bacteria 1493
195 Ga0373935_0111577 3300035692 Unclassified 1816
196 Ga0373927_0191245 3300035695 Unclassified 1343
197 Ga0373933_0021520 3300035724 Bacteria 3664
198 Ga0373937_0015746 3300036401 Bacteria 6697
199 Ga0373937_0030050 3300036401 Bacteria 4921
200 Ga0373937_0116271 3300036401 Bacteria 2491
201 Ga0316582_0045110 3300036647 Bacteria 2775
202 Ga0395901_0095219 3300038443 Bacteria 3120
203 Ga0436365_0838808 3300039437 Bacteria 1068
204 Ga0436365_1531983 3300039437 Bacteria 6899
205 Ga0439465_0000099 3300041413 Bacteria 19766
206 Ga0451791_0942703 3300041451 Bacteria 2507
207 Ga0451793_0003410 3300041452 Bacteria 966
208 Ga0451853_2997123 3300041512 Bacteria 1044
209 Ga0451853_3417319 3300041512 Bacteria 2511
210 Ga0439431_0000731 3300041997 Bacteria 7090
211 Ga0439432_000645 3300042006 Bacteria 13060
212 Ga0439449_0001392 3300042007 Bacteria 9448
213 Ga0439452_001673 3300042010 Bacteria 8724
214 Ga0439457_004165 3300042014 Bacteria 3815
215 Ga0439462_0015257 3300042015 Bacteria 1979
216 Ga0439446_0026341 3300042156 Bacteria 1665
217 Ga0439434_0000158 3300042435 Bacteria 18217
218 Ga0466969_0006486 3300044656 Bacteria 6229
219 Ga0466966_0008660 3300044684 Bacteria 6734
220 Ga0466966_0066942 3300044684 Bacteria 2257
221 Ga0466966_0681915 3300044684 Bacteria 619
222 Ga0466961_0038886 3300044693 Bacteria 3051
223 Ga0466961_0417910 3300044693 Bacteria 813
224 Ga0466963_0090273 3300044694 Bacteria 2086
225 Ga0466963_0107370 3300044694 Bacteria 1914
226 Ga0466963_0917769 3300044694 Unclassified 617
227 Ga0453684_0075106 3300044712 Bacteria 4250
228 Ga0466971_0199158 3300044719 Bacteria 945
229 Ga0466970_0071249 3300044765 Bacteria 1869
230 Ga0466957_0115876 3300044842 Bacteria 1704
231 Ga0466959_0016583 3300045049 Bacteria 5386
232 Ga0466959_0295275 3300045049 Bacteria 1110
233 Ga0466967_0801841 3300045976 Bacteria 935
234 Ga0495592_0144908 3300046454 Bacteria 1648
235 Ga0495629_0223628 3300046459 Bacteria 1298
236 Ga0495651_0006258 3300046462 Bacteria 9103
237 Ga0495651_0087401 3300046462 Bacteria 2344
238 Ga0495653_0031357 3300046463 Bacteria 4225
239 Ga0495605_0010643 3300046474 Bacteria 5141
240 Ga0495664_0152180 3300046477 Bacteria 1403
241 Ga0495594_0131578 3300046499 Unclassified 1417
242 Ga0495608_0149938 3300046511 Bacteria 1486
243 Ga0495610_0178233 3300046512 Bacteria 886
244 Ga0495618_0060588 3300046514 Unclassified 2400
245 Ga0495628_0068423 3300046516 Bacteria 2771
246 Ga0495630_0015377 3300046517 Bacteria 5588
247 Ga0495631_0033962 3300046518 Bacteria 2288
248 Ga0495666_0005797 3300046526 Bacteria 6225
249 Ga0495666_0031371 3300046526 Bacteria 2604
250 Ga0495642_0006930 3300046528 Bacteria 4347
251 Ga0495652_0002274 3300046529 Bacteria 20037
252 Ga0495652_0043253 3300046529 Unclassified 3881
253 Ga0495665_0011200 3300046531 Bacteria 4856
254 Ga0495640_0245356 3300046533 Bacteria 1123
255 Ga0495640_0610759 3300046533 Unclassified 658
256 Ga0495586_0182818 3300046535 Unclassified 1186
257 Ga0495586_0219796 3300046535 Bacteria 1079
258 Ga0495587_0004255 3300046536 Bacteria 9462
259 Ga0495587_0117700 3300046536 Bacteria 1523
260 Ga0495645_0001889 3300046543 Bacteria 14244
261 Ga0495667_0005450 3300046559 Bacteria 8596
262 Ga0495667_0011302 3300046559 Bacteria 6042
263 Ga0495668_0041332 3300046616 Bacteria 2568
264 Ga0495611_0006639 3300046648 Bacteria 4927
265 Ga0495625_0022390 3300046660 Bacteria 4845
266 Ga0495635_0549527 3300046663 Bacteria 757
267 Ga0495657_0093735 3300046675 Bacteria 1921
268 Ga0495599_0000514 3300046678 Bacteria 22162
269 Ga0495599_0000629 3300046678 Bacteria 19951
270 Ga0495623_0011540 3300046679 Bacteria 5718
271 Ga0495646_0171864 3300046680 Bacteria 1194
272 Ga0495647_0026686 3300046681 Unclassified 2118
273 Ga0495670_0052241 3300046691 Bacteria 2046
274 Ga0495670_0119032 3300046691 Bacteria 1371
275 Ga0495600_0166690 3300046809 Bacteria 1423
276 Ga0495660_0235318 3300046810 Bacteria 856
277 Ga0495604_0006039 3300047317 Bacteria 9609
278 Ga0495604_0097594 3300047317 Bacteria 2166
279 Ga0495672_0166244 3300047320 Unclassified 1129
280 Ga0495680_0013558 3300047322 Bacteria 7105
281 Ga0495680_0127790 3300047322 Bacteria 1870
282 Ga0495675_0045370 3300047444 Bacteria 2799
283 Ga0495677_0074151 3300047445 Bacteria 1270
284 Ga0495681_0156432 3300047470 Bacteria 952
285 Ga0495684_0027335 3300047471 Bacteria 4380
286 Ga0495684_0029327 3300047471 Bacteria 4223
287 Ga0495684_0186473 3300047471 Bacteria 1536
288 Ga0495602_0030037 3300048088 Bacteria 5163
289 Ga0495602_0287117 3300048088 Bacteria 1209
290 Ga0496100_0066607 3300048903 Bacteria 2389
291 Ga0496101_0103920 3300048904 Bacteria 2130
292 Ga0496101_0158098 3300048904 Bacteria 1737
293 Ga0496102_0084883 3300048905 Bacteria 2923
294 Ga0496103_0055755 3300048906 Bacteria 2451
295 Ga0496103_0058776 3300048906 Bacteria 2389
296 Ga0496104_0106292 3300048907 Bacteria 2690
297 Ga0496104_0576161 3300048907 Bacteria 1036
298 Ga0496106_0049557 3300048909 Bacteria 3164
299 Ga0496107_0040765 3300048910 Bacteria 3334
300 Ga0496109_0012561 3300048912 Bacteria 7311
301 Ga0496110_0059065 3300048913 Bacteria 3379
302 Ga0496111_0170005 3300048914 Bacteria 1620
303 Ga0496112_0057990 3300048915 Bacteria 3812
304 Ga0496112_0144281 3300048915 Bacteria 2349
305 Ga0496112_0200265 3300048915 Bacteria 1956
306 Ga0496113_0085268 3300048916 Bacteria 2426
307 Ga0496113_0127676 3300048916 Bacteria 1993
308 Ga0496115_0571396 3300048918 Bacteria 902
309 Ga0496117_0001662 3300048920 Bacteria 31159
310 Ga0496118_0103432 3300048921 Bacteria 1915
311 Ga0496119_0055042 3300048922 Bacteria 2418
312 Ga0496119_0055292 3300048922 Bacteria 2411
313 Ga0496120_0065920 3300048923 Bacteria 2004
314 Ga0496122_0055858 3300048925 Bacteria 2950
315 Ga0496122_0060214 3300048925 Bacteria 2797
316 Ga0496123_0056446 3300048926 Bacteria 2566
317 Ga0496123_0058320 3300048926 Bacteria 2505
318 Ga0496124_0113512 3300048927 Bacteria 2177
319 Ga0496125_0092534 3300048928 Bacteria 2260
320 Ga0496126_0075627 3300048929 Bacteria 2988
321 Ga0501034_0057394 3300049571 Bacteria 3914
322 Ga0501036_0018512 3300049572 Bacteria 5838
323 Ga0501038_0095754 3300049574 Bacteria 2479
324 Ga0501040_0344425 3300049576 Bacteria 1067
325 Ga0501046_0008468 3300049580 Bacteria 8964
326 Ga0501048_0003638 3300049582 Bacteria 11742
327 Ga0501048_0145296 3300049582 Bacteria 1678
328 Ga0501073_0002169 3300049589 Bacteria 14676
329 Ga0501202_026553 3300049652 Bacteria 1186
330 Ga0501238_000309 3300049671 Bacteria 6379
331 Ga0501251_046673 3300049681 Bacteria 674
332 Ga0501035_0018957 3300049822 Bacteria 6336
333 Ga0501044_0021983 3300049823 Bacteria 6801
334 nmdc:mga03683_370937_c1 3300050489 Bacteria 680
335 nmdc:mga00v17_179_c1 3300050491 Bacteria 37487
336 nmdc:mga0k408_24677_c1 3300050493 Bacteria 3400
337 nmdc:mga05p37_723055_c1 3300050507 Unclassified 1102
338 nmdc:mga09592_439280_c1 3300050508 Bacteria 1126
339 nmdc:mga06r32_341018_c1 3300050510 Bacteria 1483
340 Ga0495601_0000674 3300053077 Bacteria 18216
341 Ga0495601_0602339 3300053077 Bacteria 705
342 Ga0495612_0029601 3300053078 Bacteria 2206
343 Ga0500610_0141539 3300053079 Bacteria 1214
344 Ga0495655_0128322 3300053083 Bacteria 779
345 Ga0495595_0016118 3300053084 Bacteria 3192
346 Ga0495595_0019435 3300053084 Bacteria 2947
347 Ga0495619_0215971 3300053085 Bacteria 1328
348 Ga0500578_0247883 3300053086 Bacteria 1074
349 Ga0500643_001058 3300053087 Bacteria 16650
350 Ga0500569_001361 3300053109 Bacteria 4590
351 Ga0500595_014681 3300053119 Bacteria 2965
352 Ga0500616_0000747 3300053153 Bacteria 37477
353 Ga0500616_0068014 3300053153 Bacteria 1825
354 Ga0500636_0263059 3300053177 Bacteria 872
355 Ga0466962_0211478 3300061719 Bacteria 949
356 Ga0466962_0384202 3300061719 Bacteria 702
357 Ga0530510_0085274 3300061734 Bacteria 2301

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031616 Ga0307508_10219087 Ga0307508_102190872 165
2 3300031824 Ga0307413_10239692 Ga0307413_102396922 169
3 3300031995 Ga0307409_100062079 Ga0307409_1000620793 169
4 3300005435 Ga0070714_100213154 Ga0070714_1002131541 177
5 3300005459 Ga0068867_100551042 Ga0068867_1005510422 177
6 3300005563 Ga0068855_100195100 Ga0068855_1001951003 177
7 3300005614 Ga0068856_100417639 Ga0068856_1004176392 177
8 3300005841 Ga0068863_100119026 Ga0068863_1001190262 177
9 3300005844 Ga0068862_100075554 Ga0068862_1000755543 177
10 3300009177 Ga0105248_10169367 Ga0105248_101693674 177
11 3300010375 Ga0105239_10723862 Ga0105239_107238622 177
12 3300010375 Ga0105239_11342377 Ga0105239_113423772 177
13 3300013297 Ga0157378_10316778 Ga0157378_103167782 177
14 3300014325 Ga0163163_10495109 Ga0163163_104951091 177
15 3300025291 Ga0209675_1044533 Ga0209675_10445332 177
16 3300025292 Ga0209676_1035749 Ga0209676_10357492 177
17 3300025911 Ga0207654_10094204 Ga0207654_100942042 177
18 3300025935 Ga0207709_10004993 Ga0207709_100049933 177
19 3300025941 Ga0207711_10232042 Ga0207711_102320422 177
20 3300026023 Ga0207677_10011766 Ga0207677_1001176611 177
21 3300026023 Ga0207677_10199291 Ga0207677_101992912 177
22 3300026075 Ga0207708_10003588 Ga0207708_1000358813 177
23 3300026078 Ga0207702_10218104 Ga0207702_102181042 177
24 3300026078 Ga0207702_10537658 Ga0207702_105376582 177
25 3300026089 Ga0207648_10000194 Ga0207648_1000019415 177
26 3300028380 Ga0268265_10162346 Ga0268265_101623462 177
27 3300031731 Ga0307405_10410213 Ga0307405_104102132 177
28 3300031911 Ga0307412_11064418 Ga0307412_110644181 177
29 3300032002 Ga0307416_100047637 Ga0307416_1000476373 177
30 3300032002 Ga0307416_100256532 Ga0307416_1002565322 177
31 3300035172 Ga0373955_0125895 Ga0373955_0125895_297_848 177
32 3300036401 Ga0373937_0116271 Ga0373937_0116271_919_1470 177
33 3300038443 Ga0395901_0095219 Ga0395901_0095219_737_1285 177
34 3300039437 Ga0436365_0838808 Ga0436365_0838808_457_1008 177
35 3300041413 Ga0439465_0000099 Ga0439465_0000099_9705_10265 177
36 3300041997 Ga0439431_0000731 Ga0439431_0000731_4178_4738 177
37 3300042006 Ga0439432_000645 Ga0439432_000645_10725_11285 177
38 3300042007 Ga0439449_0001392 Ga0439449_0001392_8764_9324 177
39 3300042010 Ga0439452_001673 Ga0439452_001673_1700_2260 177
40 3300042014 Ga0439457_004165 Ga0439457_004165_1471_2031 177
41 3300042015 Ga0439462_0015257 Ga0439462_0015257_157_717 177
42 3300042156 Ga0439446_0026341 Ga0439446_0026341_18_578 177
43 3300042435 Ga0439434_0000158 Ga0439434_0000158_14005_14565 177
44 3300044684 Ga0466966_0681915 Ga0466966_0681915_29_577 177
45 3300044693 Ga0466961_0417910 Ga0466961_0417910_231_779 177
46 3300044694 Ga0466963_0917769 Ga0466963_0917769_20_571 177
47 3300044712 Ga0453684_0075106 Ga0453684_0075106_1023_1586 177
48 3300046462 Ga0495651_0087401 Ga0495651_0087401_791_1342 177
49 3300046559 Ga0495667_0005450 Ga0495667_0005450_3299_3850 177
50 3300046663 Ga0495635_0549527 Ga0495635_0549527_27_578 177
51 3300046675 Ga0495657_0093735 Ga0495657_0093735_333_884 177
52 3300047322 Ga0495680_0013558 Ga0495680_0013558_2372_2923 177
53 3300047444 Ga0495675_0045370 Ga0495675_0045370_899_1450 177
54 3300047471 Ga0495684_0186473 Ga0495684_0186473_229_780 177
55 3300048915 Ga0496112_0057990 Ga0496112_0057990_1253_1807 177
56 3300049576 Ga0501040_0344425 Ga0501040_0344425_256_807 177
57 3300049582 Ga0501048_0145296 Ga0501048_0145296_406_957 177
58 3300049652 Ga0501202_026553 Ga0501202_026553_303_851 177
59 3300050489 nmdc:mga03683_370937_c1 nmdc:mga03683_370937_c1_16_576 177
60 3300050493 nmdc:mga0k408_24677_c1 nmdc:mga0k408_24677_c1_2211_2771 177
61 3300050510 nmdc:mga06r32_341018_c1 nmdc:mga06r32_341018_c1_802_1350 177
62 3300053077 Ga0495601_0602339 Ga0495601_0602339_70_621 177
63 3300053084 Ga0495595_0019435 Ga0495595_0019435_2165_2716 177
64 3300053087 Ga0500643_001058 Ga0500643_001058_3429_3977 177
65 3300061719 Ga0466962_0384202 Ga0466962_0384202_89_643 177
66 3300061734 Ga0530510_0085274 Ga0530510_0085274_508_1059 177
67 iso_pu_bacteria 2508501050 2508728818 177
68 3300005564 Ga0070664_100160376 Ga0070664_1001603762 178
69 3300005577 Ga0068857_101011880 Ga0068857_1010118801 178
70 3300006880 Ga0075429_100469167 Ga0075429_1004691672 178
71 3300013105 Ga0157369_10112114 Ga0157369_101121143 178
72 3300013307 Ga0157372_10154321 Ga0157372_101543213 178
73 3300013308 Ga0157375_10279872 Ga0157375_102798722 178
74 3300025944 Ga0207661_10251200 Ga0207661_102512002 178
75 3300025945 Ga0207679_10187525 Ga0207679_101875252 178
76 3300026095 Ga0207676_10030643 Ga0207676_100306434 178
77 3300026116 Ga0207674_10987531 Ga0207674_109875312 178
78 3300031456 Ga0307513_10002258 Ga0307513_1000225823 178
79 3300031712 Ga0265342_10034614 Ga0265342_100346144 178
80 3300031824 Ga0307413_10310133 Ga0307413_103101332 178
81 3300032002 Ga0307416_101994024 Ga0307416_1019940241 178
82 3300046474 Ga0495605_0010643 Ga0495605_0010643_1847_2413 178
83 3300046512 Ga0495610_0178233 Ga0495610_0178233_236_802 178
84 3300046518 Ga0495631_0033962 Ga0495631_0033962_1623_2189 178
85 3300046535 Ga0495586_0219796 Ga0495586_0219796_81_638 178
86 3300046660 Ga0495625_0022390 Ga0495625_0022390_2261_2827 178
87 3300046691 Ga0495670_0119032 Ga0495670_0119032_300_866 178
88 3300046810 Ga0495660_0235318 Ga0495660_0235318_59_625 178
89 3300047320 Ga0495672_0166244 Ga0495672_0166244_455_1012 178
90 3300049571 Ga0501034_0057394 Ga0501034_0057394_1097_1654 178
91 3300049572 Ga0501036_0018512 Ga0501036_0018512_593_1150 178
92 3300049574 Ga0501038_0095754 Ga0501038_0095754_942_1499 178
93 3300049580 Ga0501046_0008468 Ga0501046_0008468_61_618 178
94 3300049582 Ga0501048_0003638 Ga0501048_0003638_2392_2949 178
95 3300049589 Ga0501073_0002169 Ga0501073_0002169_4519_5085 178
96 3300049671 Ga0501238_000309 Ga0501238_000309_2755_3312 178
97 3300049822 Ga0501035_0018957 Ga0501035_0018957_840_1397 178
98 3300049823 Ga0501044_0021983 Ga0501044_0021983_5779_6336 178
99 3300050508 nmdc:mga09592_439280_c1 nmdc:mga09592_439280_c1_40_594 178
100 3300053079 Ga0500610_0141539 Ga0500610_0141539_207_797 178
101 3300053083 Ga0495655_0128322 Ga0495655_0128322_130_687 178
102 3300053086 Ga0500578_0247883 Ga0500578_0247883_105_671 178
103 3300053109 Ga0500569_001361 Ga0500569_001361_1844_2410 178
104 3300053153 Ga0500616_0000747 Ga0500616_0000747_25278_25844 178
105 3300053153 Ga0500616_0068014 Ga0500616_0068014_566_1123 178
106 3300005329 Ga0070683_100157249 Ga0070683_1001572495 179
107 3300005355 Ga0070671_100090836 Ga0070671_1000908363 179
108 3300005364 Ga0070673_100166202 Ga0070673_1001662022 179
109 3300005457 Ga0070662_100198413 Ga0070662_1001984132 179
110 3300005458 Ga0070681_10871988 Ga0070681_108719881 179
111 3300005459 Ga0068867_100997779 Ga0068867_1009977791 179
112 3300005563 Ga0068855_100079030 Ga0068855_1000790304 179
113 3300005564 Ga0070664_100223071 Ga0070664_1002230712 179
114 3300005618 Ga0068864_100062692 Ga0068864_1000626923 179
115 3300005618 Ga0068864_100313757 Ga0068864_1003137572 179
116 3300005841 Ga0068863_100318476 Ga0068863_1003184763 179
117 3300006237 Ga0097621_100546023 Ga0097621_1005460233 179
118 3300009093 Ga0105240_11604873 Ga0105240_116048731 179
119 3300009177 Ga0105248_10128314 Ga0105248_101283142 179
120 3300009545 Ga0105237_10491467 Ga0105237_104914672 179
121 3300009551 Ga0105238_10136688 Ga0105238_101366883 179
122 3300013104 Ga0157370_10117772 Ga0157370_101177723 179
123 3300013104 Ga0157370_10340796 Ga0157370_103407962 179
124 3300013105 Ga0157369_10663046 Ga0157369_106630462 179
125 3300013296 Ga0157374_10167237 Ga0157374_101672372 179
126 3300013306 Ga0163162_10173933 Ga0163162_101739332 179
127 3300013307 Ga0157372_10084349 Ga0157372_100843495 179
128 3300013308 Ga0157375_10159115 Ga0157375_101591152 179
129 3300013308 Ga0157375_11046953 Ga0157375_110469531 179
130 3300017792 Ga0163161_10735241 Ga0163161_107352411 179
131 3300025909 Ga0207705_10003524 Ga0207705_1000352410 179
132 3300025915 Ga0207693_10170898 Ga0207693_101708982 179
133 3300025919 Ga0207657_10309970 Ga0207657_103099702 179
134 3300025924 Ga0207694_10086727 Ga0207694_100867273 179
135 3300025931 Ga0207644_10022185 Ga0207644_100221855 179
136 3300025931 Ga0207644_10179503 Ga0207644_101795033 179
137 3300025933 Ga0207706_10108878 Ga0207706_101088783 179
138 3300025945 Ga0207679_10244209 Ga0207679_102442091 179
139 3300025949 Ga0207667_10094475 Ga0207667_100944752 179
140 3300025949 Ga0207667_11297134 Ga0207667_112971341 179
141 3300025960 Ga0207651_10047557 Ga0207651_100475572 179
142 3300026088 Ga0207641_10027696 Ga0207641_100276966 179
143 3300026089 Ga0207648_10809458 Ga0207648_108094581 179
144 3300026095 Ga0207676_10016624 Ga0207676_100166246 179
145 3300026116 Ga0207674_10641502 Ga0207674_106415022 179
146 3300028786 Ga0307517_10105413 Ga0307517_101054132 179
147 3300031456 Ga0307513_10005650 Ga0307513_100056504 179
148 3300031903 Ga0307407_10009873 Ga0307407_100098734 179
149 3300032133 Ga0316583_10052470 Ga0316583_100524702 179
150 3300035118 Ga0373954_0067534 Ga0373954_0067534_895_1458 179
151 3300035119 Ga0373956_0042646 Ga0373956_0042646_936_1499 179
152 3300035692 Ga0373935_0111577 Ga0373935_0111577_740_1300 179
153 3300035695 Ga0373927_0191245 Ga0373927_0191245_622_1182 179
154 3300035724 Ga0373933_0021520 Ga0373933_0021520_1806_2369 179
155 3300036401 Ga0373937_0015746 Ga0373937_0015746_6002_6565 179
156 3300036401 Ga0373937_0030050 Ga0373937_0030050_2895_3458 179
157 3300036647 Ga0316582_0045110 Ga0316582_0045110_937_1491 179
158 3300041451 Ga0451791_0942703 Ga0451791_0942703_683_1255 179
159 3300041452 Ga0451793_0003410 Ga0451793_0003410_114_686 179
160 3300041512 Ga0451853_2997123 Ga0451853_2997123_291_863 179
161 3300044656 Ga0466969_0006486 Ga0466969_0006486_3112_3678 179
162 3300044684 Ga0466966_0008660 Ga0466966_0008660_2745_3311 179
163 3300044693 Ga0466961_0038886 Ga0466961_0038886_1604_2170 179
164 3300045049 Ga0466959_0016583 Ga0466959_0016583_1642_2208 179
165 3300046454 Ga0495592_0144908 Ga0495592_0144908_1015_1578 179
166 3300046459 Ga0495629_0223628 Ga0495629_0223628_118_678 179
167 3300046462 Ga0495651_0006258 Ga0495651_0006258_378_941 179
168 3300046463 Ga0495653_0031357 Ga0495653_0031357_1568_2131 179
169 3300046477 Ga0495664_0152180 Ga0495664_0152180_251_814 179
170 3300046499 Ga0495594_0131578 Ga0495594_0131578_415_1020 179
171 3300046511 Ga0495608_0149938 Ga0495608_0149938_470_1033 179
172 3300046514 Ga0495618_0060588 Ga0495618_0060588_1437_1997 179
173 3300046516 Ga0495628_0068423 Ga0495628_0068423_2002_2565 179
174 3300046517 Ga0495630_0015377 Ga0495630_0015377_1115_1720 179
175 3300046526 Ga0495666_0005797 Ga0495666_0005797_314_895 179
176 3300046526 Ga0495666_0031371 Ga0495666_0031371_1226_1831 179
177 3300046528 Ga0495642_0006930 Ga0495642_0006930_3001_3576 179
178 3300046529 Ga0495652_0002274 Ga0495652_0002274_6420_6983 179
179 3300046529 Ga0495652_0043253 Ga0495652_0043253_652_1218 179
180 3300046531 Ga0495665_0011200 Ga0495665_0011200_4004_4609 179
181 3300046533 Ga0495640_0245356 Ga0495640_0245356_41_601 179
182 3300046533 Ga0495640_0610759 Ga0495640_0610759_46_612 179
183 3300046535 Ga0495586_0182818 Ga0495586_0182818_20_580 179
184 3300046536 Ga0495587_0004255 Ga0495587_0004255_8715_9278 179
185 3300046536 Ga0495587_0117700 Ga0495587_0117700_856_1422 179
186 3300046543 Ga0495645_0001889 Ga0495645_0001889_9920_10483 179
187 3300046559 Ga0495667_0011302 Ga0495667_0011302_4662_5225 179
188 3300046616 Ga0495668_0041332 Ga0495668_0041332_1609_2181 179
189 3300046648 Ga0495611_0006639 Ga0495611_0006639_2130_2702 179
190 3300046678 Ga0495599_0000514 Ga0495599_0000514_8220_8786 179
191 3300046678 Ga0495599_0000629 Ga0495599_0000629_18496_19059 179
192 3300046679 Ga0495623_0011540 Ga0495623_0011540_686_1249 179
193 3300046680 Ga0495646_0171864 Ga0495646_0171864_219_782 179
194 3300046681 Ga0495647_0026686 Ga0495647_0026686_381_986 179
195 3300046691 Ga0495670_0052241 Ga0495670_0052241_1397_1972 179
196 3300046809 Ga0495600_0166690 Ga0495600_0166690_605_1168 179
197 3300047317 Ga0495604_0006039 Ga0495604_0006039_188_751 179
198 3300047317 Ga0495604_0097594 Ga0495604_0097594_382_963 179
199 3300047322 Ga0495680_0127790 Ga0495680_0127790_738_1301 179
200 3300047445 Ga0495677_0074151 Ga0495677_0074151_61_636 179
201 3300047470 Ga0495681_0156432 Ga0495681_0156432_242_814 179
202 3300047471 Ga0495684_0027335 Ga0495684_0027335_2260_2820 179
203 3300047471 Ga0495684_0029327 Ga0495684_0029327_899_1462 179
204 3300048088 Ga0495602_0030037 Ga0495602_0030037_578_1141 179
205 3300048088 Ga0495602_0287117 Ga0495602_0287117_39_602 179
206 3300048904 Ga0496101_0158098 Ga0496101_0158098_416_991 179
207 3300048905 Ga0496102_0084883 Ga0496102_0084883_1026_1601 179
208 3300048906 Ga0496103_0058776 Ga0496103_0058776_251_826 179
209 3300048907 Ga0496104_0576161 Ga0496104_0576161_400_975 179
210 3300048909 Ga0496106_0049557 Ga0496106_0049557_2300_2875 179
211 3300048910 Ga0496107_0040765 Ga0496107_0040765_264_839 179
212 3300048912 Ga0496109_0012561 Ga0496109_0012561_4681_5256 179
213 3300048913 Ga0496110_0059065 Ga0496110_0059065_1492_2067 179
214 3300048914 Ga0496111_0170005 Ga0496111_0170005_236_811 179
215 3300048915 Ga0496112_0200265 Ga0496112_0200265_73_648 179
216 3300048916 Ga0496113_0127676 Ga0496113_0127676_394_969 179
217 3300048918 Ga0496115_0571396 Ga0496115_0571396_78_653 179
218 3300049681 Ga0501251_046673 Ga0501251_046673_54_635 179
219 3300050491 nmdc:mga00v17_179_c1 nmdc:mga00v17_179_c1_30839_31420 179
220 3300053077 Ga0495601_0000674 Ga0495601_0000674_15131_15697 179
221 3300053078 Ga0495612_0029601 Ga0495612_0029601_1098_1664 179
222 3300053084 Ga0495595_0016118 Ga0495595_0016118_293_856 179
223 3300053085 Ga0495619_0215971 Ga0495619_0215971_636_1199 179
224 iso_pu_bacteria 2643221632 2644182087 179
225 iso_pu_bacteria 2675903058 2676474626 179
226 iso_pu_bacteria 2827628540 2827632900 179
227 iso_pu_bacteria 2919704043 2919705891 179
228 3300005457 Ga0070662_101092708 Ga0070662_1010927081 180
229 3300025291 Ga0209675_1047889 Ga0209675_10478892 181
230 3300005329 Ga0070683_100015107 Ga0070683_1000151072 182
231 3300005334 Ga0068869_100006341 Ga0068869_1000063418 182
232 3300005335 Ga0070666_10275135 Ga0070666_102751352 182
233 3300005336 Ga0070680_100005989 Ga0070680_1000059899 182
234 3300005338 Ga0068868_100034192 Ga0068868_1000341925 182
235 3300005339 Ga0070660_100348199 Ga0070660_1003481992 182
236 3300005340 Ga0070689_100089681 Ga0070689_1000896812 182
237 3300005344 Ga0070661_100009004 Ga0070661_1000090048 182
238 3300005345 Ga0070692_10040330 Ga0070692_100403302 182
239 3300005355 Ga0070671_100239111 Ga0070671_1002391112 182
240 3300005366 Ga0070659_100008872 Ga0070659_1000088723 182
241 3300005367 Ga0070667_100333955 Ga0070667_1003339552 182
242 3300005457 Ga0070662_100072704 Ga0070662_1000727042 182
243 3300005458 Ga0070681_10038057 Ga0070681_100380572 182
244 3300005530 Ga0070679_100004096 Ga0070679_1000040962 182
245 3300005535 Ga0070684_100097708 Ga0070684_1000977082 182
246 3300005544 Ga0070686_100673821 Ga0070686_1006738211 182
247 3300005577 Ga0068857_100161957 Ga0068857_1001619572 182
248 3300005614 Ga0068856_100184080 Ga0068856_1001840802 182
249 3300005615 Ga0070702_100019899 Ga0070702_1000198992 182
250 3300005616 Ga0068852_100361966 Ga0068852_1003619662 182
251 3300005617 Ga0068859_100018627 Ga0068859_1000186272 182
252 3300005618 Ga0068864_100005418 Ga0068864_1000054182 182
253 3300005841 Ga0068863_100016669 Ga0068863_1000166692 182
254 3300005843 Ga0068860_100171975 Ga0068860_1001719752 182
255 3300006237 Ga0097621_100024128 Ga0097621_1000241286 182
256 3300006931 Ga0097620_100018627 Ga0097620_1000186272 182
257 3300009093 Ga0105240_10764179 Ga0105240_107641792 182
258 3300009094 Ga0111539_10282844 Ga0111539_102828442 182
259 3300009177 Ga0105248_10388649 Ga0105248_103886492 182
260 3300011119 Ga0105246_10021809 Ga0105246_100218095 182
261 3300013100 Ga0157373_10081641 Ga0157373_100816413 182
262 3300013102 Ga0157371_10076249 Ga0157371_100762493 182
263 3300013105 Ga0157369_10083198 Ga0157369_100831984 182
264 3300013296 Ga0157374_10096938 Ga0157374_100969382 182
265 3300013307 Ga0157372_10003544 Ga0157372_100035445 182
266 3300013308 Ga0157375_10809082 Ga0157375_108090821 182
267 3300014745 Ga0157377_10033840 Ga0157377_100338402 182
268 3300021384 Ga0213876_10001701 Ga0213876_100017016 182
269 3300025911 Ga0207654_10022668 Ga0207654_100226681 182
270 3300025918 Ga0207662_10318610 Ga0207662_103186101 182
271 3300025919 Ga0207657_10244869 Ga0207657_102448692 182
272 3300025920 Ga0207649_10202127 Ga0207649_102021272 182
273 3300025921 Ga0207652_10006926 Ga0207652_100069269 182
274 3300025927 Ga0207687_10077516 Ga0207687_100775162 182
275 3300025931 Ga0207644_10073724 Ga0207644_100737242 182
276 3300025932 Ga0207690_10081971 Ga0207690_100819713 182
277 3300025933 Ga0207706_10033159 Ga0207706_100331595 182
278 3300025936 Ga0207670_10053382 Ga0207670_100533822 182
279 3300025942 Ga0207689_10006155 Ga0207689_100061559 182
280 3300025944 Ga0207661_10112988 Ga0207661_101129883 182
281 3300025945 Ga0207679_10058158 Ga0207679_100581583 182
282 3300025949 Ga0207667_10224186 Ga0207667_102241861 182
283 3300025986 Ga0207658_10713309 Ga0207658_107133091 182
284 3300026023 Ga0207677_10415432 Ga0207677_104154322 182
285 3300026078 Ga0207702_10224161 Ga0207702_102241612 182
286 3300026088 Ga0207641_10027166 Ga0207641_100271662 182
287 3300026095 Ga0207676_10252694 Ga0207676_102526942 182
288 3300026142 Ga0207698_10460070 Ga0207698_104600702 182
289 3300028381 Ga0268264_10358130 Ga0268264_103581302 182
290 3300032004 Ga0307414_10096216 Ga0307414_100962162 182
291 3300039437 Ga0436365_1531983 Ga0436365_1531983_4354_5013 182
292 3300044694 Ga0466963_0090273 Ga0466963_0090273_165_722 182
293 3300050507 nmdc:mga05p37_723055_c1 nmdc:mga05p37_723055_c1_220_789 182
294 iso_pu_bacteria 2643221733 2644732383 182
295 3300002704 JGI25155J39150_1000006 JGI25155J39150_1000006171 183
296 3300002705 JGI25156J39149_1000019 JGI25156J39149_100001975 183
297 3300002741 JGI25157J39369_1000024 JGI25157J39369_100002488 183
298 3300003214 JGI25165J46597_1001097 JGI25165J46597_10010979 183
299 3300003214 JGI25165J46597_1003042 JGI25165J46597_10030422 183
300 3300003316 rootH1_10125188 rootH1_101251881 183
301 3300003320 rootH2_10130526 rootH2_101305262 183
302 3300003322 rootL2_10042672 rootL2_100426722 183
303 3300003323 rootH1_10079566 rootH1_100795661 183
304 3300003856 Ga0058692_1011392 Ga0058692_10113922 183
305 3300005367 Ga0070667_100090077 Ga0070667_1000900773 183
306 3300005548 Ga0070665_100143999 Ga0070665_1001439993 183
307 3300005563 Ga0068855_100226718 Ga0068855_1002267182 183
308 3300005614 Ga0068856_100214340 Ga0068856_1002143401 183
309 3300005616 Ga0068852_100190874 Ga0068852_1001908743 183
310 3300009093 Ga0105240_10000027 Ga0105240_1000002754 183
311 3300009551 Ga0105238_10698323 Ga0105238_106983232 183
312 3300013104 Ga0157370_10000048 Ga0157370_1000004835 183
313 3300013105 Ga0157369_10110669 Ga0157369_101106692 183
314 3300015262 Ga0182007_10023024 Ga0182007_100230242 183
315 3300015265 Ga0182005_1006318 Ga0182005_10063182 183
316 3300025206 Ga0209435_100011 Ga0209435_100011169 183
317 3300025207 Ga0209760_106126 Ga0209760_1061262 183
318 3300025228 Ga0209672_104893 Ga0209672_1048932 183
319 3300025233 Ga0209437_100036 Ga0209437_100036180 183
320 3300025233 Ga0209437_100086 Ga0209437_10008668 183
321 3300025246 Ga0209646_1000024 Ga0209646_1000024242 183
322 3300025246 Ga0209646_1019449 Ga0209646_10194491 183
323 3300025250 Ga0209026_1000030 Ga0209026_1000030242 183
324 3300025253 Ga0209677_100177 Ga0209677_1001775 183
325 3300025256 Ga0209759_1000011 Ga0209759_1000011169 183
326 3300025261 Ga0209233_1000056 Ga0209233_1000056412 183
327 3300025261 Ga0209233_1000110 Ga0209233_1000110180 183
328 3300025261 Ga0209233_1000298 Ga0209233_100029842 183
329 3300025913 Ga0207695_10000024 Ga0207695_10000024576 183
330 3300026078 Ga0207702_10178165 Ga0207702_101781651 183
331 3300027312 Ga0209371_1006088 Ga0209371_10060882 183
332 3300028379 Ga0268266_10113919 Ga0268266_101139192 183
333 3300030500 Ga0268256_1003713 Ga0268256_10037133 183
334 3300031995 Ga0307409_100029175 Ga0307409_1000291753 183
335 3300041512 Ga0451853_3417319 Ga0451853_3417319_1417_2085 183
336 3300044684 Ga0466966_0066942 Ga0466966_0066942_1191_1757 183
337 3300044694 Ga0466963_0107370 Ga0466963_0107370_306_872 183
338 3300044719 Ga0466971_0199158 Ga0466971_0199158_139_705 183
339 3300044765 Ga0466970_0071249 Ga0466970_0071249_462_1028 183
340 3300044842 Ga0466957_0115876 Ga0466957_0115876_905_1471 183
341 3300045049 Ga0466959_0295275 Ga0466959_0295275_376_942 183
342 3300045976 Ga0466967_0801841 Ga0466967_0801841_295_861 183
343 3300048903 Ga0496100_0066607 Ga0496100_0066607_388_954 183
344 3300048904 Ga0496101_0103920 Ga0496101_0103920_335_901 183
345 3300048906 Ga0496103_0055755 Ga0496103_0055755_1430_1996 183
346 3300048907 Ga0496104_0106292 Ga0496104_0106292_516_1160 183
347 3300048915 Ga0496112_0144281 Ga0496112_0144281_28_672 183
348 3300048916 Ga0496113_0085268 Ga0496113_0085268_320_886 183
349 3300048920 Ga0496117_0001662 Ga0496117_0001662_671_1237 183
350 3300048921 Ga0496118_0103432 Ga0496118_0103432_295_861 183
351 3300048922 Ga0496119_0055042 Ga0496119_0055042_1447_2013 183
352 3300048922 Ga0496119_0055292 Ga0496119_0055292_569_1135 183
353 3300048923 Ga0496120_0065920 Ga0496120_0065920_1114_1680 183
354 3300048925 Ga0496122_0055858 Ga0496122_0055858_587_1153 183
355 3300048925 Ga0496122_0060214 Ga0496122_0060214_575_1141 183
356 3300048926 Ga0496123_0056446 Ga0496123_0056446_336_902 183
357 3300048926 Ga0496123_0058320 Ga0496123_0058320_1598_2164 183
358 3300048927 Ga0496124_0113512 Ga0496124_0113512_283_849 183
359 3300048928 Ga0496125_0092534 Ga0496125_0092534_1276_1842 183
360 3300048929 Ga0496126_0075627 Ga0496126_0075627_2266_2832 183
361 3300053119 Ga0500595_014681 Ga0500595_014681_1441_2016 183
362 3300053177 Ga0500636_0263059 Ga0500636_0263059_249_815 183
363 3300061719 Ga0466962_0211478 Ga0466962_0211478_73_639 183
364 iso_pu_bacteria 2585427527 2585536467 183
365 iso_pu_bacteria 2615840626 2616306172 183
366 iso_pu_bacteria 2617270742 2617382622 183
367 iso_pu_bacteria 2919408235 2919408953 183

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03473

MOSC

MOSC domain

83

213

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5yhh-assembly1.cif.gz_A crystal structure of yiim from geobacillus stearothermophilus 0.7849 6 171
1oru-assembly1.cif.gz_B crystal structure of apc1665, yuad protein from bacillus subtilis 0.7776 6 174
1o67-assembly3.cif.gz_C crystal structure of an hypothetical protein 0.7597 5 170
1o65-assembly1.cif.gz_A crystal structure of an hypothetical protein 0.752 5 170
6su2-assembly2.cif.gz_B-2 trypanosoma congolense pyruvate kinase in complex with citrate and glycerol 0.7506 99 177
ID Description Score Start End Superfamily
1oruB00 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.7802 5 174 2.40.33.20
1oruB00 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.7516 5 174 2.40.33.20
5yhiA00 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.7461 8 178 2.40.33.20
af_P9WKE5_72_166_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.7267 62 170 3.20.20.60
af_P95151_15_247_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.7104 1 179 2.40.33.20
ID Description Score Start End GO Terms
AF-S6GHE1-F1-model_v4 MOSC domain-containing protein 0.9962 66 183 GO:0003824
GO:0030151
GO:0030170
AF-A0A0H2ZHY3-F1-model_v4 MOSC domain-containing protein 0.9899 86 183 GO:0003824
GO:0030151
GO:0030170
AF-A0A0N8PRT0-F1-model_v4 Molybdenum cofactor biosysynthesis protein 0.9895 101 183 GO:0003824
GO:0030151
GO:0030170
AF-S6GHE1-F1-model_v4 MOSC domain-containing protein 0.9878 66 183 GO:0003824
GO:0030151
GO:0030170
AF-A0A7W0KTA4-F1-model_v4 MOSC domain-containing protein 0.9821 94 183 GO:0003824
GO:0030151
GO:0030170

Feature Viewer

pLDDT pTM Quality
90.82 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map