F424548

General Info

Members Datasets Scaffolds Average Seq Length
367 207 347 243

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2919692658|2919693793
Length 259
Sequence FFPFLVFLPYYCPFKDRILMAVVPYKDKQDSKKDQVAEMFNNISGKYDLLNHVLSMGIDITWRKKAIKYLKDDQPKLILDIATGTGDFAIEALSLNPDKIIGVDISEGMLEEGRKKIKKKGLEDKIELQLGDSEGLLFEDNKFDAVIVSFGVRNFENLEKGLADMYRVLKPGGKAVILEFSKPRKAPMKQAYAFYSKAILPQIGKIVSKDNSAYTYLPESVQAFPDGMDFLRIMNKVGFTSNLCKPLTFGISSIYVGTK

Samples

Sample ID Description Type Environment
1 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
2 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
3 2738541283 Pedobacter sp. OK701 Isolate Unclassified
4 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
5 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
6 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
7 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
8 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
9 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
10 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
11 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
12 2914759650 Rhizosphaericola mali Isolate Rhizosphere
13 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
14 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
15 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
16 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
17 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
18 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
19 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
20 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
21 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
22 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
23 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
24 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
25 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
26 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
27 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
28 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
29 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
30 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
31 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
32 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
33 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
36 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
37 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
83 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
84 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
85 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
86 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
87 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
88 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
89 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
90 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
94 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
124 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
125 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
126 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
127 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
128 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
129 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
130 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
131 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
132 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
135 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
136 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
144 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
145 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
146 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
153 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
154 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
155 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
156 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
157 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
158 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
162 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
163 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
164 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
165 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
166 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
167 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
168 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
169 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
170 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
171 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
172 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
173 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
174 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
175 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
176 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
179 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
180 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
181 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
182 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
183 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
184 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
185 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
186 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
187 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
188 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
189 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
190 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
191 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
192 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
193 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
194 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
195 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
196 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
197 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
198 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
199 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
200 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
201 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
202 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
203 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
204 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
205 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
206 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
207 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.55
Metatranscriptomes 0
Isolates 5.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.17
Nodule 0
Rhizoplane 0.54
Rhizosphere 79.02
Stem 0
Stem Tuber 0
Unclassified 9.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10039045 3300001979 Bacteria 1451
2 JGI24737J22298_10000394 3300001990 Bacteria 14876
3 JGI24737J22298_10002419 3300001990 Bacteria 6651
4 JGI24737J22298_10016131 3300001990 Bacteria 2412
5 JGI24737J22298_10022718 3300001990 Bacteria 1993
6 JGI24735J21928_10000013 3300002067 Bacteria 208663
7 JGI24744J21845_10004442 3300002077 Bacteria 2899
8 JGI25162J39368_1001539 3300002737 Bacteria 11872
9 JGI25152J39213_1000195 3300002773 Bacteria 40804
10 JGI25150J39212_1000014 3300002774 Bacteria 170955
11 JGI25151J46595_10000042 3300003187 Bacteria 170955
12 JGI25165J46597_1000157 3300003214 Bacteria 108987
13 JGI25153J46596_10000009 3300003215 Bacteria 340925
14 rootH2_10005336 3300003320 Bacteria 90063
15 rootH2_10089486 3300003320 Bacteria 11519
16 rootH2_10213351 3300003320 Bacteria 4516
17 rootL2_10024700 3300003322 Bacteria 24236
18 rootL2_10079709 3300003322 Bacteria 6049
19 rootL2_10124599 3300003322 Bacteria 2612
20 rootL2_10198431 3300003322 Unclassified 1034
21 rootH1_10008723 3300003323 Bacteria 23403
22 rootH1_10045017 3300003323 Bacteria 20986
23 Ga0055531_10000148 3300003794 Bacteria 80963
24 Ga0065165_1000538 3300005262 Bacteria 57448
25 Ga0065704_10233780 3300005289 Bacteria 1035
26 Ga0070658_10000028 3300005327 Bacteria 157278
27 Ga0070658_10016538 3300005327 Bacteria 5903
28 Ga0070658_10202170 3300005327 Bacteria 1677
29 Ga0070658_10335652 3300005327 Bacteria 1292
30 Ga0070676_10005673 3300005328 Bacteria 6646
31 Ga0068868_100016528 3300005338 Bacteria 5483
32 Ga0070660_100008501 3300005339 Bacteria 7183
33 Ga0070660_100091625 3300005339 Bacteria 2398
34 Ga0070660_100438031 3300005339 Bacteria 1083
35 Ga0070671_100040707 3300005355 Bacteria 3861
36 Ga0070673_100193355 3300005364 Bacteria 1749
37 Ga0070659_100000648 3300005366 Bacteria 25427
38 Ga0070659_100005000 3300005366 Bacteria 9499
39 Ga0070678_100036410 3300005456 Bacteria 3445
40 Ga0070662_100000014 3300005457 Bacteria 110124
41 Ga0070681_10026227 3300005458 Bacteria 5858
42 Ga0068867_100016823 3300005459 Bacteria 5197
43 Ga0068867_100657169 3300005459 Bacteria 920
44 Ga0070679_100015562 3300005530 Bacteria 7309
45 Ga0068853_100040113 3300005539 Bacteria 3993
46 Ga0070665_100000032 3300005548 Bacteria 333352
47 Ga0068855_100000517 3300005563 Bacteria 47550
48 Ga0068855_100037770 3300005563 Bacteria 5741
49 Ga0068855_100504414 3300005563 Bacteria 1314
50 Ga0068857_100022072 3300005577 Bacteria 5600
51 Ga0068856_100001612 3300005614 Bacteria 23598
52 Ga0068856_100050674 3300005614 Bacteria 4093
53 Ga0068856_100069286 3300005614 Bacteria 3488
54 Ga0068852_100230177 3300005616 Bacteria 1766
55 Ga0068852_100243406 3300005616 Bacteria 1720
56 Ga0068852_100389345 3300005616 Bacteria 1369
57 Ga0068864_100249362 3300005618 Bacteria 1648
58 Ga0068870_10241178 3300005840 Bacteria 1116
59 Ga0068863_100034942 3300005841 Bacteria 4788
60 Ga0068858_100114338 3300005842 Bacteria 2521
61 Ga0075366_10001635 3300006195 Bacteria 11237
62 Ga0075366_10001801 3300006195 Bacteria 10831
63 Ga0075366_10013846 3300006195 Bacteria 4597
64 Ga0097621_100046671 3300006237 Bacteria 3506
65 Ga0097621_100246907 3300006237 Unclassified 1562
66 Ga0075370_10110569 3300006353 Bacteria 1596
67 Ga0075370_10137111 3300006353 Bacteria 1430
68 Ga0068871_100000294 3300006358 Bacteria 34890
69 Ga0068865_100002711 3300006881 Bacteria 10509
70 Ga0105240_10000103 3300009093 Bacteria 172981
71 Ga0105240_10018800 3300009093 Bacteria 9258
72 Ga0105240_10071487 3300009093 Bacteria 4291
73 Ga0105240_10139990 3300009093 Bacteria 2894
74 Ga0105240_10153434 3300009093 Bacteria 2741
75 Ga0105240_10413863 3300009093 Bacteria 1516
76 Ga0105245_10252602 3300009098 Bacteria 1713
77 Ga0105245_10759930 3300009098 Bacteria 1006
78 Ga0105241_10002362 3300009174 Bacteria 14177
79 Ga0105241_10045892 3300009174 Bacteria 3316
80 Ga0105237_10003264 3300009545 Bacteria 19375
81 Ga0105237_10005389 3300009545 Bacteria 14455
82 Ga0105237_10011343 3300009545 Bacteria 9430
83 Ga0105237_10014149 3300009545 Bacteria 8352
84 Ga0105237_10019103 3300009545 Bacteria 7083
85 Ga0105237_10027910 3300009545 Bacteria 5753
86 Ga0105237_10101567 3300009545 Bacteria 2868
87 Ga0105237_10216460 3300009545 Bacteria 1915
88 Ga0105237_10370132 3300009545 Bacteria 1438
89 Ga0105237_10427122 3300009545 Bacteria 1331
90 Ga0105237_10763182 3300009545 Bacteria 974
91 Ga0105237_10853535 3300009545 Bacteria 917
92 Ga0105238_10042180 3300009551 Bacteria 4621
93 Ga0105238_10143074 3300009551 Bacteria 2368
94 Ga0105238_10244312 3300009551 Bacteria 1773
95 Ga0105249_10119283 3300009553 Bacteria 2505
96 Ga0105239_10000001 3300010375 Bacteria 617353
97 Ga0105239_10000007 3300010375 Bacteria 385297
98 Ga0105239_10000212 3300010375 Bacteria 85747
99 Ga0105239_10000352 3300010375 Bacteria 67522
100 Ga0105239_10019518 3300010375 Bacteria 7483
101 Ga0105239_10068278 3300010375 Bacteria 3906
102 Ga0105239_10165968 3300010375 Bacteria 2469
103 Ga0105239_10230671 3300010375 Bacteria 2077
104 Ga0105239_10531440 3300010375 Bacteria 1338
105 Ga0105239_10603769 3300010375 Bacteria 1252
106 Ga0105246_10039273 3300011119 Bacteria 3188
107 Ga0157373_10000245 3300013100 Bacteria 44563
108 Ga0157373_10003820 3300013100 Bacteria 11390
109 Ga0157371_10002946 3300013102 Bacteria 15852
110 Ga0157371_10005024 3300013102 Bacteria 11332
111 Ga0157371_10063427 3300013102 Bacteria 2619
112 Ga0157371_10069066 3300013102 Bacteria 2502
113 Ga0157371_10084142 3300013102 Bacteria 2253
114 Ga0157370_10000197 3300013104 Bacteria 75846
115 Ga0157370_10055865 3300013104 Bacteria 3759
116 Ga0157370_10193224 3300013104 Bacteria 1889
117 Ga0157369_10014221 3300013105 Bacteria 8990
118 Ga0157369_10422700 3300013105 Bacteria 1381
119 Ga0157374_10008347 3300013296 Bacteria 8843
120 Ga0157374_10033177 3300013296 Bacteria 4709
121 Ga0157378_10196034 3300013297 Bacteria 1908
122 Ga0163162_10000010 3300013306 Bacteria 302032
123 Ga0163162_10021091 3300013306 Bacteria 6409
124 Ga0163162_10368861 3300013306 Bacteria 1569
125 Ga0157372_10000073 3300013307 Bacteria 107356
126 Ga0157372_10000173 3300013307 Bacteria 71416
127 Ga0157372_10002062 3300013307 Bacteria 21839
128 Ga0157372_10008613 3300013307 Bacteria 10839
129 Ga0157372_10046656 3300013307 Bacteria 4810
130 Ga0157372_10122005 3300013307 Bacteria 2994
131 Ga0157375_10006292 3300013308 Bacteria 10341
132 Ga0157375_10051408 3300013308 Bacteria 4047
133 Ga0182008_10000082 3300014497 Bacteria 74716
134 Ga0157376_10090194 3300014969 Bacteria 2652
135 Ga0182006_1000373 3300015261 Bacteria 37119
136 Ga0213872_10006185 3300021361 Bacteria 6044
137 Ga0207427_100025 3300025231 Bacteria 433726
138 Ga0209437_100010 3300025233 Bacteria 838447
139 Ga0209437_100148 3300025233 Bacteria 158795
140 Ga0207425_1000023 3300025245 Bacteria 341339
141 Ga0209026_1000498 3300025250 Bacteria 28577
142 Ga0209129_1000032 3300025258 Bacteria 341150
143 Ga0209233_1000017 3300025261 Bacteria 898076
144 Ga0209233_1001847 3300025261 Bacteria 8130
145 Ga0209455_1000682 3300025272 Bacteria 20151
146 Ga0209676_1002019 3300025292 Bacteria 15961
147 Ga0209025_1000047 3300025294 Bacteria 341150
148 Ga0209758_1000145 3300025297 Bacteria 170553
149 Ga0209257_1000006 3300025304 Bacteria 1570111
150 Ga0207647_10000680 3300025904 Bacteria 26722
151 Ga0207647_10002110 3300025904 Bacteria 15216
152 Ga0207645_10006511 3300025907 Bacteria 8370
153 Ga0207705_10000045 3300025909 Bacteria 180625
154 Ga0207705_10028199 3300025909 Bacteria 4003
155 Ga0207705_10552943 3300025909 Bacteria 895
156 Ga0207654_10001057 3300025911 Bacteria 14992
157 Ga0207654_10036105 3300025911 Bacteria 2759
158 Ga0207654_10069705 3300025911 Bacteria 2085
159 Ga0207707_10002289 3300025912 Bacteria 17267
160 Ga0207695_10000019 3300025913 Bacteria 732137
161 Ga0207695_10040697 3300025913 Bacteria 4980
162 Ga0207695_10284278 3300025913 Bacteria 1547
163 Ga0207671_10002404 3300025914 Bacteria 20077
164 Ga0207671_10007651 3300025914 Bacteria 9333
165 Ga0207671_10008745 3300025914 Bacteria 8532
166 Ga0207671_10012034 3300025914 Bacteria 6989
167 Ga0207671_10013091 3300025914 Bacteria 6628
168 Ga0207671_10013851 3300025914 Bacteria 6404
169 Ga0207671_10027870 3300025914 Bacteria 4222
170 Ga0207671_10217190 3300025914 Bacteria 1497
171 Ga0207671_10255836 3300025914 Bacteria 1377
172 Ga0207660_10056787 3300025917 Bacteria 2802
173 Ga0207657_10009277 3300025919 Bacteria 9911
174 Ga0207657_10100692 3300025919 Bacteria 2398
175 Ga0207657_10614123 3300025919 Bacteria 848
176 Ga0207652_10055108 3300025921 Bacteria 3419
177 Ga0207694_10103694 3300025924 Bacteria 2256
178 Ga0207694_10113222 3300025924 Bacteria 2160
179 Ga0207694_10355385 3300025924 Bacteria 1213
180 Ga0207644_10036049 3300025931 Bacteria 3470
181 Ga0207690_10000766 3300025932 Bacteria 20779
182 Ga0207706_10000057 3300025933 Bacteria 112805
183 Ga0207704_10000266 3300025938 Bacteria 25142
184 Ga0207667_10000015 3300025949 Bacteria 417534
185 Ga0207667_10000644 3300025949 Bacteria 45263
186 Ga0207667_10030806 3300025949 Bacteria 5798
187 Ga0207667_10246904 3300025949 Bacteria 1826
188 Ga0207651_10130262 3300025960 Bacteria 1924
189 Ga0207651_10373475 3300025960 Bacteria 1207
190 Ga0207712_10088408 3300025961 Bacteria 2275
191 Ga0207677_10007663 3300026023 Bacteria 5992
192 Ga0207639_10015980 3300026041 Bacteria 5301
193 Ga0207678_10033710 3300026067 Bacteria 4460
194 Ga0207702_10000165 3300026078 Bacteria 79066
195 Ga0207702_10050819 3300026078 Bacteria 3500
196 Ga0207648_10003208 3300026089 Bacteria 17220
197 Ga0207674_10031003 3300026116 Bacteria 5619
198 Ga0207674_10335647 3300026116 Bacteria 1461
199 Ga0207674_10645153 3300026116 Bacteria 1022
200 Ga0207683_10182140 3300026121 Bacteria 1905
201 Ga0207698_10006479 3300026142 Bacteria 7308
202 Ga0207698_10362708 3300026142 Bacteria 1373
203 Ga0268266_10000030 3300028379 Bacteria 417120
204 Ga0268265_10181156 3300028380 Bacteria 1810
205 Ga0265334_10052406 3300028573 Bacteria 1561
206 Ga0265323_10001165 3300028653 Bacteria 13437
207 Ga0265323_10019362 3300028653 Bacteria 2625
208 Ga0307517_10022273 3300028786 Bacteria 7945
209 Ga0307515_10000009 3300028794 Bacteria 653206
210 Ga0307515_10000376 3300028794 Bacteria 109190
211 Ga0307515_10005206 3300028794 Bacteria 26435
212 Ga0307515_10106775 3300028794 Bacteria 3317
213 Ga0307515_10196946 3300028794 Bacteria 1903
214 Ga0265338_10001009 3300028800 Bacteria 47355
215 Ga0265338_10031931 3300028800 Bacteria 5151
216 Ga0316182_1142397 3300030745 Bacteria 1594
217 Ga0265327_10039336 3300031251 Unclassified 2570
218 Ga0265327_10040150 3300031251 Bacteria 2534
219 Ga0265316_10000823 3300031344 Bacteria 34334
220 Ga0265316_10016485 3300031344 Bacteria 6406
221 Ga0307513_10200527 3300031456 Bacteria 1837
222 Ga0307509_10072388 3300031507 Bacteria 3591
223 Ga0307509_10123009 3300031507 Bacteria 2568
224 Ga0307509_10152427 3300031507 Bacteria 2224
225 Ga0307408_100038876 3300031548 Bacteria 3359
226 Ga0307514_10119857 3300031649 Bacteria 1839
227 Ga0316576_10100868 3300031727 Bacteria 2158
228 Ga0316576_10179948 3300031727 Bacteria 1595
229 Ga0307405_10008272 3300031731 Bacteria 5263
230 Ga0307405_10096392 3300031731 Unclassified 1972
231 Ga0307405_10100153 3300031731 Bacteria 1941
232 Ga0307407_10029615 3300031903 Bacteria 2944
233 Ga0307412_10005130 3300031911 Bacteria 7335
234 Ga0307412_10162627 3300031911 Bacteria 1660
235 Ga0307409_100067017 3300031995 Unclassified 2833
236 Ga0307409_100308961 3300031995 Bacteria 1475
237 Ga0307416_100000246 3300032002 Bacteria 28754
238 Ga0307414_10002529 3300032004 Bacteria 9597
239 Ga0307414_10671615 3300032004 Bacteria 936
240 Ga0307415_100005846 3300032126 Bacteria 6577
241 Ga0307507_10003702 3300033179 Bacteria 28885
242 Ga0307510_10000464 3300033180 Bacteria 39482
243 Ga0307510_10269363 3300033180 Bacteria 1180
244 Ga0373927_0193355 3300035695 Bacteria 1335
245 Ga0316584_0265782 3300036712 Unclassified 1250
246 Ga0395899_0000001 3300037312 Bacteria 1750322
247 Ga0395899_0000887 3300037312 Bacteria 28407
248 Ga0395899_0007044 3300037312 Bacteria 8701
249 Ga0395900_0000143 3300037418 Bacteria 120234
250 Ga0395900_0003189 3300037418 Bacteria 17771
251 Ga0395898_0004789 3300037466 Bacteria 14725
252 Ga0395905_0000175 3300037471 Bacteria 104024
253 Ga0395905_0000981 3300037471 Bacteria 36581
254 Ga0395901_0000313 3300038443 Bacteria 59766
255 Ga0395901_0009480 3300038443 Bacteria 9877
256 Ga0395901_0183628 3300038443 Bacteria 2194
257 Ga0436361_1115729 3300039447 Bacteria 13860
258 Ga0451793_1603413 3300041452 Bacteria 839
259 Ga0451837_0393660 3300041494 Bacteria 1669
260 Ga0439448_0003549 3300042005 Bacteria 4331
261 Ga0451577_0001418 3300042876 Bacteria 31975
262 Ga0451577_0050012 3300042876 Bacteria 3731
263 Ga0466961_0150657 3300044693 Unclassified 1452
264 Ga0466964_0045744 3300044706 Bacteria 1782
265 Ga0453684_0003071 3300044712 Bacteria 38643
266 Ga0453684_0006110 3300044712 Bacteria 23208
267 Ga0453684_0021401 3300044712 Bacteria 9663
268 Ga0453684_0060222 3300044712 Unclassified 4886
269 Ga0453684_0094939 3300044712 Bacteria 3667
270 Ga0451576_0000022 3300045051 Bacteria 495037
271 Ga0451576_0013689 3300045051 Bacteria 9061
272 Ga0451576_0033577 3300045051 Bacteria 5454
273 Ga0451576_0298134 3300045051 Unclassified 1685
274 Ga0466958_0025254 3300045836 Bacteria 3502
275 Ga0495651_0035117 3300046462 Bacteria 3905
276 Ga0495653_0389884 3300046463 Bacteria 888
277 Ga0495650_0000162 3300046471 Bacteria 148927
278 Ga0495650_0083162 3300046471 Bacteria 1231
279 Ga0495605_0132527 3300046474 Bacteria 1123
280 Ga0495585_0000153 3300046492 Bacteria 74267
281 Ga0495585_0000240 3300046492 Bacteria 56802
282 Ga0495606_0000033 3300046507 Bacteria 247739
283 Ga0495606_0013056 3300046507 Bacteria 6599
284 Ga0495606_0016861 3300046507 Bacteria 5548
285 Ga0495606_0019127 3300046507 Bacteria 5107
286 Ga0495610_0003961 3300046512 Bacteria 11206
287 Ga0495616_0003449 3300046513 Bacteria 10118
288 Ga0495616_0006594 3300046513 Bacteria 7014
289 Ga0495628_0290922 3300046516 Bacteria 1211
290 Ga0495630_0209234 3300046517 Bacteria 1489
291 Ga0495631_0014505 3300046518 Bacteria 3803
292 Ga0495648_0003060 3300046524 Bacteria 14948
293 Ga0495586_0145713 3300046535 Unclassified 1331
294 Ga0495609_0006455 3300046538 Bacteria 5981
295 Ga0495609_0024263 3300046538 Bacteria 2783
296 Ga0495633_0000389 3300046558 Bacteria 46261
297 Ga0495633_0003181 3300046558 Bacteria 11095
298 Ga0495668_0000009 3300046616 Bacteria 492623
299 Ga0495625_0000131 3300046660 Bacteria 117738
300 Ga0495625_0000951 3300046660 Bacteria 38714
301 Ga0495625_0001562 3300046660 Bacteria 27264
302 Ga0495625_0021497 3300046660 Bacteria 4969
303 Ga0495625_0082227 3300046660 Bacteria 2240
304 Ga0495625_0103961 3300046660 Bacteria 1947
305 Ga0495625_0218452 3300046660 Bacteria 1250
306 Ga0495635_0404120 3300046663 Bacteria 907
307 Ga0495661_0008464 3300046665 Bacteria 7111
308 Ga0495661_0018305 3300046665 Bacteria 4609
309 Ga0495669_0199724 3300046684 Bacteria 955
310 Ga0495649_0000009 3300046694 Bacteria 451725
311 Ga0495649_0120644 3300046694 Bacteria 1387
312 Ga0495600_0263734 3300046809 Bacteria 1094
313 Ga0495660_0022410 3300046810 Bacteria 3607
314 Ga0495683_0162832 3300047323 Bacteria 1030
315 Ga0495687_001889 3300047443 Bacteria 18066
316 Ga0495687_004330 3300047443 Bacteria 9657
317 Ga0495686_0000843 3300047472 Bacteria 39372
318 Ga0495686_0000973 3300047472 Bacteria 35208
319 Ga0495686_0015477 3300047472 Bacteria 5206
320 Ga0495686_0032769 3300047472 Bacteria 3361
321 Ga0495686_0067062 3300047472 Bacteria 2216
322 Ga0495686_0190885 3300047472 Bacteria 1181
323 Ga0496122_0000869 3300048925 Bacteria 56890
324 Ga0496123_0004125 3300048926 Bacteria 15552
325 Ga0496125_0100755 3300048928 Bacteria 2128
326 Ga0501300_006489 3300049523 Bacteria 1721
327 Ga0501069_0170677 3300049585 Bacteria 1255
328 Ga0501202_008364 3300049652 Unclassified 1885
329 Ga0501223_002267 3300049663 Bacteria 4301
330 Ga0501253_007463 3300049683 Bacteria 1529
331 Ga0501257_001380 3300049686 Bacteria 5011
332 nmdc:mga0k408_293447_c1 3300050493 Bacteria 970
333 nmdc:mga0k408_320_c1 3300050493 Bacteria 26097
334 nmdc:mga0k408_7999_c1 3300050493 Bacteria 5668
335 nmdc:mga0k408_803_c1 3300050493 Bacteria 17292
336 Ga0500635_0022075 3300053080 Bacteria 1969
337 Ga0500562_048729 3300053108 Unclassified 1132
338 Ga0500608_139927 3300053122 Bacteria 1074
339 Ga0500618_000012 3300053125 Bacteria 185382
340 Ga0500618_019770 3300053125 Bacteria 1655
341 Ga0500655_002073 3300053133 Bacteria 3728
342 Ga0500616_0065243 3300053153 Bacteria 1873
343 Ga0500622_0000163 3300053156 Bacteria 70679
344 Ga0500622_0000838 3300053156 Bacteria 26284
345 Ga0500622_0002779 3300053156 Bacteria 12301
346 Ga0500624_000118 3300053157 Bacteria 35980
347 Ga0500627_0181126 3300053158 Unclassified 948

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031727 Ga0316576_10100868 Ga0316576_101008683 213
2 3300003320 rootH2_10213351 rootH2_102133514 216
3 3300003322 rootL2_10124599 rootL2_101245992 216
4 3300003794 Ga0055531_10000148 Ga0055531_1000014841 216
5 3300025304 Ga0209257_1000006 Ga0209257_10000061253 216
6 3300028653 Ga0265323_10001165 Ga0265323_100011653 221
7 3300031344 Ga0265316_10000823 Ga0265316_1000082325 221
8 3300031507 Ga0307509_10072388 Ga0307509_100723884 221
9 3300028573 Ga0265334_10052406 Ga0265334_100524062 222
10 3300035695 Ga0373927_0193355 Ga0373927_0193355_146_841 231
11 iso_pu_bacteria 2522125168 2522549097 236
12 iso_pu_bacteria 2884634485 2884637523 236
13 iso_pu_bacteria 2910245624 2910247101 236
14 3300005614 Ga0068856_100050674 Ga0068856_1000506743 239
15 3300028794 Ga0307515_10000009 Ga0307515_10000009520 239
16 3300031251 Ga0265327_10039336 Ga0265327_100393361 239
17 3300031548 Ga0307408_100038876 Ga0307408_1000388763 239
18 3300031649 Ga0307514_10119857 Ga0307514_101198572 239
19 3300049523 Ga0501300_006489 Ga0501300_006489_26_745 239
20 3300049683 Ga0501253_007463 Ga0501253_007463_341_1060 239
21 3300049686 Ga0501257_001380 Ga0501257_001380_2273_2992 239
22 iso_pu_bacteria 2599185184 2599480401 239
23 iso_pu_bacteria 2738541283 2738755421 239
24 iso_pu_bacteria 2852623160 2852624822 239
25 iso_pu_bacteria 2884933994 2884936296 239
26 iso_pu_bacteria 2919437846 2919438295 239
27 iso_pu_bacteria 2928078545 2928083358 239
28 iso_pu_bacteria 2928147474 2928151380 239
29 iso_pu_bacteria 2932082852 2932087297 239
30 3300003322 rootL2_10024700 rootL2_100247009 240
31 3300003322 rootL2_10198431 rootL2_101984312 240
32 3300003323 rootH1_10008723 rootH1_1000872320 240
33 3300005262 Ga0065165_1000538 Ga0065165_10005383 240
34 3300005289 Ga0065704_10233780 Ga0065704_102337801 240
35 3300005459 Ga0068867_100657169 Ga0068867_1006571692 240
36 3300005841 Ga0068863_100034942 Ga0068863_1000349425 240
37 3300006237 Ga0097621_100246907 Ga0097621_1002469072 240
38 3300013104 Ga0157370_10193224 Ga0157370_101932242 240
39 3300025292 Ga0209676_1002019 Ga0209676_10020193 240
40 3300028794 Ga0307515_10106775 Ga0307515_101067752 240
41 3300028794 Ga0307515_10196946 Ga0307515_101969463 240
42 3300031251 Ga0265327_10040150 Ga0265327_100401502 240
43 3300031507 Ga0307509_10152427 Ga0307509_101524273 240
44 3300031727 Ga0316576_10179948 Ga0316576_101799482 240
45 3300031731 Ga0307405_10008272 Ga0307405_100082724 240
46 3300031731 Ga0307405_10096392 Ga0307405_100963922 240
47 3300031903 Ga0307407_10029615 Ga0307407_100296154 240
48 3300031911 Ga0307412_10005130 Ga0307412_100051305 240
49 3300031995 Ga0307409_100067017 Ga0307409_1000670172 240
50 3300031995 Ga0307409_100308961 Ga0307409_1003089612 240
51 3300032002 Ga0307416_100000246 Ga0307416_10000024625 240
52 3300032004 Ga0307414_10002529 Ga0307414_100025296 240
53 3300032126 Ga0307415_100005846 Ga0307415_1000058466 240
54 3300036712 Ga0316584_0265782 Ga0316584_0265782_70_792 240
55 3300038443 Ga0395901_0183628 Ga0395901_0183628_127_849 240
56 3300041494 Ga0451837_0393660 Ga0451837_0393660_264_986 240
57 3300042876 Ga0451577_0001418 Ga0451577_0001418_11969_12691 240
58 3300044706 Ga0466964_0045744 Ga0466964_0045744_288_1010 240
59 3300044712 Ga0453684_0003071 Ga0453684_0003071_6180_6902 240
60 3300044712 Ga0453684_0060222 Ga0453684_0060222_4148_4876 240
61 3300044712 Ga0453684_0094939 Ga0453684_0094939_1115_1837 240
62 3300045051 Ga0451576_0013689 Ga0451576_0013689_291_1013 240
63 3300045051 Ga0451576_0298134 Ga0451576_0298134_278_1003 240
64 3300046517 Ga0495630_0209234 Ga0495630_0209234_460_1182 240
65 3300046535 Ga0495586_0145713 Ga0495586_0145713_363_1085 240
66 3300049652 Ga0501202_008364 Ga0501202_008364_836_1558 240
67 3300053108 Ga0500562_048729 Ga0500562_048729_107_829 240
68 3300053133 Ga0500655_002073 Ga0500655_002073_894_1616 240
69 3300053156 Ga0500622_0000163 Ga0500622_0000163_63092_63814 240
70 3300053156 Ga0500622_0002779 Ga0500622_0002779_6885_7607 240
71 3300053158 Ga0500627_0181126 Ga0500627_0181126_162_884 240
72 3300005618 Ga0068864_100249362 Ga0068864_1002493622 241
73 3300013102 Ga0157371_10084142 Ga0157371_100841425 241
74 3300028380 Ga0268265_10181156 Ga0268265_101811561 241
75 3300028653 Ga0265323_10019362 Ga0265323_100193622 241
76 3300028800 Ga0265338_10001009 Ga0265338_1000100930 241
77 3300031344 Ga0265316_10016485 Ga0265316_100164852 241
78 3300045051 Ga0451576_0000022 Ga0451576_0000022_43197_43922 241
79 3300049585 Ga0501069_0170677 Ga0501069_0170677_127_852 241
80 iso_pu_bacteria 8055588893 8055591766 241
81 3300003320 rootH2_10089486 rootH2_1008948612 242
82 3300009093 Ga0105240_10000103 Ga0105240_1000010395 242
83 3300009545 Ga0105237_10027910 Ga0105237_100279107 242
84 3300009545 Ga0105237_10853535 Ga0105237_108535351 242
85 3300009551 Ga0105238_10143074 Ga0105238_101430742 242
86 3300009551 Ga0105238_10244312 Ga0105238_102443124 242
87 3300010375 Ga0105239_10019518 Ga0105239_100195187 242
88 3300013102 Ga0157371_10069066 Ga0157371_100690663 242
89 3300013306 Ga0163162_10368861 Ga0163162_103688612 242
90 3300013307 Ga0157372_10008613 Ga0157372_1000861310 242
91 3300025913 Ga0207695_10000019 Ga0207695_10000019492 242
92 3300025914 Ga0207671_10007651 Ga0207671_100076519 242
93 3300025924 Ga0207694_10103694 Ga0207694_101036943 242
94 3300025924 Ga0207694_10113222 Ga0207694_101132223 242
95 3300037312 Ga0395899_0000001 Ga0395899_0000001_658342_659070 242
96 3300042876 Ga0451577_0050012 Ga0451577_0050012_1098_1826 242
97 3300044712 Ga0453684_0006110 Ga0453684_0006110_13256_13984 242
98 3300044712 Ga0453684_0021401 Ga0453684_0021401_217_954 242
99 3300045051 Ga0451576_0033577 Ga0451576_0033577_2452_3213 242
100 3300047472 Ga0495686_0190885 Ga0495686_0190885_356_1084 242
101 iso_pu_bacteria 2890737413 2890738692 242
102 iso_pu_bacteria 2896317667 2896320029 242
103 iso_pu_bacteria 2896344016 2896345627 242
104 iso_pu_bacteria 2898713307 2898715754 242
105 iso_pu_bacteria 2914759650 2914760394 242
106 iso_pu_bacteria 2919692658 2919693793 242
107 3300001979 JGI24740J21852_10039045 JGI24740J21852_100390452 243
108 3300001990 JGI24737J22298_10000394 JGI24737J22298_100003945 243
109 3300001990 JGI24737J22298_10002419 JGI24737J22298_100024192 243
110 3300001990 JGI24737J22298_10016131 JGI24737J22298_100161312 243
111 3300001990 JGI24737J22298_10022718 JGI24737J22298_100227183 243
112 3300002067 JGI24735J21928_10000013 JGI24735J21928_10000013143 243
113 3300002077 JGI24744J21845_10004442 JGI24744J21845_100044423 243
114 3300002737 JGI25162J39368_1001539 JGI25162J39368_10015398 243
115 3300002773 JGI25152J39213_1000195 JGI25152J39213_100019529 243
116 3300002774 JGI25150J39212_1000014 JGI25150J39212_100001462 243
117 3300003187 JGI25151J46595_10000042 JGI25151J46595_1000004262 243
118 3300003214 JGI25165J46597_1000157 JGI25165J46597_100015766 243
119 3300003215 JGI25153J46596_10000009 JGI25153J46596_1000000962 243
120 3300003320 rootH2_10005336 rootH2_1000533656 243
121 3300003322 rootL2_10079709 rootL2_100797093 243
122 3300003323 rootH1_10045017 rootH1_1004501710 243
123 3300005327 Ga0070658_10000028 Ga0070658_1000002877 243
124 3300005327 Ga0070658_10016538 Ga0070658_100165387 243
125 3300005327 Ga0070658_10202170 Ga0070658_102021702 243
126 3300005327 Ga0070658_10335652 Ga0070658_103356521 243
127 3300005328 Ga0070676_10005673 Ga0070676_100056739 243
128 3300005338 Ga0068868_100016528 Ga0068868_1000165284 243
129 3300005339 Ga0070660_100008501 Ga0070660_1000085018 243
130 3300005339 Ga0070660_100091625 Ga0070660_1000916252 243
131 3300005339 Ga0070660_100438031 Ga0070660_1004380312 243
132 3300005355 Ga0070671_100040707 Ga0070671_1000407072 243
133 3300005364 Ga0070673_100193355 Ga0070673_1001933551 243
134 3300005366 Ga0070659_100000648 Ga0070659_10000064822 243
135 3300005366 Ga0070659_100005000 Ga0070659_10000500011 243
136 3300005456 Ga0070678_100036410 Ga0070678_1000364104 243
137 3300005457 Ga0070662_100000014 Ga0070662_10000001448 243
138 3300005458 Ga0070681_10026227 Ga0070681_100262276 243
139 3300005459 Ga0068867_100016823 Ga0068867_1000168233 243
140 3300005530 Ga0070679_100015562 Ga0070679_1000155628 243
141 3300005539 Ga0068853_100040113 Ga0068853_1000401136 243
142 3300005548 Ga0070665_100000032 Ga0070665_100000032206 243
143 3300005563 Ga0068855_100000517 Ga0068855_10000051717 243
144 3300005563 Ga0068855_100037770 Ga0068855_1000377702 243
145 3300005563 Ga0068855_100504414 Ga0068855_1005044142 243
146 3300005577 Ga0068857_100022072 Ga0068857_1000220724 243
147 3300005614 Ga0068856_100001612 Ga0068856_10000161213 243
148 3300005614 Ga0068856_100069286 Ga0068856_1000692864 243
149 3300005616 Ga0068852_100230177 Ga0068852_1002301771 243
150 3300005616 Ga0068852_100243406 Ga0068852_1002434062 243
151 3300005616 Ga0068852_100389345 Ga0068852_1003893452 243
152 3300005840 Ga0068870_10241178 Ga0068870_102411781 243
153 3300005842 Ga0068858_100114338 Ga0068858_1001143383 243
154 3300006195 Ga0075366_10001635 Ga0075366_100016355 243
155 3300006195 Ga0075366_10001801 Ga0075366_1000180112 243
156 3300006195 Ga0075366_10013846 Ga0075366_100138464 243
157 3300006237 Ga0097621_100046671 Ga0097621_1000466715 243
158 3300006353 Ga0075370_10110569 Ga0075370_101105692 243
159 3300006353 Ga0075370_10137111 Ga0075370_101371112 243
160 3300006358 Ga0068871_100000294 Ga0068871_1000002944 243
161 3300006881 Ga0068865_100002711 Ga0068865_1000027118 243
162 3300009093 Ga0105240_10018800 Ga0105240_100188003 243
163 3300009093 Ga0105240_10071487 Ga0105240_100714874 243
164 3300009093 Ga0105240_10139990 Ga0105240_101399903 243
165 3300009093 Ga0105240_10153434 Ga0105240_101534343 243
166 3300009093 Ga0105240_10413863 Ga0105240_104138631 243
167 3300009098 Ga0105245_10252602 Ga0105245_102526021 243
168 3300009098 Ga0105245_10759930 Ga0105245_107599302 243
169 3300009174 Ga0105241_10002362 Ga0105241_100023624 243
170 3300009174 Ga0105241_10045892 Ga0105241_100458925 243
171 3300009545 Ga0105237_10003264 Ga0105237_1000326417 243
172 3300009545 Ga0105237_10005389 Ga0105237_1000538915 243
173 3300009545 Ga0105237_10011343 Ga0105237_100113431 243
174 3300009545 Ga0105237_10014149 Ga0105237_100141496 243
175 3300009545 Ga0105237_10019103 Ga0105237_100191035 243
176 3300009545 Ga0105237_10101567 Ga0105237_101015672 243
177 3300009545 Ga0105237_10216460 Ga0105237_102164602 243
178 3300009545 Ga0105237_10370132 Ga0105237_103701322 243
179 3300009545 Ga0105237_10427122 Ga0105237_104271221 243
180 3300009545 Ga0105237_10763182 Ga0105237_107631821 243
181 3300009551 Ga0105238_10042180 Ga0105238_100421806 243
182 3300009553 Ga0105249_10119283 Ga0105249_101192833 243
183 3300010375 Ga0105239_10000001 Ga0105239_10000001284 243
184 3300010375 Ga0105239_10000007 Ga0105239_10000007210 243
185 3300010375 Ga0105239_10000212 Ga0105239_1000021224 243
186 3300010375 Ga0105239_10000352 Ga0105239_1000035220 243
187 3300010375 Ga0105239_10068278 Ga0105239_100682782 243
188 3300010375 Ga0105239_10165968 Ga0105239_101659682 243
189 3300010375 Ga0105239_10230671 Ga0105239_102306712 243
190 3300010375 Ga0105239_10531440 Ga0105239_105314402 243
191 3300010375 Ga0105239_10603769 Ga0105239_106037692 243
192 3300011119 Ga0105246_10039273 Ga0105246_100392733 243
193 3300013100 Ga0157373_10000245 Ga0157373_1000024516 243
194 3300013100 Ga0157373_10003820 Ga0157373_1000382012 243
195 3300013102 Ga0157371_10002946 Ga0157371_100029468 243
196 3300013102 Ga0157371_10005024 Ga0157371_100050243 243
197 3300013102 Ga0157371_10063427 Ga0157371_100634272 243
198 3300013104 Ga0157370_10000197 Ga0157370_1000019758 243
199 3300013104 Ga0157370_10055865 Ga0157370_100558653 243
200 3300013105 Ga0157369_10014221 Ga0157369_100142214 243
201 3300013105 Ga0157369_10422700 Ga0157369_104227001 243
202 3300013296 Ga0157374_10008347 Ga0157374_100083474 243
203 3300013296 Ga0157374_10033177 Ga0157374_100331772 243
204 3300013297 Ga0157378_10196034 Ga0157378_101960343 243
205 3300013306 Ga0163162_10000010 Ga0163162_10000010256 243
206 3300013306 Ga0163162_10021091 Ga0163162_100210914 243
207 3300013307 Ga0157372_10000073 Ga0157372_1000007320 243
208 3300013307 Ga0157372_10000173 Ga0157372_1000017324 243
209 3300013307 Ga0157372_10002062 Ga0157372_100020628 243
210 3300013307 Ga0157372_10046656 Ga0157372_100466563 243
211 3300013307 Ga0157372_10122005 Ga0157372_101220051 243
212 3300013308 Ga0157375_10006292 Ga0157375_100062929 243
213 3300013308 Ga0157375_10051408 Ga0157375_100514083 243
214 3300014497 Ga0182008_10000082 Ga0182008_1000008256 243
215 3300014969 Ga0157376_10090194 Ga0157376_100901942 243
216 3300015261 Ga0182006_1000373 Ga0182006_100037327 243
217 3300021361 Ga0213872_10006185 Ga0213872_100061852 243
218 3300025231 Ga0207427_100025 Ga0207427_10002576 243
219 3300025233 Ga0209437_100010 Ga0209437_100010338 243
220 3300025233 Ga0209437_100148 Ga0209437_10014880 243
221 3300025245 Ga0207425_1000023 Ga0207425_100002361 243
222 3300025250 Ga0209026_1000498 Ga0209026_10004983 243
223 3300025258 Ga0209129_1000032 Ga0209129_1000032212 243
224 3300025261 Ga0209233_1000017 Ga0209233_1000017351 243
225 3300025261 Ga0209233_1001847 Ga0209233_10018474 243
226 3300025272 Ga0209455_1000682 Ga0209455_100068215 243
227 3300025294 Ga0209025_1000047 Ga0209025_1000047212 243
228 3300025297 Ga0209758_1000145 Ga0209758_100014561 243
229 3300025904 Ga0207647_10000680 Ga0207647_1000068010 243
230 3300025904 Ga0207647_10002110 Ga0207647_100021106 243
231 3300025907 Ga0207645_10006511 Ga0207645_100065119 243
232 3300025909 Ga0207705_10000045 Ga0207705_1000004577 243
233 3300025909 Ga0207705_10028199 Ga0207705_100281995 243
234 3300025909 Ga0207705_10552943 Ga0207705_105529432 243
235 3300025911 Ga0207654_10001057 Ga0207654_100010578 243
236 3300025911 Ga0207654_10036105 Ga0207654_100361051 243
237 3300025911 Ga0207654_10069705 Ga0207654_100697052 243
238 3300025912 Ga0207707_10002289 Ga0207707_1000228919 243
239 3300025913 Ga0207695_10040697 Ga0207695_100406975 243
240 3300025913 Ga0207695_10284278 Ga0207695_102842781 243
241 3300025914 Ga0207671_10002404 Ga0207671_1000240417 243
242 3300025914 Ga0207671_10008745 Ga0207671_100087456 243
243 3300025914 Ga0207671_10012034 Ga0207671_100120345 243
244 3300025914 Ga0207671_10013091 Ga0207671_100130915 243
245 3300025914 Ga0207671_10013851 Ga0207671_100138513 243
246 3300025914 Ga0207671_10027870 Ga0207671_100278703 243
247 3300025914 Ga0207671_10217190 Ga0207671_102171901 243
248 3300025914 Ga0207671_10255836 Ga0207671_102558362 243
249 3300025917 Ga0207660_10056787 Ga0207660_100567872 243
250 3300025919 Ga0207657_10009277 Ga0207657_100092778 243
251 3300025919 Ga0207657_10100692 Ga0207657_101006922 243
252 3300025919 Ga0207657_10614123 Ga0207657_106141231 243
253 3300025921 Ga0207652_10055108 Ga0207652_100551083 243
254 3300025924 Ga0207694_10355385 Ga0207694_103553851 243
255 3300025931 Ga0207644_10036049 Ga0207644_100360492 243
256 3300025932 Ga0207690_10000766 Ga0207690_1000076622 243
257 3300025933 Ga0207706_10000057 Ga0207706_1000005787 243
258 3300025938 Ga0207704_10000266 Ga0207704_1000026617 243
259 3300025949 Ga0207667_10000015 Ga0207667_10000015137 243
260 3300025949 Ga0207667_10000644 Ga0207667_100006449 243
261 3300025949 Ga0207667_10030806 Ga0207667_100308066 243
262 3300025949 Ga0207667_10246904 Ga0207667_102469042 243
263 3300025960 Ga0207651_10130262 Ga0207651_101302622 243
264 3300025960 Ga0207651_10373475 Ga0207651_103734751 243
265 3300025961 Ga0207712_10088408 Ga0207712_100884082 243
266 3300026023 Ga0207677_10007663 Ga0207677_100076632 243
267 3300026041 Ga0207639_10015980 Ga0207639_100159806 243
268 3300026067 Ga0207678_10033710 Ga0207678_100337105 243
269 3300026078 Ga0207702_10000165 Ga0207702_1000016579 243
270 3300026078 Ga0207702_10050819 Ga0207702_100508192 243
271 3300026089 Ga0207648_10003208 Ga0207648_100032083 243
272 3300026116 Ga0207674_10031003 Ga0207674_100310036 243
273 3300026116 Ga0207674_10335647 Ga0207674_103356472 243
274 3300026116 Ga0207674_10645153 Ga0207674_106451531 243
275 3300026121 Ga0207683_10182140 Ga0207683_101821402 243
276 3300026142 Ga0207698_10006479 Ga0207698_1000647910 243
277 3300026142 Ga0207698_10362708 Ga0207698_103627081 243
278 3300028379 Ga0268266_10000030 Ga0268266_10000030124 243
279 3300028786 Ga0307517_10022273 Ga0307517_100222737 243
280 3300028794 Ga0307515_10000376 Ga0307515_1000037683 243
281 3300028794 Ga0307515_10005206 Ga0307515_1000520619 243
282 3300028800 Ga0265338_10031931 Ga0265338_100319311 243
283 3300030745 Ga0316182_1142397 Ga0316182_11423972 243
284 3300031456 Ga0307513_10200527 Ga0307513_102005272 243
285 3300031507 Ga0307509_10123009 Ga0307509_101230091 243
286 3300031731 Ga0307405_10100153 Ga0307405_101001532 243
287 3300031911 Ga0307412_10162627 Ga0307412_101626272 243
288 3300032004 Ga0307414_10671615 Ga0307414_106716152 243
289 3300033179 Ga0307507_10003702 Ga0307507_1000370226 243
290 3300033180 Ga0307510_10000464 Ga0307510_1000046429 243
291 3300033180 Ga0307510_10269363 Ga0307510_102693631 243
292 3300037312 Ga0395899_0000887 Ga0395899_0000887_5606_6337 243
293 3300037312 Ga0395899_0007044 Ga0395899_0007044_4416_5147 243
294 3300037418 Ga0395900_0000143 Ga0395900_0000143_6774_7505 243
295 3300037418 Ga0395900_0003189 Ga0395900_0003189_9929_10660 243
296 3300037466 Ga0395898_0004789 Ga0395898_0004789_6582_7313 243
297 3300037471 Ga0395905_0000175 Ga0395905_0000175_25176_25907 243
298 3300037471 Ga0395905_0000981 Ga0395905_0000981_3189_3980 243
299 3300038443 Ga0395901_0000313 Ga0395901_0000313_22060_22791 243
300 3300038443 Ga0395901_0009480 Ga0395901_0009480_3157_3948 243
301 3300039447 Ga0436361_1115729 Ga0436361_1115729_6472_7203 243
302 3300041452 Ga0451793_1603413 Ga0451793_1603413_36_767 243
303 3300042005 Ga0439448_0003549 Ga0439448_0003549_2053_2784 243
304 3300044693 Ga0466961_0150657 Ga0466961_0150657_459_1190 243
305 3300045836 Ga0466958_0025254 Ga0466958_0025254_123_854 243
306 3300046462 Ga0495651_0035117 Ga0495651_0035117_2071_2802 243
307 3300046463 Ga0495653_0389884 Ga0495653_0389884_145_876 243
308 3300046471 Ga0495650_0000162 Ga0495650_0000162_114083_114814 243
309 3300046471 Ga0495650_0083162 Ga0495650_0083162_28_759 243
310 3300046474 Ga0495605_0132527 Ga0495605_0132527_41_772 243
311 3300046492 Ga0495585_0000153 Ga0495585_0000153_49790_50521 243
312 3300046492 Ga0495585_0000240 Ga0495585_0000240_7061_7792 243
313 3300046507 Ga0495606_0000033 Ga0495606_0000033_188028_188759 243
314 3300046507 Ga0495606_0013056 Ga0495606_0013056_451_1182 243
315 3300046507 Ga0495606_0016861 Ga0495606_0016861_611_1342 243
316 3300046507 Ga0495606_0019127 Ga0495606_0019127_1180_1911 243
317 3300046512 Ga0495610_0003961 Ga0495610_0003961_10219_10950 243
318 3300046513 Ga0495616_0003449 Ga0495616_0003449_5158_5889 243
319 3300046513 Ga0495616_0006594 Ga0495616_0006594_2457_3188 243
320 3300046516 Ga0495628_0290922 Ga0495628_0290922_425_1156 243
321 3300046518 Ga0495631_0014505 Ga0495631_0014505_1980_2711 243
322 3300046524 Ga0495648_0003060 Ga0495648_0003060_13100_13831 243
323 3300046538 Ga0495609_0006455 Ga0495609_0006455_5231_5962 243
324 3300046538 Ga0495609_0024263 Ga0495609_0024263_1000_1731 243
325 3300046558 Ga0495633_0000389 Ga0495633_0000389_20626_21357 243
326 3300046558 Ga0495633_0003181 Ga0495633_0003181_521_1252 243
327 3300046616 Ga0495668_0000009 Ga0495668_0000009_207081_207812 243
328 3300046660 Ga0495625_0000131 Ga0495625_0000131_65009_65740 243
329 3300046660 Ga0495625_0000951 Ga0495625_0000951_6501_7232 243
330 3300046660 Ga0495625_0001562 Ga0495625_0001562_17274_18005 243
331 3300046660 Ga0495625_0021497 Ga0495625_0021497_1904_2635 243
332 3300046660 Ga0495625_0082227 Ga0495625_0082227_87_929 243
333 3300046660 Ga0495625_0103961 Ga0495625_0103961_106_837 243
334 3300046660 Ga0495625_0218452 Ga0495625_0218452_448_1179 243
335 3300046663 Ga0495635_0404120 Ga0495635_0404120_82_813 243
336 3300046665 Ga0495661_0008464 Ga0495661_0008464_3120_3851 243
337 3300046665 Ga0495661_0018305 Ga0495661_0018305_3722_4453 243
338 3300046684 Ga0495669_0199724 Ga0495669_0199724_168_899 243
339 3300046694 Ga0495649_0000009 Ga0495649_0000009_65006_65737 243
340 3300046694 Ga0495649_0120644 Ga0495649_0120644_118_849 243
341 3300046809 Ga0495600_0263734 Ga0495600_0263734_299_1030 243
342 3300046810 Ga0495660_0022410 Ga0495660_0022410_2760_3491 243
343 3300047323 Ga0495683_0162832 Ga0495683_0162832_69_800 243
344 3300047443 Ga0495687_001889 Ga0495687_001889_16346_17077 243
345 3300047443 Ga0495687_004330 Ga0495687_004330_4972_5823 243
346 3300047472 Ga0495686_0000843 Ga0495686_0000843_30980_31711 243
347 3300047472 Ga0495686_0000973 Ga0495686_0000973_16468_17199 243
348 3300047472 Ga0495686_0015477 Ga0495686_0015477_4187_4918 243
349 3300047472 Ga0495686_0032769 Ga0495686_0032769_2318_3049 243
350 3300047472 Ga0495686_0067062 Ga0495686_0067062_494_1225 243
351 3300048925 Ga0496122_0000869 Ga0496122_0000869_54410_55141 243
352 3300048926 Ga0496123_0004125 Ga0496123_0004125_7060_7791 243
353 3300048928 Ga0496125_0100755 Ga0496125_0100755_427_1158 243
354 3300049663 Ga0501223_002267 Ga0501223_002267_3337_4068 243
355 3300050493 nmdc:mga0k408_293447_c1 nmdc:mga0k408_293447_c1_141_872 243
356 3300050493 nmdc:mga0k408_320_c1 nmdc:mga0k408_320_c1_24590_25321 243
357 3300050493 nmdc:mga0k408_7999_c1 nmdc:mga0k408_7999_c1_2169_2900 243
358 3300050493 nmdc:mga0k408_803_c1 nmdc:mga0k408_803_c1_7427_8158 243
359 3300053080 Ga0500635_0022075 Ga0500635_0022075_1226_1957 243
360 3300053122 Ga0500608_139927 Ga0500608_139927_246_977 243
361 3300053125 Ga0500618_000012 Ga0500618_000012_90811_91542 243
362 3300053125 Ga0500618_019770 Ga0500618_019770_439_1389 243
363 3300053153 Ga0500616_0065243 Ga0500616_0065243_240_971 243
364 3300053156 Ga0500622_0000838 Ga0500622_0000838_13248_13979 243
365 3300053157 Ga0500624_000118 Ga0500624_000118_15420_16151 243
366 iso_pu_bacteria 2977232053 2977236406 243
367 iso_pu_bacteria 3003233435 3003233644 243

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

28

259

0.97

PF08241

Methyltransf_11

Methyltransferase domain

79

177

0.97

PF13649

Methyltransf_25

Methyltransferase domain

78

173

0.95

PF08242

Methyltransf_12

Methyltransferase domain

79

175

0.88

PF02353

CMAS

Mycolic acid cyclopropane synthetase

59

215

0.84

PF01135

PCMT

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)

32

218

0.83

PF06325

PrmA

Ribosomal protein L11 methyltransferase (PrmA)

64

192

0.81

PF13847

Methyltransf_31

Methyltransferase domain

72

238

0.79

PF12147

Methyltransf_20

Putative methyltransferase

55

179

0.76

PF13489

Methyltransf_23

Methyltransferase domain

61

241

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
4obx-assembly1.cif.gz_B crystal structure of yeast coq5 in the apo form 0.9267 26 243
4obx-assembly1.cif.gz_B crystal structure of yeast coq5 in the apo form 0.8585 26 243
4dcm-assembly1.cif.gz_A crystal structure of methyltransferase rlmg modifying g1835 of 23s rrna in escherichia coli 0.8567 59 243
2gpy-assembly1.cif.gz_B crystal structure of putative o-methyltransferase from bacillus halodurans 0.8259 46 243
1dus-assembly1.cif.gz_A mj0882-a hypothetical protein from m. jannaschii 0.822 60 243
ID Description Score Start End Superfamily
af_O96145_64_353_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.955 25 243 3.40.50.150
af_P9WFR3_19_228_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9523 27 243 3.40.50.150
af_P0A887_31_251_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9475 26 243 3.40.50.150
af_Q59ZE2_70_306_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.935 26 243 3.40.50.150
af_Q2FYG5_1_193_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9348 59 243 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A3D9LGH2-F1-model_v4 Demethylmenaquinone methyltransferase (EC 2.1.1.163) 0.9912 3 243 GO:0009234
GO:0032259
GO:0043770
AF-A0A3D9LGH2-F1-model_v4 Demethylmenaquinone methyltransferase (EC 2.1.1.163) 0.975 3 243 GO:0009234
GO:0032259
GO:0043770
AF-R5W8M8-F1-model_v4 deleted 0.9734 93 243
AF-A0A7V3DFQ2-F1-model_v4 Demethylmenaquinone methyltransferase (EC 2.1.1.163) 0.973 19 243 GO:0009234
GO:0032259
GO:0043770
AF-K1U8B1-F1-model_v4 Ubiquinone/menaquinone biosynthesis methyltransferase UbiE 0.9716 2 202 GO:0008168
GO:0032259
GO:0042181

Feature Viewer

pLDDT pTM Quality
89.94 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map