F424693

General Info

Members Datasets Scaffolds Average Seq Length
368 237 736 235

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10204546|Ga0105237_102045462
Length 283
Sequence MCQQNNRFFDNPANIIRYIIPPYYKFYFAFTTGLRVYANFALSKERENMKIEIWSDVMCPFCYIGKRRFEDALQQSGHREQVEIEWKSFQLNPDIKTDPSININQYLADAKGWTLDYAAQLNDHVTQMAAEVGLTYNMDRAIVANSFNAHRFTHLAKKHGLGDAAEEALFKAYFTEGLNMDDNDTLIKLGTGIGLDAAEVKQVLESDVYADEVKYDIAQAQQLGIRGVPFFVMNNKYGVSGAQAVPVFLETIEKSFTEWQQENKKPSLTIIEGESCSPDGDCG

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
56 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
57 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
59 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
61 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
85 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
86 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
87 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
88 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
89 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
90 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
91 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
92 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
93 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
94 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
95 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
96 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
97 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
98 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
99 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
100 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
101 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
102 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
105 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
108 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
109 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
113 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
119 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
120 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
121 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
122 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
123 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
124 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
125 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
126 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
127 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
128 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
129 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
130 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
131 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
132 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
133 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
134 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
135 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
136 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
137 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
138 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
139 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
140 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
141 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
142 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
143 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
144 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
145 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
146 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
147 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
148 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
149 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
150 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
151 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
152 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
153 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
154 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
155 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
156 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
157 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
162 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
165 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
177 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
178 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
179 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
180 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
181 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
182 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
183 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
184 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
185 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
186 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
187 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
188 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
189 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
190 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
191 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
192 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
193 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
194 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
195 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
196 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
197 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
198 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
199 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
200 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
201 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
202 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
203 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
204 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
205 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
206 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
207 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
208 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
209 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
210 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
211 2738541278 Niastella sp. CF465 Isolate Unclassified
212 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
213 2818991444 Filimonas endophytica 3197 Isolate Unclassified
214 2818991459 Paenibacillus sp. 597 Isolate Unclassified
215 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
216 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
217 2842682962 Bacillus sp. R-72492 Isolate Unclassified
218 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
219 2849139964 Bacillus sp. R-71875 Isolate Unclassified
220 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
221 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
222 2857581216 Bacillus sp. R-71922 Isolate Unclassified
223 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
224 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
225 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
226 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
227 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
228 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
229 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
230 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
231 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
232 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
233 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
234 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
235 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
236 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
237 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 87.77
Metatranscriptomes 3.8
Isolates 8.42

Biome Distribution

Category Percentage (%)
Aerial Root 0.54
Bulb 0
Endosphere 14.67
Nodule 0
Rhizoplane 1.09
Rhizosphere 73.91
Stem 0
Stem Tuber 0
Unclassified 5.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10204546 3300009545 Bacteria 1975
2 JGI24740J21852_10048678 3300001979 Bacteria 1230
3 JGI24739J22299_10009576 3300001989 Bacteria 3606
4 JGI24739J22299_10020055 3300001989 Bacteria 2389
5 JGI24737J22298_10002562 3300001990 Bacteria 6450
6 JGI24735J21928_10000168 3300002067 Bacteria 23435
7 JGI25162J39368_1000047 3300002737 Viruses 167507
8 JGI25162J39368_1000183 3300002737 Bacteria 67086
9 JGI25162J39368_1000354 3300002737 Bacteria 39303
10 JGI25164J39214_1002052 3300002772 Bacteria 3496
11 JGI25165J46597_1003847 3300003214 Bacteria 3496
12 rootH2_10023142 3300003320 Bacteria 8829
13 rootL2_10127154 3300003322 Bacteria 2054
14 rootL2_10159056 3300003322 Unclassified 1251
15 rootH1_10000536 3300003323 Bacteria 87102
16 rootH1_10047748 3300003323 Bacteria 6319
17 rootH1_10217645 3300003323 Bacteria 2256
18 Ga0055535_1006151 3300003761 Bacteria 2485
19 Ga0055542_1008724 3300003762 Bacteria 1962
20 Ga0065714_10066462 3300005288 Bacteria 6804
21 Ga0070676_10191785 3300005328 Bacteria 1335
22 Ga0070690_100020467 3300005330 Bacteria 4031
23 Ga0068869_100139491 3300005334 Bacteria 1871
24 Ga0070682_100470617 3300005337 Bacteria 967
25 Ga0070669_100066339 3300005353 Bacteria 2660
26 Ga0070671_100012478 3300005355 Bacteria 6841
27 Ga0070674_100061430 3300005356 Bacteria 2622
28 Ga0070674_100115589 3300005356 Bacteria 1978
29 Ga0070673_100041724 3300005364 Bacteria 3532
30 Ga0070659_100044353 3300005366 Bacteria 3481
31 Ga0068867_100013944 3300005459 Bacteria 5689
32 Ga0068867_100043982 3300005459 Unclassified 3271
33 Ga0068853_100355702 3300005539 Bacteria 1363
34 Ga0070665_100296981 3300005548 Bacteria 1618
35 Ga0068855_100000354 3300005563 Bacteria 56753
36 Ga0068855_100038551 3300005563 Bacteria 5678
37 Ga0068855_100100270 3300005563 Bacteria 3335
38 Ga0068855_100153710 3300005563 Bacteria 2615
39 Ga0068855_100567191 3300005563 Unclassified 1227
40 Ga0068857_100006130 3300005577 Bacteria 10273
41 Ga0068854_100153777 3300005578 Bacteria 1776
42 Ga0068856_100007355 3300005614 Bacteria 10749
43 Ga0068856_100015584 3300005614 Bacteria 7349
44 Ga0068863_100204936 3300005841 Bacteria 1898
45 Ga0068860_100150787 3300005843 Bacteria 2239
46 Ga0075366_10014186 3300006195 Bacteria 4549
47 Ga0075366_10116570 3300006195 Bacteria 1608
48 Ga0075366_10268503 3300006195 Bacteria 1042
49 Ga0068871_100185125 3300006358 Bacteria 1791
50 Ga0068871_100305516 3300006358 Bacteria 1397
51 Ga0068871_100754917 3300006358 Unclassified 894
52 Ga0105240_10004395 3300009093 Bacteria 21507
53 Ga0105240_10034396 3300009093 Bacteria 6536
54 Ga0105240_10100919 3300009093 Bacteria 3511
55 Ga0105240_10304684 3300009093 Bacteria 1821
56 Ga0114129_10000949 3300009147 Bacteria 37836
57 Ga0105241_10056410 3300009174 Bacteria 3011
58 Ga0105242_10499810 3300009176 Unclassified 1156
59 Ga0105237_10001669 3300009545 Bacteria 28718
60 Ga0105237_10005136 3300009545 Bacteria 14826
61 Ga0105237_10038975 3300009545 Bacteria 4798
62 Ga0105237_10252817 3300009545 Bacteria 1764
63 Ga0105238_10159389 3300009551 Bacteria 2232
64 Ga0105249_10347273 3300009553 Unclassified 1502
65 Ga0105239_10000001 3300010375 Bacteria 617353
66 Ga0105239_10000009 3300010375 Bacteria 361182
67 Ga0105239_10000280 3300010375 Bacteria 75222
68 Ga0105239_10001876 3300010375 Bacteria 27527
69 Ga0105239_10445516 3300010375 Bacteria 1469
70 Ga0105239_11047379 3300010375 Bacteria 939
71 Ga0105246_10145232 3300011119 Bacteria 1789
72 Ga0157373_10000265 3300013100 Bacteria 42223
73 Ga0157373_10000677 3300013100 Bacteria 26683
74 Ga0157371_10001407 3300013102 Bacteria 25067
75 Ga0157371_10009488 3300013102 Bacteria 7654
76 Ga0157371_10187792 3300013102 Bacteria 1479
77 Ga0157371_10402572 3300013102 Bacteria 1002
78 Ga0157370_10091404 3300013104 Bacteria 2857
79 Ga0157370_10108385 3300013104 Bacteria 2597
80 Ga0157370_10443935 3300013104 Bacteria 1193
81 Ga0157369_10001726 3300013105 Bacteria 26600
82 Ga0157369_10067628 3300013105 Bacteria 3840
83 Ga0157369_10170383 3300013105 Bacteria 2294
84 Ga0157369_10447110 3300013105 Bacteria 1338
85 Ga0157374_10098377 3300013296 Bacteria 2801
86 Ga0157378_10002605 3300013297 Bacteria 16048
87 Ga0157378_10310912 3300013297 Bacteria 1528
88 Ga0163162_10194846 3300013306 Bacteria 2155
89 Ga0163162_10991542 3300013306 Bacteria 950
90 Ga0157372_10000071 3300013307 Bacteria 109638
91 Ga0157372_10000286 3300013307 Bacteria 56140
92 Ga0157372_10009804 3300013307 Bacteria 10187
93 Ga0157372_10015619 3300013307 Bacteria 8142
94 Ga0157372_10493151 3300013307 Bacteria 1428
95 Ga0157372_10494711 3300013307 Bacteria 1426
96 Ga0157372_10720265 3300013307 Bacteria 1161
97 Ga0157375_10026364 3300013308 Bacteria 5414
98 Ga0206351_10207955 3300020077 Bacteria 2380
99 Ga0206351_10226389 3300020077 Bacteria 1708
100 Ga0206350_10092879 3300020080 Bacteria 819
101 Ga0206350_10272693 3300020080 Bacteria 1075
102 Ga0209563_112543 3300025230 Bacteria 1155
103 Ga0207427_100025 3300025231 Bacteria 433726
104 Ga0209437_100010 3300025233 Bacteria 838447
105 Ga0209437_100089 3300025233 Bacteria 250476
106 Ga0209258_100036 3300025242 Bacteria 428859
107 Ga0209646_1001805 3300025246 Bacteria 5318
108 Ga0209148_1000139 3300025254 Bacteria 167011
109 Ga0209233_1000017 3300025261 Bacteria 898076
110 Ga0209233_1006629 3300025261 Bacteria 3717
111 Ga0209233_1044691 3300025261 Bacteria 936
112 Ga0209455_1004216 3300025272 Bacteria 4793
113 Ga0209455_1005188 3300025272 Bacteria 4082
114 Ga0209676_1000351 3300025292 Bacteria 87135
115 Ga0207688_10066846 3300025901 Bacteria 2034
116 Ga0207647_10000154 3300025904 Bacteria 54378
117 Ga0207647_10155494 3300025904 Bacteria 1335
118 Ga0207654_10005692 3300025911 Bacteria 6298
119 Ga0207695_10000019 3300025913 Bacteria 732137
120 Ga0207695_10046587 3300025913 Bacteria 4596
121 Ga0207695_10206208 3300025913 Bacteria 1878
122 Ga0207695_10264124 3300025913 Bacteria 1618
123 Ga0207695_10409156 3300025913 Bacteria 1241
124 Ga0207671_10001553 3300025914 Bacteria 26274
125 Ga0207671_10002497 3300025914 Bacteria 19633
126 Ga0207671_10004541 3300025914 Bacteria 13186
127 Ga0207671_10015286 3300025914 Bacteria 6022
128 Ga0207671_10021404 3300025914 Bacteria 4906
129 Ga0207681_10044287 3300025923 Bacteria 2982
130 Ga0207694_10117555 3300025924 Bacteria 2120
131 Ga0207644_10203295 3300025931 Bacteria 1563
132 Ga0207690_10015942 3300025932 Bacteria 4564
133 Ga0207686_10387682 3300025934 Bacteria 1061
134 Ga0207689_10063128 3300025942 Bacteria 3047
135 Ga0207667_10002952 3300025949 Bacteria 21103
136 Ga0207667_10040683 3300025949 Bacteria 4949
137 Ga0207667_10539895 3300025949 Unclassified 1180
138 Ga0207651_10029911 3300025960 Bacteria 3460
139 Ga0207640_10013937 3300025981 Bacteria 4616
140 Ga0207640_10204681 3300025981 Bacteria 1498
141 Ga0207640_10557319 3300025981 Bacteria 964
142 Ga0207639_10116351 3300026041 Bacteria 2189
143 Ga0207639_10220483 3300026041 Bacteria 1638
144 Ga0207702_10010674 3300026078 Bacteria 7674
145 Ga0207702_10015931 3300026078 Bacteria 6224
146 Ga0207641_10231168 3300026088 Bacteria 1719
147 Ga0207648_10075986 3300026089 Bacteria 2928
148 Ga0207648_10148184 3300026089 Bacteria 2070
149 Ga0207676_10200800 3300026095 Bacteria 1762
150 Ga0268266_10630186 3300028379 Bacteria 1031
151 Ga0268264_10034789 3300028381 Bacteria 4146
152 Ga0268264_10125752 3300028381 Bacteria 2265
153 Ga0265337_1003334 3300028556 Bacteria 7000
154 Ga0265326_10003302 3300028558 Bacteria 5315
155 Ga0265319_1000472 3300028563 Bacteria 28452
156 Ga0265334_10000987 3300028573 Bacteria 14101
157 Ga0265318_10004116 3300028577 Bacteria 7124
158 Ga0265322_10003102 3300028654 Bacteria 5062
159 Ga0265322_10004862 3300028654 Unclassified 3983
160 Ga0265322_10101369 3300028654 Bacteria 819
161 Ga0265336_10000072 3300028666 Bacteria 84279
162 Ga0307515_10000376 3300028794 Bacteria 109190
163 Ga0307515_10001287 3300028794 Bacteria 56974
164 Ga0265338_10000610 3300028800 Bacteria 62626
165 Ga0265338_10005582 3300028800 Bacteria 16364
166 Ga0265338_10018795 3300028800 Bacteria 7373
167 Ga0265338_10065692 3300028800 Bacteria 3145
168 Ga0265324_10000867 3300029957 Bacteria 19424
169 Ga0265324_10001358 3300029957 Bacteria 14245
170 Ga0316183_1211687 3300030742 Bacteria 37631
171 Ga0316181_1006235 3300030744 Bacteria 22254
172 Ga0265330_10098771 3300031235 Unclassified 1251
173 Ga0265332_10023316 3300031238 Unclassified 2729
174 Ga0265332_10090860 3300031238 Unclassified 1291
175 Ga0265320_10003439 3300031240 Bacteria 10647
176 Ga0265320_10008203 3300031240 Bacteria 6410
177 Ga0265325_10009747 3300031241 Bacteria 5598
178 Ga0265340_10088194 3300031247 Unclassified 1453
179 Ga0265339_10044990 3300031249 Unclassified 2432
180 Ga0265327_10026694 3300031251 Bacteria 3340
181 Ga0265316_10009111 3300031344 Bacteria 9142
182 Ga0265316_10033244 3300031344 Bacteria 4202
183 Ga0265316_10243512 3300031344 Bacteria 1322
184 Ga0265316_10661734 3300031344 Bacteria 738
185 Ga0307513_10476284 3300031456 Bacteria 969
186 Ga0307509_10074702 3300031507 Bacteria 3524
187 Ga0307509_10105669 3300031507 Bacteria 2836
188 Ga0307408_100002516 3300031548 Bacteria 12815
189 Ga0307408_100009248 3300031548 Bacteria 6495
190 Ga0265313_10000454 3300031595 Bacteria 43333
191 Ga0265314_10020368 3300031711 Bacteria 5121
192 Ga0265342_10021246 3300031712 Bacteria 4149
193 Ga0265342_10025312 3300031712 Bacteria 3734
194 Ga0307412_10001805 3300031911 Bacteria 11838
195 Ga0307416_100026301 3300032002 Bacteria 4286
196 Ga0307414_10089080 3300032004 Bacteria 2286
197 Ga0307507_10000894 3300033179 Bacteria 66220
198 Ga0395899_0000002 3300037312 Bacteria 1324310
199 Ga0395899_0000434 3300037312 Bacteria 48146
200 Ga0395899_0215361 3300037312 Bacteria 1333
201 Ga0395900_0096637 3300037418 Bacteria 3035
202 Ga0395905_0083365 3300037471 Bacteria 2995
203 Ga0395905_0202400 3300037471 Unclassified 1861
204 Ga0395905_0298906 3300037471 Bacteria 1497
205 Ga0395901_0000406 3300038443 Bacteria 51197
206 Ga0395901_0044834 3300038443 Bacteria 4587
207 Ga0395901_0289337 3300038443 Bacteria 1701
208 Ga0439436_0006859 3300041404 Bacteria 3499
209 Ga0439439_0000270 3300041406 Bacteria 8151
210 Ga0439439_0037912 3300041406 Unclassified 1243
211 Ga0439439_0052324 3300041406 Bacteria 1072
212 Ga0439439_0098578 3300041406 Unclassified 803
213 Ga0451789_1232303 3300041443 Bacteria 1260
214 Ga0451802_0482519 3300041460 Bacteria 1579
215 Ga0451849_0800626 3300041505 Bacteria 1176
216 Ga0451853_1963454 3300041512 Bacteria 896
217 Ga0451853_2929054 3300041512 Bacteria 2828
218 Ga0439449_0007473 3300042007 Bacteria 4153
219 Ga0439449_0037413 3300042007 Bacteria 1805
220 Ga0439457_001498 3300042014 Bacteria 7001
221 Ga0439462_0000325 3300042015 Bacteria 8914
222 Ga0439462_0003747 3300042015 Bacteria 3667
223 Ga0451577_0009135 3300042876 Bacteria 9565
224 Ga0466969_0000533 3300044656 Bacteria 20932
225 Ga0466972_0000032 3300044658 Bacteria 159445
226 Ga0466972_0003078 3300044658 Bacteria 8263
227 Ga0466972_0014019 3300044658 Bacteria 4019
228 Ga0453683_0021309 3300044673 Bacteria 4139
229 Ga0453683_0025166 3300044673 Bacteria 3782
230 Ga0466966_0060451 3300044684 Bacteria 2391
231 Ga0466961_0122258 3300044693 Bacteria 1634
232 Ga0466964_0143050 3300044706 Bacteria 1101
233 Ga0453684_0002477 3300044712 Bacteria 44621
234 Ga0453684_0021879 3300044712 Bacteria 9517
235 Ga0453684_0473294 3300044712 Bacteria 1391
236 Ga0466957_0005672 3300044842 Bacteria 7017
237 Ga0466957_0011333 3300044842 Bacteria 5141
238 Ga0466959_0000050 3300045049 Bacteria 83281
239 Ga0451576_0069270 3300045051 Bacteria 3671
240 Ga0466958_0091197 3300045836 Bacteria 1886
241 Ga0495627_003314 3300046453 Bacteria 7184
242 Ga0495627_026070 3300046453 Unclassified 1889
243 Ga0495641_0191786 3300046461 Bacteria 916
244 Ga0495650_0000198 3300046471 Bacteria 130455
245 Ga0495585_0000305 3300046492 Bacteria 48998
246 Ga0495585_0000354 3300046492 Bacteria 44420
247 Ga0495583_0044725 3300046506 Bacteria 2052
248 Ga0495606_0000003 3300046507 Bacteria 449402
249 Ga0495606_0012899 3300046507 Bacteria 6651
250 Ga0495610_0000845 3300046512 Bacteria 28519
251 Ga0495616_0006908 3300046513 Bacteria 6835
252 Ga0495616_0008466 3300046513 Bacteria 6093
253 Ga0495648_0015304 3300046524 Bacteria 5576
254 Ga0495648_0060900 3300046524 Bacteria 2243
255 Ga0495648_0177404 3300046524 Bacteria 1086
256 Ga0495652_0496212 3300046529 Bacteria 847
257 Ga0495609_0011194 3300046538 Bacteria 4280
258 Ga0495622_0051558 3300046557 Bacteria 1909
259 Ga0495633_0000019 3300046558 Bacteria 233769
260 Ga0495633_0000273 3300046558 Bacteria 60402
261 Ga0495633_0002488 3300046558 Bacteria 12989
262 Ga0495668_0000010 3300046616 Bacteria 487308
263 Ga0495668_0134563 3300046616 Bacteria 1353
264 Ga0495625_0000932 3300046660 Bacteria 39330
265 Ga0495625_0002022 3300046660 Bacteria 22834
266 Ga0495625_0020041 3300046660 Bacteria 5169
267 Ga0495625_0052706 3300046660 Bacteria 2912
268 Ga0495661_0003432 3300046665 Bacteria 11697
269 Ga0495661_0004275 3300046665 Bacteria 10378
270 Ga0495661_0065435 3300046665 Bacteria 2142
271 Ga0495649_0000951 3300046694 Bacteria 22848
272 Ga0495600_0046841 3300046809 Bacteria 2820
273 Ga0495687_069759 3300047443 Bacteria 1413
274 Ga0495687_070221 3300047443 Bacteria 1407
275 Ga0495686_0000283 3300047472 Bacteria 89298
276 Ga0495686_0001745 3300047472 Bacteria 22306
277 Ga0495686_0089110 3300047472 Bacteria 1875
278 Ga0495686_0154737 3300047472 Bacteria 1344
279 Ga0495686_0185298 3300047472 Bacteria 1203
280 Ga0495614_0016986 3300048089 Bacteria 3163
281 Ga0496110_0003777 3300048913 Bacteria 11663
282 Ga0496124_0054700 3300048927 Bacteria 3377
283 Ga0501306_001070 3300049127 Bacteria 2440
284 Ga0501306_001160 3300049127 Bacteria 2385
285 Ga0501305_001234 3300049161 Bacteria 2453
286 Ga0501305_036683 3300049161 Bacteria 785
287 Ga0495678_003071 3300049459 Bacteria 10596
288 Ga0501312_004998 3300049528 Bacteria 1590
289 Ga0501313_001196 3300049529 Bacteria 2166
290 Ga0501314_003047 3300049530 Bacteria 1333
291 Ga0501316_010819 3300049532 Bacteria 1043
292 Ga0501334_01982 3300049550 Bacteria 1182
293 Ga0501335_000526 3300049551 Bacteria 2501
294 Ga0501033_0315011 3300049570 Unclassified 1100
295 Ga0501034_0020055 3300049571 Bacteria 6828
296 Ga0501034_0220185 3300049571 Bacteria 1851
297 Ga0501040_0144159 3300049576 Bacteria 1678
298 Ga0501043_0158586 3300049579 Bacteria 1769
299 Ga0501043_0188631 3300049579 Bacteria 1604
300 Ga0501047_0145183 3300049581 Bacteria 2250
301 Ga0501223_000535 3300049663 Bacteria 9165
302 Ga0501238_012714 3300049671 Bacteria 1142
303 Ga0501257_040495 3300049686 Bacteria 1143
304 Ga0501225_0003088 3300049705 Bacteria 5087
305 Ga0501044_0129517 3300049823 Bacteria 2518
306 nmdc:mga0k408_169753_c1 3300050493 Bacteria 1300
307 nmdc:mga0k408_18364_c1 3300050493 Bacteria 3903
308 nmdc:mga0k408_185466_c1 3300050493 Bacteria 1241
309 Ga0500635_0001000 3300053080 Bacteria 6779
310 Ga0500578_0000001 3300053086 Bacteria 317120
311 Ga0500578_0166045 3300053086 Bacteria 1367
312 Ga0500578_0369421 3300053086 Bacteria 834
313 Ga0500644_0000332 3300053088 Bacteria 24138
314 Ga0500583_0000013 3300053092 Bacteria 150087
315 Ga0500583_0013370 3300053092 Bacteria 3173
316 Ga0500651_0022475 3300053093 Unclassified 3939
317 Ga0500650_0097248 3300053098 Bacteria 1378
318 Ga0500555_013666 3300053103 Bacteria 2343
319 Ga0500556_0033747 3300053104 Bacteria 1757
320 Ga0500569_000892 3300053109 Bacteria 5328
321 Ga0500594_0010534 3300053118 Bacteria 2148
322 Ga0500608_029980 3300053122 Bacteria 2576
323 Ga0500614_013841 3300053123 Bacteria 1778
324 Ga0500618_000127 3300053125 Bacteria 62903
325 Ga0500658_0006478 3300053134 Bacteria 4341
326 Ga0500561_0014948 3300053137 Bacteria 1713
327 Ga0500577_0202126 3300053142 Bacteria 857
328 Ga0500590_156139 3300053148 Bacteria 1023
329 Ga0500604_0008241 3300053151 Bacteria 2763
330 Ga0500616_0018085 3300053153 Bacteria 3988
331 Ga0500622_0151392 3300053156 Bacteria 1096
332 Ga0500624_000407 3300053157 Bacteria 13297
333 Ga0500633_0002014 3300053160 Bacteria 4057
334 Ga0500636_0011690 3300053177 Bacteria 5139
335 Ga0500636_0218181 3300053177 Bacteria 996
336 Ga0500637_0362308 3300053178 Bacteria 767
337 Ga0500611_000314 3300053727 Bacteria 5061
338 2522548256 2522125168 Bacteria 7376607
339 2524190706 2524023129 Bacteria 6762600
340 2599479041 2599185184 Bacteria 6430550
341 2672337445 2671180330 Bacteria 5521719
342 2738728769 2738541278 Bacteria 9755573
343 2816862141 2816332186 Bacteria 5331395
344 2819585790 2818991444 Bacteria 6968812
345 2819673238 2818991459 Bacteria 8736032
346 2819678089 2818991460 Bacteria 7595395
347 2839990932 2839989709 Bacteria 3773432
348 2842684947 2842682962 Bacteria 5589973
349 2842904691 2842903701 Bacteria 6986368
350 2849141505 2849139964 Bacteria 5613304
351 2852626993 2852623160 Bacteria 4376875
352 2857459678 2857453340 Bacteria 8090534
353 2857584072 2857581216 Bacteria 5522813
354 2884792933 2884791551 Bacteria 8511252
355 2884935830 2884933994 Bacteria 4535041
356 2911139147 2911138879 Bacteria 5811561
357 2919442672 2919437846 Bacteria 6199444
358 2928082648 2928078545 Bacteria 6534839
359 2928148769 2928147474 Bacteria 6512076
360 2929244146 2929239360 Bacteria 7745570
361 2932086435 2932082852 Bacteria 6563563
362 2945983608 2945977869 Bacteria 7777518
363 2946017004 2946013367 Bacteria 7766675
364 2971412793 2971410472 Bacteria 8311090
365 2977233578 2977232053 Bacteria 5485925
366 2984530008 2984527788 Bacteria 5288478
367 2984536113 2984532647 Bacteria 5288506
368 8056534894 8056533031 Bacteria 8964429
369 Ga0105237_10204546
370 JGI24740J21852_10048678
371 JGI24739J22299_10009576
372 JGI24739J22299_10020055
373 JGI24737J22298_10002562
374 JGI24735J21928_10000168
375 JGI25162J39368_1000047
376 JGI25162J39368_1000183
377 JGI25162J39368_1000354
378 JGI25164J39214_1002052
379 JGI25165J46597_1003847
380 rootH2_10023142
381 rootL2_10127154
382 rootL2_10159056
383 rootH1_10000536
384 rootH1_10047748
385 rootH1_10217645
386 Ga0055535_1006151
387 Ga0055542_1008724
388 Ga0065714_10066462
389 Ga0070676_10191785
390 Ga0070690_100020467
391 Ga0068869_100139491
392 Ga0070682_100470617
393 Ga0070669_100066339
394 Ga0070671_100012478
395 Ga0070674_100061430
396 Ga0070674_100115589
397 Ga0070673_100041724
398 Ga0070659_100044353
399 Ga0068867_100013944
400 Ga0068867_100043982
401 Ga0068853_100355702
402 Ga0070665_100296981
403 Ga0068855_100000354
404 Ga0068855_100038551
405 Ga0068855_100100270
406 Ga0068855_100153710
407 Ga0068855_100567191
408 Ga0068857_100006130
409 Ga0068854_100153777
410 Ga0068856_100007355
411 Ga0068856_100015584
412 Ga0068863_100204936
413 Ga0068860_100150787
414 Ga0075366_10014186
415 Ga0075366_10116570
416 Ga0075366_10268503
417 Ga0068871_100185125
418 Ga0068871_100305516
419 Ga0068871_100754917
420 Ga0105240_10004395
421 Ga0105240_10034396
422 Ga0105240_10100919
423 Ga0105240_10304684
424 Ga0114129_10000949
425 Ga0105241_10056410
426 Ga0105242_10499810
427 Ga0105237_10001669
428 Ga0105237_10005136
429 Ga0105237_10038975
430 Ga0105237_10252817
431 Ga0105238_10159389
432 Ga0105249_10347273
433 Ga0105239_10000001
434 Ga0105239_10000009
435 Ga0105239_10000280
436 Ga0105239_10001876
437 Ga0105239_10445516
438 Ga0105239_11047379
439 Ga0105246_10145232
440 Ga0157373_10000265
441 Ga0157373_10000677
442 Ga0157371_10001407
443 Ga0157371_10009488
444 Ga0157371_10187792
445 Ga0157371_10402572
446 Ga0157370_10091404
447 Ga0157370_10108385
448 Ga0157370_10443935
449 Ga0157369_10001726
450 Ga0157369_10067628
451 Ga0157369_10170383
452 Ga0157369_10447110
453 Ga0157374_10098377
454 Ga0157378_10002605
455 Ga0157378_10310912
456 Ga0163162_10194846
457 Ga0163162_10991542
458 Ga0157372_10000071
459 Ga0157372_10000286
460 Ga0157372_10009804
461 Ga0157372_10015619
462 Ga0157372_10493151
463 Ga0157372_10494711
464 Ga0157372_10720265
465 Ga0157375_10026364
466 Ga0206351_10207955
467 Ga0206351_10226389
468 Ga0206350_10092879
469 Ga0206350_10272693
470 Ga0209563_112543
471 Ga0207427_100025
472 Ga0209437_100010
473 Ga0209437_100089
474 Ga0209258_100036
475 Ga0209646_1001805
476 Ga0209148_1000139
477 Ga0209233_1000017
478 Ga0209233_1006629
479 Ga0209233_1044691
480 Ga0209455_1004216
481 Ga0209455_1005188
482 Ga0209676_1000351
483 Ga0207688_10066846
484 Ga0207647_10000154
485 Ga0207647_10155494
486 Ga0207654_10005692
487 Ga0207695_10000019
488 Ga0207695_10046587
489 Ga0207695_10206208
490 Ga0207695_10264124
491 Ga0207695_10409156
492 Ga0207671_10001553
493 Ga0207671_10002497
494 Ga0207671_10004541
495 Ga0207671_10015286
496 Ga0207671_10021404
497 Ga0207681_10044287
498 Ga0207694_10117555
499 Ga0207644_10203295
500 Ga0207690_10015942
501 Ga0207686_10387682
502 Ga0207689_10063128
503 Ga0207667_10002952
504 Ga0207667_10040683
505 Ga0207667_10539895
506 Ga0207651_10029911
507 Ga0207640_10013937
508 Ga0207640_10204681
509 Ga0207640_10557319
510 Ga0207639_10116351
511 Ga0207639_10220483
512 Ga0207702_10010674
513 Ga0207702_10015931
514 Ga0207641_10231168
515 Ga0207648_10075986
516 Ga0207648_10148184
517 Ga0207676_10200800
518 Ga0268266_10630186
519 Ga0268264_10034789
520 Ga0268264_10125752
521 Ga0265337_1003334
522 Ga0265326_10003302
523 Ga0265319_1000472
524 Ga0265334_10000987
525 Ga0265318_10004116
526 Ga0265322_10003102
527 Ga0265322_10004862
528 Ga0265322_10101369
529 Ga0265336_10000072
530 Ga0307515_10000376
531 Ga0307515_10001287
532 Ga0265338_10000610
533 Ga0265338_10005582
534 Ga0265338_10018795
535 Ga0265338_10065692
536 Ga0265324_10000867
537 Ga0265324_10001358
538 Ga0316183_1211687
539 Ga0316181_1006235
540 Ga0265330_10098771
541 Ga0265332_10023316
542 Ga0265332_10090860
543 Ga0265320_10003439
544 Ga0265320_10008203
545 Ga0265325_10009747
546 Ga0265340_10088194
547 Ga0265339_10044990
548 Ga0265327_10026694
549 Ga0265316_10009111
550 Ga0265316_10033244
551 Ga0265316_10243512
552 Ga0265316_10661734
553 Ga0307513_10476284
554 Ga0307509_10074702
555 Ga0307509_10105669
556 Ga0307408_100002516
557 Ga0307408_100009248
558 Ga0265313_10000454
559 Ga0265314_10020368
560 Ga0265342_10021246
561 Ga0265342_10025312
562 Ga0307412_10001805
563 Ga0307416_100026301
564 Ga0307414_10089080
565 Ga0307507_10000894
566 Ga0395899_0000002
567 Ga0395899_0000434
568 Ga0395899_0215361
569 Ga0395900_0096637
570 Ga0395905_0083365
571 Ga0395905_0202400
572 Ga0395905_0298906
573 Ga0395901_0000406
574 Ga0395901_0044834
575 Ga0395901_0289337
576 Ga0439436_0006859
577 Ga0439439_0000270
578 Ga0439439_0037912
579 Ga0439439_0052324
580 Ga0439439_0098578
581 Ga0451789_1232303
582 Ga0451802_0482519
583 Ga0451849_0800626
584 Ga0451853_1963454
585 Ga0451853_2929054
586 Ga0439449_0007473
587 Ga0439449_0037413
588 Ga0439457_001498
589 Ga0439462_0000325
590 Ga0439462_0003747
591 Ga0451577_0009135
592 Ga0466969_0000533
593 Ga0466972_0000032
594 Ga0466972_0003078
595 Ga0466972_0014019
596 Ga0453683_0021309
597 Ga0453683_0025166
598 Ga0466966_0060451
599 Ga0466961_0122258
600 Ga0466964_0143050
601 Ga0453684_0002477
602 Ga0453684_0021879
603 Ga0453684_0473294
604 Ga0466957_0005672
605 Ga0466957_0011333
606 Ga0466959_0000050
607 Ga0451576_0069270
608 Ga0466958_0091197
609 Ga0495627_003314
610 Ga0495627_026070
611 Ga0495641_0191786
612 Ga0495650_0000198
613 Ga0495585_0000305
614 Ga0495585_0000354
615 Ga0495583_0044725
616 Ga0495606_0000003
617 Ga0495606_0012899
618 Ga0495610_0000845
619 Ga0495616_0006908
620 Ga0495616_0008466
621 Ga0495648_0015304
622 Ga0495648_0060900
623 Ga0495648_0177404
624 Ga0495652_0496212
625 Ga0495609_0011194
626 Ga0495622_0051558
627 Ga0495633_0000019
628 Ga0495633_0000273
629 Ga0495633_0002488
630 Ga0495668_0000010
631 Ga0495668_0134563
632 Ga0495625_0000932
633 Ga0495625_0002022
634 Ga0495625_0020041
635 Ga0495625_0052706
636 Ga0495661_0003432
637 Ga0495661_0004275
638 Ga0495661_0065435
639 Ga0495649_0000951
640 Ga0495600_0046841
641 Ga0495687_069759
642 Ga0495687_070221
643 Ga0495686_0000283
644 Ga0495686_0001745
645 Ga0495686_0089110
646 Ga0495686_0154737
647 Ga0495686_0185298
648 Ga0495614_0016986
649 Ga0496110_0003777
650 Ga0496124_0054700
651 Ga0501306_001070
652 Ga0501306_001160
653 Ga0501305_001234
654 Ga0501305_036683
655 Ga0495678_003071
656 Ga0501312_004998
657 Ga0501313_001196
658 Ga0501314_003047
659 Ga0501316_010819
660 Ga0501334_01982
661 Ga0501335_000526
662 Ga0501033_0315011
663 Ga0501034_0020055
664 Ga0501034_0220185
665 Ga0501040_0144159
666 Ga0501043_0158586
667 Ga0501043_0188631
668 Ga0501047_0145183
669 Ga0501223_000535
670 Ga0501238_012714
671 Ga0501257_040495
672 Ga0501225_0003088
673 Ga0501044_0129517
674 nmdc:mga0k408_169753_c1
675 nmdc:mga0k408_18364_c1
676 nmdc:mga0k408_185466_c1
677 Ga0500635_0001000
678 Ga0500578_0000001
679 Ga0500578_0166045
680 Ga0500578_0369421
681 Ga0500644_0000332
682 Ga0500583_0000013
683 Ga0500583_0013370
684 Ga0500651_0022475
685 Ga0500650_0097248
686 Ga0500555_013666
687 Ga0500556_0033747
688 Ga0500569_000892
689 Ga0500594_0010534
690 Ga0500608_029980
691 Ga0500614_013841
692 Ga0500618_000127
693 Ga0500658_0006478
694 Ga0500561_0014948
695 Ga0500577_0202126
696 Ga0500590_156139
697 Ga0500604_0008241
698 Ga0500616_0018085
699 Ga0500622_0151392
700 Ga0500624_000407
701 Ga0500633_0002014
702 Ga0500636_0011690
703 Ga0500636_0218181
704 Ga0500637_0362308
705 Ga0500611_000314
706 2522548256
707 2524190706
708 2599479041
709 2672337445
710 2738728769
711 2816862141
712 2819585790
713 2819673238
714 2819678089
715 2839990932
716 2842684947
717 2842904691
718 2849141505
719 2852626993
720 2857459678
721 2857584072
722 2884792933
723 2884935830
724 2911139147
725 2919442672
726 2928082648
727 2928148769
728 2929244146
729 2932086435
730 2945983608
731 2946017004
732 2971412793
733 2977233578
734 2984530008
735 2984536113
736 8056534894

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01323

DSBA

DSBA-like thioredoxin domain

50

253

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xwh-assembly1.cif.gz_A structure of frne, a novel disulfide oxidoreductase from deinococcus radiodurans crystallized in the presence of gsh 0.9278 2 225
5cnw-assembly1.cif.gz_A crystal structure of a novel disulfide oxidoreductase from deinococcus radiodurans 0.9258 2 225
5xwh-assembly1.cif.gz_A structure of frne, a novel disulfide oxidoreductase from deinococcus radiodurans crystallized in the presence of gsh 0.9079 2 225
5cnw-assembly1.cif.gz_A crystal structure of a novel disulfide oxidoreductase from deinococcus radiodurans 0.902 2 225
5y1a-assembly1.cif.gz_A hbp35 of porphyromonas gingivalis 0.9015 2 41
ID Description Score Start End Superfamily
5xwhA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9788 2 206 3.40.30.10
5xwhA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9558 2 206 3.40.30.10
3gl5A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9132 1 207 3.40.30.10
3gl5A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9049 1 207 3.40.30.10
af_I1KWJ3_9_211_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8902 2 206 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A4Y8SHE3-F1-model_v4 DsbA family oxidoreductase 0.9991 1 214 GO:0016491
AF-A0A521G9U2-F1-model_v4 DsbA family oxidoreductase 0.9963 1 209 GO:0016491
AF-A0A0P0NH03-F1-model_v4 Disulfide bond formation protein DsbA 0.9947 1 210 GO:0016491
AF-A0A4Y8SHE3-F1-model_v4 DsbA family oxidoreductase 0.9944 1 214 GO:0016491
AF-A0A2T5JEQ9-F1-model_v4 Putative DsbA family dithiol-disulfide isomerase 0.9943 2 209 GO:0016491
GO:0016853

Map